changeset 6:3cb37af59360 draft

"planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/eggnog_mapper/eggnog_mapper commit 2200885b5049b2d952959001c8a9b5ae5c62bee5"
author galaxyp
date Sat, 05 Sep 2020 07:21:28 +0000
parents a5a3bdd0954b
children 4e4c6329f6cd
files eggnog_macros.xml eggnog_mapper.xml test-data/DIA_nlim.emapper.annotations test-data/DIA_nlim.emapper.annotations_orthologs test-data/DIA_nlim.emapper.seed_orthologs test-data/HMM_nlim.emapper.hmm_hits test-data/Nmar_0135.fa test-data/README test-data/cached_locally/OG_fasta/thaNOG/1CB2A.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2B.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2C.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2D.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2E.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2F.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2G.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2H.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2I.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2J.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2K.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2M.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2N.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2P.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2Q.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2R.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2S.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2T.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2U.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2V.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2W.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2X.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2Y.fa test-data/cached_locally/OG_fasta/thaNOG/1CB2Z.fa test-data/cached_locally/eggnog.db test-data/cached_locally/eggnog_mapper_db.loc test-data/cached_locally/eggnog_mapper_hmm_dbs.loc test-data/cached_locally/eggnog_proteins.dmnd test-data/cached_locally/eggnog_proteins.fa test-data/cached_locally/hmmdb_levels/ENOG411CB2I/ENOG411CB2I test-data/cached_locally/hmmdb_levels/ENOG411CB2I/ENOG411CB2I.h3f test-data/cached_locally/hmmdb_levels/ENOG411CB2I/ENOG411CB2I.h3i test-data/cached_locally/hmmdb_levels/ENOG411CB2I/ENOG411CB2I.h3m test-data/cached_locally/hmmdb_levels/ENOG411CB2I/ENOG411CB2I.h3p test-data/cached_locally/hmmdb_levels/thaNOG/thaNOG test-data/cached_locally/hmmdb_levels/thaNOG/thaNOG.h3f test-data/cached_locally/hmmdb_levels/thaNOG/thaNOG.h3i test-data/cached_locally/hmmdb_levels/thaNOG/thaNOG.h3m test-data/cached_locally/hmmdb_levels/thaNOG/thaNOG.h3p test-data/cached_locally/hmmdb_levels/thaNOG_hmm/thaNOG_hmm.all_hmm.h3f test-data/cached_locally/hmmdb_levels/thaNOG_hmm/thaNOG_hmm.all_hmm.h3i test-data/cached_locally/hmmdb_levels/thaNOG_hmm/thaNOG_hmm.all_hmm.h3m test-data/cached_locally/hmmdb_levels/thaNOG_hmm/thaNOG_hmm.all_hmm.h3p test-data/cached_locally/hmmdb_levels/thaNOG_hmm/thaNOG_hmm.all_hmm.idmap test-data/make_comp_file.sh test-data/scoped.emapper.annotations test-data/scoped.emapper.annotations_orthologs test-data/scoped.emapper.seed_orthologs tool-data/eggnog_mapper_db.loc.sample tool-data/eggnog_mapper_hmm_dbs.loc.sample tool_data_table_conf.xml.sample tool_data_table_conf.xml.test
diffstat 60 files changed, 238 insertions(+), 3412 deletions(-) [+]
line wrap: on
line diff
--- a/eggnog_macros.xml	Mon Nov 11 11:50:36 2019 -0500
+++ b/eggnog_macros.xml	Sat Sep 05 07:21:28 2020 +0000
@@ -1,9 +1,11 @@
 <?xml version="1.0"?>
 <macros>
-   <token name="@VERSION@">1.0.3</token>
+   <token name="@VERSION@">2.0.1</token>
+   <token name="@EGGNOG_DB_VERSION@">5.0</token>
    <xml name="citations">
         <citations>
             <citation type="doi">10.1093/nar/gkv1248</citation>
+            <citation type="doi">10.1093/molbev/msx148</citation>
         </citations>
     </xml>
     <xml name="requirements">
@@ -16,119 +18,7 @@
     </xml>
     <xml name="data_manager_params">
         <param name="test" type="hidden" value="false" />
-        <param name="diamond_database" type="boolean" truevalue="" falsevalue="-D" checked="true" label="Install the diamond database"/>
