Mercurial > repos > bgruening > augustus_training

comparison test-data/human_augustus_utr-on.gff @ 5:7be22100e5e1 draft

Find changesets by keywords (author, files, the commit message), revision number or hash, or revset expression.
"planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/augustus commit bba7f5df059fcbeb06e89cf689e9a04d4f22cb76"
author iuc
date Thu, 15 Jul 2021 17:16:33 +0000
parents 6519ebe25019
children
comparison
equal deleted inserted replaced
4:6519ebe25019 5:7be22100e5e1
1 ##gff-version 3 1 ##gff-version 3
2 # This output was generated with AUGUSTUS (version 3.3.3). 2 # This output was generated with AUGUSTUS (version 3.4.0).
3 # AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de), 3 # AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de),
4 # O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff. 4 # O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff.
5 # Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008), 5 # Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008),
6 # Using native and syntenically mapped cDNA alignments to improve de novo gene finding 6 # Using native and syntenically mapped cDNA alignments to improve de novo gene finding
7 # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013 7 # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013
8 # No extrinsic information on sequences given. 8 # No extrinsic information on sequences given.
9 # Initializing the parameters using config directory /home/abretaud/miniconda3/envs/__augustus@3.3.3/config/ ... 9 # Initializing the parameters using config directory /usr/local/config/ ...
10 # human version. Using default transition matrix. 10 # human version. Using default transition matrix.
11 # Looks like /tmp/tmpTS0N1X/files/c/2/9/dataset_c29ecb21-0612-4152-8d35-994815171865.dat is in fasta format. 11 # Looks like /tmp/tmpb49zmbej/files/e/0/1/dataset_e0109fd4-ac59-4275-90d3-25691349bc0c.dat is in fasta format.
12 # We have hints for 0 sequences and for 0 of the sequences in the input set. 12 # We have hints for 0 sequences and for 0 of the sequences in the input set.
13 # 13 #
14 # ----- prediction on sequence number 1 (length = 9453, name = HS04636) ----- 14 # ----- prediction on sequence number 1 (length = 9453, name = HS04636) -----
15 # 15 #
16 # Predicted genes for sequence number 1 on both strands 16 # Predicted genes for sequence number 1 on both strands
101 # WQVRQLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQF 101 # WQVRQLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQF
102 # HVLDGECTAGASMAAW] 102 # HVLDGECTAGASMAAW]
103 # end gene HS08198.g2 103 # end gene HS08198.g2
104 ### 104 ###
105 # command line: 105 # command line:
106 # augustus --strand=both --noInFrameStop=false --gff3=on --uniqueGeneId=true --protein=on --codingseq=on --introns=off --stop=off --stop=off --cds=on --singlestrand=false /tmp/tmpTS0N1X/files/c/2/9/dataset_c29ecb21-0612-4152-8d35-994815171865.dat --UTR=on --genemodel=complete --species=human 106 # augustus --strand=both --noInFrameStop=false --gff3=on --uniqueGeneId=true --protein=on --codingseq=on --introns=off --stop=off --stop=off --cds=on --singlestrand=false /tmp/tmpb49zmbej/files/e/0/1/dataset_e0109fd4-ac59-4275-90d3-25691349bc0c.dat --UTR=on --genemodel=complete --softmasking=0 --species=human