Mercurial > repos > cpt > cpt_putative_isp
view generate-putative-isp.py @ 1:4e02e6e9e77d draft
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
author | cpt |
---|---|
date | Mon, 05 Jun 2023 02:51:35 +0000 |
parents | |
children |
line wrap: on
line source
#!/usr/bin/env python ##### findSpanin.pl --> findSpanin.py ######### Incooperated from the findSpanin.pl script, but better and more snakey. import argparse from cpt import OrfFinder from Bio import SeqIO from Bio import Seq import re from spaninFuncs import * import os # if __name__ == '__main__': # pass ############################################################################### if __name__ == "__main__": # Common parameters for both ISP / OSP portion of script parser = argparse.ArgumentParser( description="Get putative protein candidates for spanins" ) parser.add_argument( "fasta_file", type=argparse.FileType("r"), help="Fasta file" ) # the "input" argument parser.add_argument( "-f", "--format", dest="seq_format", default="fasta", help="Sequence format (e.g. fasta, fastq, sff)", ) # optional formats for input, currently just going to do ntFASTA parser.add_argument( "--strand", dest="strand", choices=("both", "forward", "reverse"), default="both", help="select strand", ) # Selection of +, -, or both strands parser.add_argument( "--table", dest="table", default=11, help="NCBI Translation table", type=int ) # Uses "default" NCBI codon table. This should always (afaik) be what we want... parser.add_argument( "-t", "--ftype", dest="ftype", choices=("CDS", "ORF"), default="ORF", help="Find ORF or CDSs", ) # "functional type(?)" --> Finds ORF or CDS, for this we want just the ORF parser.add_argument( "-e", "--ends", dest="ends", choices=("open", "closed"), default="closed", help="Open or closed. Closed ensures start/stop codons are present", ) # includes the start and stop codon parser.add_argument( "-m", "--mode", dest="mode", choices=("all", "top", "one"), default="all", # I think we want this to JUST be all...nearly always help="Output all ORFs/CDSs from sequence, all ORFs/CDSs with max length, or first with maximum length", ) parser.add_argument( "--switch", dest="switch", default="all", help="switch between ALL putative osps, or a range. If not all, insert a range of two integers separated by a colon (:). Eg: 1234:4321", ) # isp parameters parser.add_argument( "--isp_min_len", dest="isp_min_len", default=60, help="Minimum ORF length, measured in codons", type=int, ) parser.add_argument( "--isp_on", dest="out_isp_nuc", type=argparse.FileType("w"), default="_out_isp.fna", help="Output nucleotide sequences, FASTA", ) parser.add_argument( "--isp_op", dest="out_isp_prot", type=argparse.FileType("w"), default="_out_isp.fa", help="Output protein sequences, FASTA", ) parser.add_argument( "--isp_ob", dest="out_isp_bed", type=argparse.FileType("w"), default="_out_isp.bed", help="Output BED file", ) parser.add_argument( "--isp_og", dest="out_isp_gff3", type=argparse.FileType("w"), default="_out_isp.gff3", help="Output GFF3 file", ) parser.add_argument( "--isp_min_dist", dest="isp_min_dist", default=10, help="Minimal distance to first AA of TMD, measured in AA", type=int, ) parser.add_argument( "--isp_max_dist", dest="isp_max_dist", default=30, help="Maximum distance to first AA of TMD, measured in AA", type=int, ) parser.add_argument( "--putative_isp", dest="putative_isp_fa", type=argparse.FileType("w"), default="_putative_isp.fa", help="Output of putative FASTA file", ) parser.add_argument( "--min_tmd_size", dest="min_tmd_size", default=10, help="Minimal size of the TMD domain", type=int, ) parser.add_argument( "--max_tmd_size", dest="max_tmd_size", default=20, help="Maximum size of the TMD domain", type=int, ) parser.add_argument( "--summary_isp_txt", dest="summary_isp_txt", type=argparse.FileType("w"), default="_summary_isp.txt", help="Summary statistics on putative i-spanins", ) parser.add_argument( "--putative_isp_gff", dest="putative_isp_gff", type=argparse.FileType("w"), default="_putative_isp.gff3", help="gff3 output for putative