diff extract_features.py @ 5:a4fab0c1ae1a

Uploaded
author bjoern-gruening
date Sun, 09 Jun 2013 07:54:25 -0400
parents
children
line wrap: on
line diff
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/extract_features.py	Sun Jun 09 07:54:25 2013 -0400
@@ -0,0 +1,93 @@
+#!/usr/bin/env python
+
+import os
+import sys
+import argparse
+import textwrap
+
+def main( args ):
+    """
+    Extract the protein and coding section from an augustus gff, gtf file
+    Example file:
+HS04636	AUGUSTUS	stop_codon	6901	6903	.	+	0	Parent=g1.t1
+HS04636	AUGUSTUS	transcription_end_site	8857	8857	.	+	.	Parent=g1.t1
+# protein sequence = [MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYIL
+# THFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPD
+# PQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVG
+# QEVFGLVPGLMMYATIWLREHNRVCDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQNRIAAEFNTLYH
+# WHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRVAGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGE
+# KEMSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSV
+# PDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL]
+# end gene g1
+###
+#
+# ----- prediction on sequence number 2 (length = 2344, name = HS08198) -----
+#
+# Predicted genes for sequence number 2 on both strands
+# start gene g2
+HS08198	AUGUSTUS	gene	86	2344	1	+	.	ID=g2
+HS08198	AUGUSTUS	transcript	86	2344	.	+	.	ID=g2.t1;Parent=g2
+HS08198	AUGUSTUS	transcription_start_site	86	86	.	+	.	Parent=g2.t1
+HS08198	AUGUSTUS	exon	86	582	.	+	.	Parent=g2.t1
+HS08198	AUGUSTUS	start_codon	445	447	.	+	0	Parent=g2.t1
+    """
+    protein_seq = ''
+    coding_seq = ''
+    if args.protein:
+        po = open( args.protein, 'w+' )
+    if args.codingseq:
+        co = open( args.codingseq, 'w+' )
+
+    for line in sys.stdin:
+        # protein- and coding-sequence are stored as comments
+        if line.startswith('#'):
+            line = line[2:].strip()
+            if line.startswith('start gene'):
+                gene_name = line[11:].strip()
+
+            if args.protein and line.startswith('protein sequence = ['):
+                if line.endswith(']'):
+                    protein_seq = line[20:-1]
+                    po.write( '>%s\n%s\n' % (gene_name, '\n'.join( textwrap.wrap( protein_seq, 80 ) ) ) )
+                    protein_seq = ''
+                else:
+                    line = line[20:]
+                    protein_seq = line
+
+            if args.codingseq and line.startswith('coding sequence = ['):
+                if line.endswith(']'):
+                    coding_seq = line[19:-1]
+                    co.write( '>%s\n%s\n' % (gene_name, '\n'.join( textwrap.wrap( coding_seq, 80 ) ) ) )
+                    coding_seq = ''
+                else:
+                    line = line[19:]
+                    coding_seq = line
+
+            if protein_seq:
+                if line.endswith(']'):
+                    protein_seq += line[:-1]
+                    po.write( '>%s\n%s\n' % (gene_name, '\n'.join( textwrap.wrap( protein_seq, 80 ) ) ) )
+                    protein_seq = ''
+                else:
+                    protein_seq += line
+
+            if coding_seq:
+                if line.endswith(']'):
+                    coding_seq += line[:-1]
+                    co.write( '>%s\n%s\n' % (gene_name, '\n'.join( textwrap.wrap( coding_seq, 80 ) ) ) )
+                    coding_seq = ''
+                else:
+                    coding_seq += line
+    if args.codingseq:
+        co.close()
+    if args.protein:
+        po.close()
+
+if __name__ == '__main__':
+    parser = argparse.ArgumentParser()
+    parser.add_argument('-p', '--protein', help='Path to the protein file.')
+    parser.add_argument('-c', '--codingseq', help='Path to the coding file.')
+
+    args = parser.parse_args()
+    main( args )
+