Mercurial > repos > cpt > cpt_putative_isp
view spaninFuncs.py @ 6:7a0ed74e9ff8 draft
planemo upload commit e563355aff813a6412160834ee3dead9414eddc8
author | cpt |
---|---|
date | Wed, 18 Sep 2024 05:03:59 +0000 |
parents | 4e02e6e9e77d |
children |
line wrap: on
line source
""" PREMISE ### Functions/Classes that are used in both generate-putative-osp.py and generate-putative-isp.py ###### Main premise here is to make the above scripts a little more DRY, as well as easily readable for execution. ###### Documentation will ATTEMPT to be thourough here """ import re from Bio import SeqIO from Bio import Seq from collections import OrderedDict # Not written in OOP for a LITTLE bit of trying to keep the complication down in case adjustments are needed by someone else. # Much of the manipulation is string based; so it should be straightforward as well as moderately quick ################## GLobal Variables Lys = "K" def check_back_end_snorkels(seq, tmsize): """ Searches through the backend of a potential TMD snorkel. This is the 2nd part of a TMD snorkel lysine match. --> seq : should be the sequence fed from the "search_region" portion of the sequence --> tmsize : size of the potential TMD being investigated """ found = [] if seq[tmsize - 4] == Lys and re.search(("[FIWLVMYCATGS]"), seq[tmsize - 5]): found = "match" return found elif seq[tmsize - 3] == Lys and re.search(("[FIWLVMYCATGS]"), seq[tmsize - 4]): found = "match" return found elif seq[tmsize - 2] == Lys and re.search(("[FIWLVMYCATGS]"), seq[tmsize - 3]): found = "match" return found elif seq[tmsize - 1] == Lys and re.search(("[FIWLVMYCATGS]"), seq[tmsize - 2]): found = "match" return found else: found = "NOTmatch" return found def prep_a_gff3(fa, spanin_type, org): """ Function parses an input detailed 'fa' file and outputs a 'gff3' file ---> fa = input .fa file ---> output = output a returned list of data, easily portable to a gff3 next ---> spanin_type = 'isp' or 'osp' """ with org as f: header = f.readline() orgacc = header.split(" ") orgacc = orgacc[0].split(">")[1].strip() fa_zip = tuple_fasta(fa) data = [] for a_pair in fa_zip: # print(a_pair) if re.search(("(\[1\])"), a_pair[0]): strand = "+" elif re.search(("(\[-1\])"), a_pair[0]): strand = "-" # column 7 start = re.search(("[\d]+\.\."), a_pair[0]).group(0).split("..")[0] # column 4 end = re.search(("\.\.[\d]+"), a_pair[0]).group(0).split("..")[1] # column 5 orfid = re.search(("(ORF)[\d]+"), a_pair[0]).group(0) # column 1 if spanin_type == "isp": methodtype = "CDS" # column 3 spanin = "isp" elif spanin_type == "osp": methodtype = "CDS" # column 3 spanin = "osp" elif spanin_type == "usp": methodtype = "CDS" spanin = "usp" else: raise "need to input spanin type" source = "cpt.py|putative-*.py" # column 2 score = "." # column 6 phase = "." # column 8 attributes = ( "ID=" + orgacc + "|" + orfid + ";ALIAS=" + spanin + ";SEQ=" + a_pair[1] ) # column 9 sequence = [ [orgacc, source, methodtype, start, end, score, strand, phase, attributes] ] data += sequence return data def write_gff3(data, output="results.gff3"): """ Parses results from prep_a_gff3 into a gff3 file ---> input : list from prep_a_gff3 ---> output : gff3 file """ data = data filename = output with filename as f: f.write("#gff-version 3\n") for value in data: f.write( "{}\t{}\t{}\t{}\t{}\t{}\t{}\t{}\t{}\n".format( value[0], value[1], value[2], value[3], value[4], value[5], value[6], value[7], value[8], ) ) f.close() def find_tmd( pair, minimum=10, maximum=30, TMDmin=10, TMDmax=20, isp_mode=False, peri_min=18, peri_max=206, ): """ Function that searches for lysine snorkels and then for a spanning hydrophobic region that indicates a potential