Mercurial > repos > bgruening > augustus_training
view extract_features.py @ 5:7be22100e5e1 draft
"planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/augustus commit bba7f5df059fcbeb06e89cf689e9a04d4f22cb76"
author | iuc |
---|---|
date | Thu, 15 Jul 2021 17:16:33 +0000 |
parents | 86c89c3bd99d |
children |
line wrap: on
line source
#!/usr/bin/env python import argparse import sys import textwrap def main(args): """ Extract the protein and coding section from an augustus gff, gtf file Example file: HS04636 AUGUSTUS stop_codon 6901 6903 . + 0 Parent=g1.t1 HS04636 AUGUSTUS transcription_end_site 8857 8857 . + . Parent=g1.t1 # protein sequence = [MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYIL # THFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPD # PQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVG # QEVFGLVPGLMMYATIWLREHNRVCDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQNRIAAEFNTLYH # WHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRVAGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGE # KEMSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSV # PDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL] # end gene g1 ### # # ----- prediction on sequence number 2 (length = 2344, name = HS08198) ----- # # Predicted genes for sequence number 2 on both strands # start gene g2 HS08198 AUGUSTUS gene 86 2344 1 + . ID=g2 HS08198 AUGUSTUS transcript 86 2344 . + . ID=g2.t1;Parent=g2 HS08198 AUGUSTUS transcription_start_site 86 86 . + . Parent=g2.t1 HS08198 AUGUSTUS exon 86 582 . + . Parent=g2.t1 HS08198 AUGUSTUS start_codon 445 447 . + 0 Parent=g2.t1 """ protein_seq = "" coding_seq = "" if args.protein: po = open(args.protein, "w+") if args.codingseq: co = open(args.codingseq, "w+") for line in sys.stdin: # protein- and coding-sequence are stored as comments if line.startswith("#"): line = line[2:].strip() if line.startswith("start gene"): gene_name = line[11:].strip() if protein_seq: if line.endswith("]"): protein_seq += line[:-1] po.write( ">%s\n%s\n" % (gene_name, "\n".join(textwrap.wrap(protein_seq, 80))) ) protein_seq = "" else: protein_seq += line if coding_seq: if line.endswith("]"): coding_seq += line[:-1] co.write( ">%s\n%s\n" % (gene_name, "\n".join(textwrap.wrap(coding_seq, 80))) ) coding_seq = "" else: coding_seq += line if args.protein and line.startswith("protein sequence = ["): if line.endswith("]"): protein_seq = line[20:-1] po.write( ">%s\n%s\n" % (gene_name, "\n".join(textwrap.wrap(protein_seq, 80))) ) protein_seq = "" else: line = line[20:] protein_seq = line if args.codingseq and line.startswith("coding sequence = ["): if line.endswith("]"): coding_seq = line[19:-1] co.write( ">%s\n%s\n" % (gene_name, "\n".join(textwrap.wrap(coding_seq, 80))) ) coding_seq = "" else: line = line[19:] coding_seq = line if args.codingseq: co.close() if args.protein: po.close() if __name__ == "__main__": parser = argparse.ArgumentParser() parser.add_argument("-p", "--protein", help="Path to the protein file.") parser.add_argument("-c", "--codingseq", help="Path to the coding file.") args = parser.parse_args() main(args)