-        <param argument="dbs" type="select" multiple="true" label="eggNOG HMM databases to download. If none are selected only diamond can be used'">
-            <option value="arch" selected="true">Archea  arch_1 (arch)</option>
-            <option value="bact" selected="true">Bacteria bact_50 (bact)</option>
-            <option value="euk" selected="true">Eukaryote euk_500 (euk)</option>
-            <option value="NOG" selected="true">All organisms (NOG)</option>
-            <option value="aciNOG">Acidobacteria (aciNOG)</option>
-            <option value="acidNOG">Acidobacteriia (acidNOG)</option>
-            <option value="acoNOG">Aconoidasida (acoNOG)</option>
-            <option value="actNOG">Actinobacteria (actNOG)</option>
-            <option value="agaNOG">Agaricales (agaNOG)</option>
-            <option value="agarNOG">Agaricomycetes (agarNOG)</option>
-            <option value="apiNOG">Apicomplexa (apiNOG)</option>
-            <option value="aproNOG">Proteobacteria_alpha (aproNOG)</option>
-            <option value="aquNOG">Aquificae (aquNOG)</option>
-            <option value="arNOG">Archaea (arNOG)</option>
-            <option value="arcNOG">Archaeoglobi (arcNOG)</option>
-            <option value="artNOG">Arthropoda (artNOG)</option>
-            <option value="arthNOG">Arthrodermataceae (arthNOG)</option>
-            <option value="ascNOG">Ascomycota (ascNOG)</option>
-            <option value="aveNOG">Aves (aveNOG)</option>
-            <option value="bacNOG">Bacilli (bacNOG)</option>
-            <option value="bactNOG">Bacteria (bactNOG)</option>
-            <option value="bacteNOG">Bacteroidia (bacteNOG)</option>
-            <option value="basNOG">Basidiomycota (basNOG)</option>
-            <option value="bctoNOG">Bacteroidetes (bctoNOG)</option>
-            <option value="biNOG">Bilateria (biNOG)</option>
-            <option value="bproNOG">Proteobacteria_beta (bproNOG)</option>
-            <option value="braNOG">Brassicales (braNOG)</option>
-            <option value="carNOG">Carnivora (carNOG)</option>
-            <option value="chaNOG">Chaetomiaceae (chaNOG)</option>
-            <option value="chlNOG">Chlorobi (chlNOG)</option>
-            <option value="chlaNOG">Chlamydiae (chlaNOG)</option>
-            <option value="chloNOG">Chloroflexi (chloNOG)</option>
-            <option value="chlorNOG">Chloroflexi (chlorNOG)</option>
-            <option value="chloroNOG">Chlorophyta (chloroNOG)</option>
-            <option value="chorNOG">Chordata (chorNOG)</option>
-            <option value="chrNOG">Chromadorea (chrNOG)</option>
-            <option value="cloNOG">Clostridia (cloNOG)</option>
-            <option value="cocNOG">Coccidia (cocNOG)</option>
-            <option value="creNOG">Crenarchaeota (creNOG)</option>
-            <option value="cryNOG">Cryptosporidiidae (cryNOG)</option>
-            <option value="cyaNOG">Cyanobacteria (cyaNOG)</option>
-            <option value="cytNOG">Cytophagia (cytNOG)</option>
-            <option value="debNOG">Debaryomycetaceae (debNOG)</option>
-            <option value="defNOG">Deferribacteres (defNOG)</option>
-            <option value="dehNOG">Dehalococcoidetes (dehNOG)</option>
-            <option value="deiNOG">Deinococcusthermus (deiNOG)</option>
-            <option value="delNOG">delta/epsilon (delNOG)</option>
-            <option value="dipNOG">Diptera (dipNOG)</option>
-            <option value="dotNOG">Dothideomycetes (dotNOG)</option>
-            <option value="dproNOG">Proteobacteria_delta (dproNOG)</option>
-            <option value="droNOG">Drosophilidae (droNOG)</option>
-            <option value="eproNOG">Proteobacteria_epsilon (eproNOG)</option>
-            <option value="eryNOG">Erysipelotrichi (eryNOG)</option>
-            <option value="euNOG">Eukaryotes (euNOG)</option>
-            <option value="eurNOG">Euryarchaeota (eurNOG)</option>
-            <option value="euroNOG">Eurotiomycetes (euroNOG)</option>
-            <option value="eurotNOG">Eurotiales (eurotNOG)</option>
-            <option value="fiNOG">Fishes (fiNOG)</option>
