Mercurial > repos > cpt > cpt_putative_osp
view generate-putative-osp.py @ 2:05244a021b80 draft
planemo upload commit f33bdf952d796c5d7a240b132af3c4cbd102decc
| author | cpt |
|---|---|
| date | Fri, 05 Jan 2024 05:56:31 +0000 |
| parents | 05b97a4dce94 |
| children | 859e18a9814a |
line wrap: on
line source
#!/usr/bin/env python import argparse from cpt import OrfFinder from Bio import SeqIO from Bio import Seq from CPT_GFFParser import gffParse, gffWrite from spaninFuncs import * import re import os import sys ### Requirement Inputs #### INPUT : Genomic FASTA #### OUTPUT : Putative OSP candidates in FASTA format. ######### Optional OUTPUT: "Complete" potential ORFs, in BED/FASTAs/GFF3 formats ### Notes: ####### As of 2.13.2020 - RegEx pattern: [ACGSILMFTV][^REKD][GASNL]C for LipoRy if __name__ == "__main__": # Common parameters for both ISP / OSP portion of scripts parser = argparse.ArgumentParser( description="Get putative protein candidates for spanins" ) parser.add_argument( "fasta_file", type=argparse.FileType("r"), help="Fasta file" ) # the "input" argument parser.add_argument( "-f", "--format", dest="seq_format", default="fasta", help="Sequence format (e.g. fasta, fastq, sff)", ) # optional formats for input, currently just going to do ntFASTA parser.add_argument( "--strand", dest="strand", choices=("both", "forward", "reverse"), default="both", help="select strand", ) # Selection of +, -, or both strands parser.add_argument( "--table", dest="table", default=11, help="NCBI Translation table", type=int ) # Uses "default" NCBI codon table. This should always (afaik) be what we want... parser.add_argument( "-t", "--ftype", dest="ftype", choices=("CDS", "ORF"), default="ORF", help="Find ORF or CDSs", ) # "functional type(?)" --> Finds ORF or CDS, for this we want just the ORF parser.add_argument( "-e", "--ends", dest="ends", choices=("open", "closed"), default="closed", help="Open or closed. Closed ensures start/stop codons are present", ) # includes the start and stop codon parser.add_argument( "-m", "--mode", dest="mode", choices=("all", "top", "one"), default="all", # I think we want this to JUST be all...nearly always help="Output all ORFs/CDSs from sequence, all ORFs/CDSs with max length, or first with maximum length", ) parser.add_argument( "--switch", dest="switch", default="all", help="switch between ALL putative osps, or a range. If not all, insert a range of two integers separated by a colon (:). Eg: 1234:4321", ) # osp parameters parser.add_argument( "--osp_min_len", dest="osp_min_len", default=30, help="Minimum ORF length, measured in codons", type=int, ) parser.add_argument( "--max_osp", dest="max_osp", default=200, help="Maximum ORF length, measured in codons", type=int, ) parser.add_argument( "--osp_on", dest="out_osp_nuc", type=argparse.FileType("w"), default="_out_osp.fna", help="Output nucleotide sequences, FASTA", ) parser.add_argument( "--osp_op", dest="out_osp_prot", type=argparse.FileType("w"), default="_out_osp.fa", help="Output protein sequences, FASTA", ) parser.add_argument( "--osp_ob", dest="out_osp_bed", type=argparse.FileType("w"), default="_out_osp.bed", help="Output BED file", ) parser.add_argument( "--osp_og", dest="out_osp_gff3", type=argparse.FileType("w"), default="_out_osp.gff3", help="Output GFF3 file", ) parser.add_argument( "--osp_min_dist", dest="osp_min_dist", default=10, help="Minimal distance to first AA of lipobox, measured in AA", type=int, ) parser.add_argument( "--osp_max_dist", dest="osp_max_dist", default=50, help="Maximum distance to first AA of lipobox, measured in AA", type=int, ) parser.add_argument( "--min_lipo_after", dest="min_lipo_after", default=25, help="minimal amount of residues after lipobox", type=int, ) parser.add_argument( "--max_lipo_after", dest="max_lipo_after", default=170, help="minimal amount of residues after lipobox", type=int, ) parser.add_argument( "--putative_osp", dest="putative_osp_fa", type=argparse.FileType("w"), default="_putative_osp.fa", help="Output of putative FASTA