TMD ---> pair : Input of tuple with description and AA sequence (str) ---> minimum : How close from the initial start codon a TMD can be within ---> maximum : How far from the initial start codon a TMD can be within ---> TMDmin : The minimum size that a transmembrane can be (default = 10) ---> TMDmax : The maximum size tha ta transmembrane can be (default = 20) """ # hydrophobicAAs = ['P', 'F', 'I', 'W', 'L', 'V', 'M', 'Y', 'C', 'A', 'T', 'G', 'S'] tmd = [] s = str(pair[1]) # sequence being analyzed # print(s) # for trouble shooting if maximum > len(s): maximum = len(s) search_region = s[minimum - 1 : maximum + 1] # print(f"this is the search region: {search_region}") # print(search_region) # for trouble shooting for tmsize in range(TMDmin, TMDmax + 1, 1): # print(f"this is the current tmsize we're trying: {tmsize}") # print('==============='+str(tmsize)+'================') # print for troubleshooting pattern = ( "[PFIWLVMYCATGS]{" + str(tmsize) + "}" ) # searches for these hydrophobic residues tmsize total times # print(pattern) # print(f"sending to regex: {search_region}") if re.search( ("[K]"), search_region[1:8] ): # grabbing one below with search region, so I want to grab one ahead here when I query. store_search = re.search( ("[K]"), search_region[1:8] ) # storing regex object where_we_are = store_search.start() # finding where we got the hit if re.search( ("[PFIWLVMYCATGS]"), search_region[where_we_are + 1] ) and re.search( ("[PFIWLVMYCATGS]"), search_region[where_we_are - 1] ): # hydrophobic neighbor # try: g = re.search( ("[PFIWLVMYCATGS]"), search_region[where_we_are + 1] ).group() backend = check_back_end_snorkels(search_region, tmsize) if backend == "match": if isp_mode: g = re.search((pattern), search_region).group() end_of_tmd = re.search((g), s).end() + 1 amt_peri = len(s) - end_of_tmd if peri_min <= amt_peri <= peri_max: pair_desc = pair[0] + ", peri_count~=" + str(amt_peri) new_pair = (pair_desc, pair[1]) tmd.append(new_pair) else: tmd.append(pair) else: continue # else: # print("I'm continuing out of snorkel loop") # print(f"{search_region}") # continue if re.search((pattern), search_region): # print(f"found match: {}") # print("I AM HEREEEEEEEEEEEEEEEEEEEEEEE") # try: if isp_mode: g = re.search((pattern), search_region).group() end_of_tmd = re.search((g), s).end() + 1 amt_peri = len(s) - end_of_tmd if peri_min <= amt_peri <= peri_max: pair_desc = pair[0] + ", peri_count~=" + str(amt_peri) new_pair = (pair_desc, pair[1]) tmd.append(new_pair) else: tmd.append(pair) else: continue return tmd def find_lipobox( pair, minimum=10, maximum=50, min_after=30, max_after=185, regex=1, osp_mode=False ): """ Function that takes an input tuple, and will return pairs of sequences to their description that have a lipoobox ---> minimum - min distance from start codon to first AA of lipobox ---> maximum - max distance from start codon to first AA of lipobox ---> regex - option 1 (default) => more strict regular expression ; option 2 => looser selection, imported from LipoRy """ if regex == 1: pattern = "[ILMFTV][^REKD][GAS]C" # regex for Lipobox from findSpanin.pl elif regex == 2: pattern = "[ACGSILMFTV][^REKD][GAS]C" # regex for Lipobox from LipoRy candidates = [] s = str(pair[1]) # print(s) # trouble shooting search_region = s[ minimum - 1 : maximum + 5 ] # properly slice the input... add 4 to catch if it hangs off at max input # print(search_region) # trouble shooting patterns = ["[ILMFTV][^REKD][GAS]C", "AW[AGS]C"] for pattern in patterns: # print(pattern) # trouble shooting if re.search((pattern), search_region): # lipobox must be WITHIN the range... # searches the sequence with the input RegEx AND omits