-            <option value="firmNOG">Firmicutes (firmNOG)</option>
-            <option value="flaNOG">Flavobacteriia (flaNOG)</option>
-            <option value="fuNOG">Fungi (fuNOG)</option>
-            <option value="fusoNOG">Fusobacteria (fusoNOG)</option>
-            <option value="gproNOG">Proteobacteria_gamma (gproNOG)</option>
-            <option value="haeNOG">Haemosporida (haeNOG)</option>
-            <option value="halNOG">Halobacteria (halNOG)</option>
-            <option value="homNOG">Hominidae (homNOG)</option>
-            <option value="hymNOG">Hymenoptera (hymNOG)</option>
-            <option value="hypNOG">Hypocreales (hypNOG)</option>
-            <option value="inNOG">Insects (inNOG)</option>
-            <option value="kinNOG">Kinetoplastida (kinNOG)</option>
-            <option value="lepNOG">Lepidoptera (lepNOG)</option>
-            <option value="lilNOG">Liliopsida (lilNOG)</option>
-            <option value="maNOG">Mammals (maNOG)</option>
-            <option value="magNOG">Magnaporthales (magNOG)</option>
-            <option value="meNOG">Animals (meNOG)</option>
-            <option value="metNOG">Methanobacteria (metNOG)</option>
-            <option value="methNOG">Methanococci (methNOG)</option>
-            <option value="methaNOG">Methanomicrobia (methaNOG)</option>
-            <option value="necNOG">Nectriaceae (necNOG)</option>
-            <option value="negNOG">Negativicutes (negNOG)</option>
-            <option value="nemNOG">Nematodes (nemNOG)</option>
-            <option value="onyNOG">Onygenales (onyNOG)</option>
-            <option value="opiNOG">Opisthokonts (opiNOG)</option>
-            <option value="perNOG">Peronosporales (perNOG)</option>
-            <option value="plaNOG">Planctomycetes (plaNOG)</option>
-            <option value="pleNOG">Pleosporales (pleNOG)</option>
-            <option value="poaNOG">Poales (poaNOG)</option>
-            <option value="prNOG">Primates (prNOG)</option>
-            <option value="proNOG">Proteobacteria (proNOG)</option>
-            <option value="rhaNOG">Rhabditida (rhaNOG)</option>
-            <option value="roNOG">Rodents (roNOG)</option>
-            <option value="sacNOG">Saccharomycetaceae (sacNOG)</option>
-            <option value="saccNOG">Saccharomycetes (saccNOG)</option>
-            <option value="sorNOG">Sordariales (sorNOG)</option>
-            <option value="sordNOG">Sordariomycetes (sordNOG)</option>
-            <option value="sphNOG">Sphingobacteriia (sphNOG)</option>
-            <option value="spiNOG">Spirochaetes (spiNOG)</option>
-            <option value="spriNOG">Supraprimates (spriNOG)</option>
-            <option value="strNOG">Streptophyta (strNOG)</option>
-            <option value="synNOG">Synergistetes (synNOG)</option>
-            <option value="tenNOG">Tenericutes (tenNOG)</option>
-            <option value="thaNOG">Thaumarchaeota (thaNOG)</option>
-            <option value="theNOG">Thermoplasmata (theNOG)</option>
-            <option value="therNOG">Thermotogae (therNOG)</option>
-            <option value="thermNOG">Thermococci (thermNOG)</option>
-            <option value="treNOG">Tremellales (treNOG)</option>
-            <option value="veNOG">Vertebrates (veNOG)</option>
-            <option value="verNOG">Verrucomicrobia (verNOG)</option>
-            <option value="verrNOG">Verrucomicrobiae (verrNOG)</option>
-            <option value="virNOG">Viridiplantae (virNOG)</option>
-        </param>
+        <param name="diamond_database" type="boolean" truevalue="" falsevalue="-D" checked="true" label="Install the diamond database" help="Takes ~9Gb, you most probably want it."/>
     </xml>
     <xml name="data_manager_outputs">
         <outputs>
@@ -141,33 +31,26 @@
 #import os.path
 #set $install_path = $os.path.join($os.path.dirname($__tool_directory__), 'test-data/cached_locally')
 #end if
-#if $dbs:
-#set $eggnogdbs = ' '.join(str($dbs).split(','))
-#else
-#set $eggnogdbs = 'none'
-#end if
 mkdir -p '${install_path}' &&
-download_eggnog_data.py 
-  $diamond_database -y -q 
+download_eggnog_data.py
+  $diamond_database -y -q