file", ) parser.add_argument( "--summary_osp_txt", dest="summary_osp_txt", type=argparse.FileType("w"), default="_summary_osp.txt", help="Summary statistics on putative o-spanins", ) parser.add_argument( "--putative_osp_gff", dest="putative_osp_gff", type=argparse.FileType("w"), default="_putative_osp.gff3", help="gff3 output for putative o-spanins", ) parser.add_argument("--osp_mode", action="store_true", default=True) # parser.add_argument('-v', action='version', version='0.3.0') # Is this manually updated? args = parser.parse_args() the_args = vars(parser.parse_args()) ### osp output, naive ORF finding: osps = OrfFinder(args.table, args.ftype, args.ends, args.osp_min_len, args.strand) osps.locate( args.fasta_file, args.out_osp_nuc, args.out_osp_prot, args.out_osp_bed, args.out_osp_gff3, ) """ ### For Control: Use T7 and lambda; # Note the distance from start codon to lipobox region for t7 o-spanin 18,7-------------------------------------------------LIPO---------------------------------- >T7_EOS MSTLRELRLRRALKEQSVRYLLSIKKTLPRWKGALIGLFLICVATISGCASESKLPESPMVSVDSSLMVEPNLTTEMLNVFSQ -----------------------------LIPO---------------------------------------- > lambda_EOS MLKLKMMLCVMMLPLVVVGCTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSERG """ args.fasta_file.close() args.fasta_file = open(args.fasta_file.name, "r") args.out_osp_prot.close() args.out_osp_prot = open(args.out_osp_prot.name, "r") pairs = tuple_fasta(fasta_file=args.out_osp_prot) have_lipo = [] # empty candidates list to be passed through the user input for each_pair in pairs: if len(each_pair[1]) <= args.max_osp: try: have_lipo += find_lipobox( pair=each_pair, minimum=args.osp_min_dist, maximum=args.osp_max_dist, min_after=args.min_lipo_after, max_after=args.max_lipo_after, osp_mode=args.osp_mode, ) except (IndexError, TypeError): continue if args.switch == "all": pass else: # for each_pair in have_lipo: range_of = args.switch range_of = re.search(("[\d]+:[\d]+"), range_of).group(0) start = int(range_of.split(":")[0]) end = int(range_of.split(":")[1]) have_lipo = parse_a_range(pair=have_lipo, start=start, end=end) # print(have_lipo) # matches # have_lipo = [] # have_lipo = matches total_osp = len(have_lipo) # print(have_lipo) # print(total_osp) # print(type(have_lipo)) # for i in have_lipo: # print(i) # export results in fasta format ORF = [] length = [] # grabbing length of the sequences candidate_dict = {k: v for k, v in have_lipo} with args.putative_osp_fa as f: for desc, s in candidate_dict.items(): # description / sequence f.write(">" + str(desc)) f.write("\n" + lineWrapper(str(s).replace("*", "")) + "\n") length.append(len(s)) ORF.append(desc) if not length: raise Exception("Parameters yielded no candidates.") bot_size = min(length) top_size = max(length) avg = (sum(length)) / total_osp n = len(length) if n == 0: raise Exception("no median for empty data") if n % 2 == 1: med = length[n // 2] else: i = n // 2 med = (length[i - 1] + length[i]) / 2 args.out_osp_prot.close() all_orfs = open(args.out_osp_prot.name, "r") all_osps = open(args.putative_osp_fa.name, "r") # record = SeqIO.read(all_orfs, "fasta") # print(len(record)) #### Extra stats n = 0 for line in all_orfs: if line.startswith(">"): n += 1 all_orfs_counts = n c = 0 for line in all_osps: if line.startswith(">"): c += 1 all_osps_counts = c with args.summary_osp_txt as f: f.write("total potential o-spanins: " + str(total_osp) + "\n") f.write("average length (AA): " + str(avg) + "\n") f.write("median length (AA): " + str(med) + "\n") f.write("maximum orf in size (AA): " + str(top_size) + "\n") f.write("minimum orf in size (AA): " + str(bot_size) + "\n") # f.write(f"ratio of osps found from naive orfs: {c}/{n}") f.write("ratio of osps found from naive orfs: " + str(c) + "/" + str(n)) # Output the putative list in gff3 format: args.putative_osp_fa = open(args.putative_osp_fa.name, "r") gff_data = prep_a_gff3( fa=args.putative_osp_fa, spanin_type="osp", org=args.fasta_file ) write_gff3(data=gff_data, output=args.putative_osp_gff)