if g = re.search( (pattern), search_region ).group() # find the exact group match amt_peri = len(s) - re.search((g), s).end() + 1 if min_after <= amt_peri <= max_after: # find the lipobox end region if osp_mode: pair_desc = pair[0] + ", peri_count~=" + str(amt_peri) new_pair = (pair_desc, pair[1]) candidates.append(new_pair) else: candidates.append(pair) return candidates def tuple_fasta(fasta_file): """ #### INPUT: Fasta File #### OUTPUT: zipped (zip) : pairwise relationship of description to sequence #### """ fasta = SeqIO.parse(fasta_file, "fasta") descriptions = [] sequences = [] for r in fasta: # iterates and stores each description and sequence description = r.description sequence = str(r.seq) if ( sequence[0] != "I" ): # the translation table currently has I as a potential start codon ==> this will remove all ORFs that start with I descriptions.append(description) sequences.append(sequence) else: continue return zip(descriptions, sequences) def lineWrapper(text, charactersize=60): if len(text) <= charactersize: return text else: return ( text[:charactersize] + "\n" + lineWrapper(text[charactersize:], charactersize) ) def getDescriptions(fasta): """ Takes an output FASTA file, and parses retrieves the description headers. These headers contain information needed for finding locations of a potential i-spanin and o-spanin proximity to one another. """ desc = [] with fasta as f: for line in f: if line.startswith(">"): desc.append(line) return desc def splitStrands(text, strand="+"): # positive_strands = [] # negative_strands = [] if strand == "+": if re.search(("(\[1\])"), text): return text elif strand == "-": if re.search(("(\[-1\])"), text): return text # return positive_strands, negative_strands def parse_a_range(pair, start, end): """ Takes an input data tuple from a fasta tuple pair and keeps only those within the input sequence range ---> data : fasta tuple data ---> start : start range to keep ---> end : end range to keep (will need to + 1) """ matches = [] for each_pair in pair: s = re.search(("[\d]+\.\."), each_pair[0]).group(0) # Start of the sequence s = int(s.split("..")[0]) e = re.search(("\.\.[\d]+"), each_pair[0]).group(0) e = int(e.split("..")[1]) if start - 1 <= s and e <= end + 1: matches.append(each_pair) else: continue # else: # continue # if matches != []: return matches # else: # print('no candidates within selected range') def grabLocs(text): """ Grabs the locations of the spanin based on NT location (seen from ORF). Grabs the ORF name, as per named from the ORF class/module from cpt.py """ start = re.search(("[\d]+\.\."), text).group( 0 ) # Start of the sequence ; looks for [numbers].. end = re.search(("\.\.[\d]+"), text).group( 0 ) # End of the sequence ; Looks for ..[numbers] orf = re.search(("(ORF)[\d]+"), text).group( 0 ) # Looks for ORF and the numbers that are after it if re.search(("(\[1\])"), text): # stores strand strand = "+" elif re.search(("(\[-1\])"), text): # stores strand strand = "-" start = int(start.split("..")[0]) end = int(end.split("..")[1]) vals = [start, end, orf, strand] return vals def spaninProximity(isp, osp, max_dist=30): """ _NOTE THIS FUNCTION COULD BE MODIFIED TO RETURN SEQUENCES_ Compares the locations of i-spanins and o-spanins. max_dist is the distance in NT measurement from i-spanin END site to o-spanin START. The user will be inputting AA distance, so a conversion will be necessary (<user_input> * 3) I modified this on 07.30.2020 to bypass the pick + or - strand. To INPUT: list of OSP and ISP candidates OUTPUT: Return (improved) candidates for overlapping, embedded, and separate list """ embedded = {} overlap = {} separate = {} for iseq in isp: embedded[iseq[2]] = [] overlap[iseq[2]] = [] separate[iseq[2]] = [] for oseq in osp: if iseq[3] == "+": if oseq[3] == "+": if iseq[0] < oseq[0] < iseq[1] and oseq[1] < iseq[1]: ### EMBEDDED ### combo = [ iseq[0], iseq[1], oseq[2], oseq[0], oseq[1], iseq[3], ] # ordering a return for dic embedded[iseq[2]] += [combo] elif iseq[0] < oseq[0] <= iseq[1] and oseq[1] > iseq[1]: ### OVERLAP / SEPARATE ### if (iseq[1] - oseq[0]) < 6: combo = [ iseq[0], iseq[1], oseq[2], oseq[0], oseq[1], iseq[3], ] separate[iseq[2]] += [combo] else: combo = [ iseq[0], iseq[1], oseq[2], oseq[0], oseq[1], iseq[3], ] overlap[iseq[2]] += [combo] elif iseq[1] <= oseq[0] <= iseq[1] + max_dist: combo = [iseq[0], iseq[1], oseq[2], oseq[0], oseq[1], iseq[3]] separate[iseq[2]] += [combo] else: continue if iseq[3] == "-": if oseq[3] == "-": if iseq[0] <= oseq[1] <= iseq[1] and oseq[0] > iseq[0]: ### EMBEDDED ### combo = [ iseq[0], iseq[1], oseq[2], oseq[0], oseq[1], iseq[3], ] # ordering a return for dict embedded[iseq[2]] += [combo] elif iseq[0] <= oseq[1] <= iseq[1] and oseq[0] < iseq[0]: if (oseq[1] - iseq[0]) < 6: combo = [ iseq[0], iseq[1], oseq[2], oseq[0], oseq[1], iseq[3], ] separate[iseq[2]] += [combo] else: combo = [ iseq[0], iseq[1], oseq[2], oseq[0], oseq[1], iseq[3], ] overlap[iseq[2]] += [combo] elif iseq[0] - 10 < oseq[1] < iseq[0]: combo = [iseq[0], iseq[1], oseq[2], oseq[0], oseq[1], iseq[3]] separate[iseq[2]] += [combo] else: continue embedded = {k: embedded[k] for k in embedded if embedded[k]} overlap = {k: overlap[k] for k in overlap if overlap[k]} separate = {k: separate[k] for k in separate if separate[k]} return embedded, overlap, separate def check_for_usp(): "pass" ############################################### TEST RANGE ######################################################################### #################################################################################################################################### if __name__ == "__main__": #### TMD TEST test_desc = ["one", "two", "three", "four", "five"] test_seq = [ "XXXXXXXXXXXXXXXFMCFMCFMCFMCFMCXXXXXXXXXXXXXXXXXXXXXXXXXX", "XXXXXXXXAAKKKKKKKKKKKKKKKXXXXXXXXXXXXX", "XXXXXXX", "XXXXXXXXXXXKXXXXXXXXXX", "XXXXXXXXXXAKXXXXXXXXXXAKXXXXXXXX", ] # for l in # combo = zip(test_desc,test_seq) pairs = zip(test_desc, test_seq) tmd = [] for each_pair in pairs: # print(each_pair) try: tmd += find_tmd(pair=each_pair) except (IndexError, TypeError): continue # try:s = each_pair[1] # tmd += find_tmd(seq=s, tmsize=15) # print('\n+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++\n') # print(tmd) # print('\n+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++\n') #### tuple-fasta TEST # fasta_file = 'out_isp.fa' # ret = tuple_fasta(fasta_file) # print('=============') # for i in ret: # print(i[1]) #### LipoBox TEST test_desc = ["one", "two", "three", "four", "five", "six", "seven"] test_seq = [ "XXXXXXXXXTGGCXXXXXXXXXXXXXXXX", "XXXXXXXXAAKKKKKKKKKKKKKKKXXXXXXXXXXXXX", "XXXXXXX", "AGGCXXXXXXXXXXXXXXXXXXXXTT", "XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGGC", "XXXXXXXXXXXXXXXXXXXXXXXXXXTGGC", "MSTLRELRLRRALKEQSMRYLLSIKKTLPRWKGALIGLFLICVATISGCASESKLPEPPMVSVDSSLMVEPNLTTEMLNVFSQ*", ] pairs = zip(test_desc, test_seq) lipo = [] for each_pair in pairs: # print(each_pair) # try: try: lipo += find_lipobox(pair=each_pair, regex=2) # , minimum=8) except TypeError: # catches if something doesnt have the min/max requirements (something is too small) continue # except: # continue # print('\n+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++\n') #############################3 # g = prep_a_gff3(fa='putative_isp.fa', spanin_type='isp') # print(g) # write_gff3(data=g)