 #if $test == 'true'
   -s
 #end if
-  --data_dir '$install_path' 
-  $eggnogdbs &&
-python '${__tool_directory__}/data_manager_eggnog.py' --config_file '$out_file' --install_path '$install_path' --dbs '$dbs'
+  --data_dir '$install_path' &&
+python '${__tool_directory__}/data_manager_eggnog.py' --config_file '$out_file' --install_path '$install_path'
     ]]></token>
     <xml name="data_manager_test">
-        <!--
         <test>
             <param name="test" value="true"/>
-            <param name="diamond_database" value="false"/>
-            <param name="dbs" value="thaNOG"/>
+            <param name="diamond_database" value="true"/>
+            <yield />
             <output name="out_file">
                 <assert_contents>
                     <has_text text="eggnog_mapper_db" />
+                    <has_text text="@EGGNOG_DB_VERSION@" />
                 </assert_contents>
             </output>
         </test>
-        -->
     </xml>
 </macros>
--- a/eggnog_mapper.xml	Mon Nov 11 11:50:36 2019 -0500
+++ b/eggnog_mapper.xml	Sat Sep 05 07:21:28 2020 +0000
@@ -1,4 +1,4 @@
-<tool id="eggnog_mapper" name="eggNOG Mapper" version="@VERSION@.1">
+<tool id="eggnog_mapper" name="eggNOG Mapper" version="@VERSION@">
     <description>functional sequence annotation by orthology</description>
     <macros>
         <import>eggnog_macros.xml</import>
@@ -8,28 +8,15 @@
     <command detect_errors="aggressive"><![CDATA[
         emapper.py
         --data_dir '$eggnog_data.fields.path'
-        -m $db.mode 
+        -m diamond
         $translate
-        #if ($db.mode == 'hmmer'):
-            #if $db.database.fields.path:
-                --database=$db.database.fields.path
-            #else
-                --database=$db.database
-            #end if
-            #if $db.hmm_options.hmm_settings == 'specified':
-                --hmm_maxhits=$db.hmm_options.hmm_maxhits
-                --hmm_evalue=$db.hmm_options.hmm_evalue
-                --hmm_score=$db.hmm_options.hmm_score
-                --hmm_maxseqlen=$db.hmm_options.hmm_maxseqlen
-                #if str($db.hmm_options.hmm_qcov):
-                    --hmm_qcov=$db.hmm_options.hmm_qcov
-                #end if
-                --Z=$db.hmm_options.Z
-            #end if
-        #elif ($db.mode == 'diamond'):
-            --matrix '$db.matrix_gapcosts.matrix'
-            $db.matrix_gapcosts.gap_costs
-        #end if
+
+        ## Diamond option
+        --matrix '$diamond.matrix_gapcosts.matrix'
+        $diamond.matrix_gapcosts.gap_costs
+        --query-cover $diamond.query_cover
+        --subject-cover $diamond.subject_cover
+
         #if $annotation_options.tax_scope:
             --tax_scope=$annotation_options.tax_scope
         #end if
@@ -40,10 +27,10 @@
             --go_evidence=$annotation_options.go_evidence
         #end if
         #if $seed_ortholog_options.seed_ortholog_evalue:
-            --seed_ortholog_evalue=$seed_ortholog_options.seed_ortholog_evalue 
+            --seed_ortholog_evalue=$seed_ortholog_options.seed_ortholog_evalue
         #end if
         #if str($seed_ortholog_options.seed_ortholog_score):
-            --seed_ortholog_score=$seed_ortholog_options.seed_ortholog_score 
+            --seed_ortholog_score=$seed_ortholog_options.seed_ortholog_score
         #end if
         $output_options.no_file_comments
         $output_options.no_annot
@@ -52,286 +39,149 @@
         -i '${input}'
         --cpu "\${GALAXY_SLOTS:-4}"
     ]]></command>
-        <inputs>
-            <param name="input" type="data" format="fasta" label="Fasta sequences to annotate"/>
-            <param name="eggnog_data" type="select" label="Version of eggNOG Database">
-                <options from_data_table="eggnog_mapper_db"/>
-            </param>
-            <param name="translate" type="boolean" truevalue="--translate" falsevalue="" checked="false"
-                label="Are these coding DNA sequences that need to be translated?"/>
-            <conditional name="db">
-                <param name="mode" type="select" label="Annotation Type">
-                    <option value="hmmer">HMM</option>