i-spanins", ) parser.add_argument( "--max_isp", dest="max_isp", default=230, help="Maximum size of the ISP", type=int, ) parser.add_argument("--isp_mode", action="store_true", default=True) parser.add_argument( "--peri_min", type=int, default=18, help="amount of residues after TMD is found min", ) parser.add_argument( "--peri_max", type=int, default=206, help="amount of residues after TMD is found max", ) # parser.add_argument('-v', action='version', version='0.3.0') # Is this manually updated? args = parser.parse_args() the_args = vars(parser.parse_args()) ### isp output, naive ORF finding: isps = OrfFinder(args.table, args.ftype, args.ends, args.isp_min_len, args.strand) isps.locate( args.fasta_file, args.out_isp_nuc, args.out_isp_prot, args.out_isp_bed, args.out_isp_gff3, ) """ >T7_EIS MLEFLRKLIPWVLVGMLFGLGWHLGSDSMDAKWKQEVHNEYVKRVEAAKSTQRAIGAVSAKYQEDLAALEGSTDRIISDLRSDNKRLRVRVKTTGISDGQCGFEPDGRAELDDRDAKRILAVTQKGDAWIRALQDTIRELQRK >lambda_EIS MSRVTAIISALVICIIVCLSWAVNHYRDNAITYKAQRDKNARELKLANAAITDMQMRQRDVAALDAKYTKELADAKAENDALRDDVAAGRRRLHIKAVCQSVREATTASGVDNAASPRLADTAERDYFTLRERLITMQKQLEGTQKYINEQCR """ args.fasta_file.close() args.fasta_file = open(args.fasta_file.name, "r") args.out_isp_prot.close() args.out_isp_prot = open(args.out_isp_prot.name, "r") pairs = tuple_fasta(fasta_file=args.out_isp_prot) # print(pairs) have_tmd = [] # empty candidates list to be passed through the user input criteria for ( each_pair ) in ( pairs ): # grab transmembrane domains from spaninFuncts (queries for lysin snorkels # and a range of hydrophobic regions that could be TMDs) if len(each_pair[1]) <= args.max_isp: try: have_tmd += find_tmd( pair=each_pair, minimum=args.isp_min_dist, maximum=args.isp_max_dist, TMDmin=args.min_tmd_size, TMDmax=args.max_tmd_size, isp_mode=args.isp_mode, peri_min=args.peri_min, peri_max=args.peri_max, ) except TypeError: continue if args.switch == "all": pass else: # for each_pair in have_lipo: range_of = args.switch range_of = re.search(("[\d]+:[\d]+"), range_of).group(0) start = int(range_of.split(":")[0]) end = int(range_of.split(":")[1]) have_tmd = parse_a_range(pair=have_tmd, start=start, end=end) total_isp = len(have_tmd) # ORF = [] # mightttttttttttt use eventually length = [] # grabbing length of the sequences candidate_dict = {k: v for k, v in have_tmd} with args.putative_isp_fa as f: for desc, s in candidate_dict.items(): # description / sequence f.write(">" + str(desc)) f.write("\n" + lineWrapper(str(s).replace("*", "")) + "\n") length.append(len(s)) # ORF.append(desc) if not length: raise Exception("Parameters yielded no candidates.") bot_size = min(length) top_size = max(length) avg = (sum(length)) / total_isp n = len(length) if n == 0: raise Exception("no median for empty data") if n % 2 == 1: med = length[n // 2] else: i = n // 2 med = (length[i - 1] + length[i]) / 2 #### Extra statistics args.out_isp_prot.close() all_orfs = open(args.out_isp_prot.name, "r") all_isps = open(args.putative_isp_fa.name, "r") # record = SeqIO.read(all_orfs, "fasta") # print(len(record)) n = 0 for line in all_orfs: if line.startswith(">"): n += 1 all_orfs_counts = n c = 0 for line in all_isps: if line.startswith(">"): c += 1 all_isps_counts = c # print(f"{n} -> {c}") # count = 0 # for feature in record.features: # count += 1 # print(count) with args.summary_isp_txt as f: f.write("total potential o-spanins: " + str(total_isp) + "\n") f.write("average length (AA): " + str(avg) + "\n") f.write("median length (AA): " + str(med) + "\n") f.write("maximum orf in size (AA): " + str(top_size) + "\n") f.write("minimum orf in size (AA): " + str(bot_size) + "\n") f.write("ratio of isps found from naive orfs: " + str(c) + "/" + str(n)) # Output the putative list in gff3 format args.putative_isp_fa = open(args.putative_isp_fa.name, "r") gff_data = prep_a_gff3( fa=args.putative_isp_fa, spanin_type="isp", org=args.fasta_file ) write_gff3(data=gff_data, output=args.putative_isp_gff) """https://docs.python.org/3.4/library/subprocess.html""" """https://github.tamu.edu/CPT/Galaxy-Tools/blob/f0bf4a4b8e5124d4f3082d21b738dfaa8e1a3cf6/tools/phage/transmembrane.py"""