-                    <option value="diamond">DIAMOND</option>
+    <inputs>
+        <param name="input" type="data" format="fasta" label="Fasta sequences to annotate"/>
+        <param name="eggnog_data" type="select" label="Version of eggNOG Database">
+            <options from_data_table="eggnog_mapper_db"/>
+        </param>
+        <param name="translate" type="boolean" truevalue="--translate" falsevalue="" checked="false"
+            label="Are these coding DNA sequences that need to be translated?"/>
+
+        <section name="diamond" expanded="true" title="Diamond Options">
+            <conditional name="matrix_gapcosts">
+                <param argument="--matrix" type="select" label="Scoring matrix and gap costs">
+                    <option value="BLOSUM90">BLOSUM90</option>
+                    <option value="BLOSUM80">BLOSUM80</option>
+                    <option value="BLOSUM62" selected="true">BLOSUM62</option>
+                    <option value="BLOSUM50">BLOSUM50</option>
+                    <option value="BLOSUM45">BLOSUM45</option>
+                    <option value="PAM250">PAM250</option>
+                    <option value="PAM70">PAM70</option>
+                    <option value="PAM30">PAM30</option>
                 </param>
-                <when value="hmmer">
-                    <param name="database" type="select" label="HMM target database" help="Choose either the full eggNOG database or a subset of it. Contact your Galaxy admin to have additional HMM databases installed.">
-                        <options from_data_table="eggnog_mapper_hmm_dbs">
-                            <!--
-                            <filter type="param_value" ref="eggnog_data" column="1" />
-                            <filter type="unique_value" column="3" />
-                            <validator type="no_options" message="No HMM databases are available; request installation from your Galaxy admin." />
-                            -->
-                        </options>
+                <when value="BLOSUM90">
+                    <param name="gap_costs" type="select" label="Gap Costs">
+                        <option value="--gapopen 9 --gapextend 2">Existence: 9  Extension: 2</option>
+                        <option value="--gapopen 8 --gapextend 2">Existence: 8  Extension: 2</option>
+                        <option value="--gapopen 7 --gapextend 2">Existence: 7  Extension: 2</option>
+                        <option value="--gapopen 6 --gapextend 2">Existence: 6  Extension: 2</option>
+                        <option value="--gapopen 11 --gapextend 1">Existence: 11  Extension: 1</option>
+                        <option value="--gapopen 10 --gapextend 1" selected="true">Existence: 10  Extension: 1</option>
+                        <option value="--gapopen 9 --gapextend 1">Existence: 9  Extension: 1</option>
                     </param>
-                    <conditional name="hmm_options">
-                        <param name="hmm_settings" type="select" label="HMM Search Options">
-                            <option value="default">Use defaults</option>
-                            <option value="specified">Set HMM Search Options</option>
-                        </param>
-                        <when value="default"/>
-                        <when value="specified">
-                            <param name="hmm_maxhits" type="integer" value="1" label="Max number of hits to report per query sequence"/>
-                            <param name="hmm_evalue" type="float" min="0" value="0.001" label="E-value threshold" />
-                            <param name="hmm_score" type="integer" min="0" value="20" label="Bit score threshold" />
-                            <param name="hmm_maxseqlen" type="integer" value="5000" label="Ignore query sequences larger than `maxseqlen`.  Default=5000" />
-                            <param name="hmm_qcov" type="float" value="" min="0." max="1." optional="true" label="min query coverage (from 0 to 1). Default=(disabled)" />
-                            <param name="Z" type="integer" value="40000000" min="0" label="Fixed database size used in phmmer/hmmscan (allows comparing e-values among databases).  Default=40,000,000" />
-                        </when>
-                    </conditional>
+                </when>
+                <when value="BLOSUM80">
+                    <param name="gap_costs" type="select" label="Gap Costs">
+                        <option value="--gapopen 8 --gapextend 2">Existence: 8  Extension: 2</option>
+                        <option value="--gapopen 7 --gapextend 2">Existence: 7  Extension: 2</option>
+                        <option value="--gapopen 6 --gapextend 2">Existence: 6  Extension: 2</option>
+                        <option value="--gapopen 11 --gapextend 1">Existence: 11  Extension: 1</option>
+                        <option value="--gapopen 10 --gapextend 1" selected="true">Existence: 10  Extension: 1</option>
+                        <option value="--gapopen 9 --gapextend 1">Existence: 9  Extension: 1</option>
+                    </param>
+                </when>
+                <when value="BLOSUM62">
+                    <param name="gap_costs" type="select" label="Gap Costs">
+                        <option value="--gapopen 11 --gapextend 2">Existence: 11  Extension: 2</option>
+                        <option value="--gapopen 10 --gapextend 2">Existence: 10  Extension: 2</option>
+                        <option value="--gapopen 9 --gapextend 2">Existence: 9  Extension: 2</option>
+                        <option value="--gapopen 8 --gapextend 2">Existence: 8  Extension: 2</option>
+                        <option value="--gapopen 7 --gapextend 2">Existence: 7  Extension: 2</option>
+                        <option value="--gapopen 6 --gapextend 2">Existence: 6  Extension: 2</option>
+                        <option value="--gapopen 13 --gapextend 1">Existence: 13  Extension: 1</option>
+                        <option value="--gapopen 12 --gapextend 1">Existence: 12  Extension: 1</option>
+                        <option value="--gapopen 11 --gapextend 1" selected="true">Existence: 11  Extension: 1</option>
+                        <option value="--gapopen 10 --gapextend 1">Existence: 10  Extension: 1</option>
+                        <option value="--gapopen 9 --gapextend 1">Existence: 9  Extension: 1</option>
+                    </param>
                 </when>
-                <when value="diamond">
-                    <!-- db.database is used in diamond mode only to name outputs -->
-                    <param name="database" type="hidden" value="diamond"/>
-                    <conditional name="matrix_gapcosts">
-                        <param argument="--matrix" type="select" label="Scoring matrix and gap costs">
-                            <option value="BLOSUM90">BLOSUM90</option>
-                            <option value="BLOSUM80">BLOSUM80</option>
-                            <option value="BLOSUM62" selected="true">BLOSUM62</option>
-                            <option value="BLOSUM50">BLOSUM50</option>
-                            <option value="BLOSUM45">BLOSUM45</option>
-                            <option value="PAM250">PAM250</option>
-                            <option value="PAM70">PAM70</option>
-                            <option value="PAM30">PAM30</option>
-                        </param>
-                        <when value="BLOSUM90">
-                            <param name="gap_costs" type="select" label="Gap Costs">
-                                <option value="--gapopen 9 --gapextend 2">Existence: 9  Extension: 2</option>
-                                <option value="--gapopen 8 --gapextend 2">Existence: 8  Extension: 2</option>
-                                <option value="--gapopen 7 --gapextend 2">Existence: 7  Extension: 2</option>
-                                <option value="--gapopen 6 --gapextend 2">Existence: 6  Extension: 2</option>
-                                <option value="--gapopen 11 --gapextend 1">Existence: 11  Extension: 1</option>
-                                <option value="--gapopen 10 --gapextend 1" selected="true">Existence: 10  Extension: 1</option>
-                                <option value="--gapopen 9 --gapextend 1">Existence: 9  Extension: 1</option>
-                            </param>
-                        </when>
-                        <when value="BLOSUM80">
-                            <param name="gap_costs" type="select" label="Gap Costs">
-                                <option value="--gapopen 8 --gapextend 2">Existence: 8  Extension: 2</option>
-                                <option value="--gapopen 7 --gapextend 2">Existence: 7  Extension: 2</option>
-                                <option value="--gapopen 6 --gapextend 2">Existence: 6  Extension: 2</option>
-                                <option value="--gapopen 11 --gapextend 1">Existence: 11  Extension: 1</option>
-                                <option value="--gapopen 10 --gapextend 1" selected="true">Existence: 10  Extension: 1</option>
-                                <option value="--gapopen 9 --gapextend 1">Existence: 9  Extension: 1</option>
-                            </param>
-                        </when>
-                        <when value="BLOSUM62">
-                            <param name="gap_costs" type="select" label="Gap Costs">
-                                <option value="--gapopen 11 --gapextend 2">Existence: 11  Extension: 2</option>
-                                <option value="--gapopen 10 --gapextend 2">Existence: 10  Extension: 2</option>
-                                <option value="--gapopen 9 --gapextend 2">Existence: 9  Extension: 2</option>
-                                <option value="--gapopen 8 --gapextend 2">Existence: 8  Extension: 2</option>
-                                <option value="--gapopen 7 --gapextend 2">Existence: 7  Extension: 2</option>
-                                <option value="--gapopen 6 --gapextend 2">Existence: 6  Extension: 2</option>
-                                <option value="--gapopen 13 --gapextend 1">Existence: 13  Extension: 1</option>
-                                <option value="--gapopen 12 --gapextend 1">Existence: 12  Extension: 1</option>
-                                <option value="--gapopen 11 --gapextend 1" selected="true">Existence: 11  Extension: 1</option>
-                                <option value="--gapopen 10 --gapextend 1">Existence: 10  Extension: 1</option>
-                                <option value="--gapopen 9 --gapextend 1">Existence: 9  Extension: 1</option>
-                            </param>
-                        </when>
-                        <when value="BLOSUM50">
-                            <param name="gap_costs" type="select" label="Gap Costs">
-                                <option value="--gapopen 13 --gapextend 3">Existence: 13  Extension: 3</option>
-                                <option value="--gapopen 12 --gapextend 3">Existence: 12  Extension: 3</option>
-                                <option value="--gapopen 11 --gapextend 3">Existence: 11  Extension: 3</option>
-                                <option value="--gapopen 10 --gapextend 3">Existence: 10  Extension: 3</option>
-                                <option value="--gapopen 9 --gapextend 3">Existence: 9  Extension: 3</option>
-                                <option value="--gapopen 16 --gapextend 2">Existence: 16  Extension: 2</option>
-                                <option value="--gapopen 15 --gapextend 2">Existence: 15  Extension: 2</option>
-                                <option value="--gapopen 14 --gapextend 2">Existence: 14  Extension: 2</option>
-                                <option value="--gapopen 13 --gapextend 2" selected="true">Existence: 13  Extension: 2</option>
-                                <option value="--gapopen 12 --gapextend 2">Existence: 12  Extension: 2</option>
-                                <option value="--gapopen 19 --gapextend 1">Existence: 19  Extension: 1</option>
-                                <option value="--gapopen 18 --gapextend 1">Existence: 18  Extension: 1</option>
-                                <option value="--gapopen 17 --gapextend 1">Existence: 17  Extension: 1</option>
-                                <option value="--gapopen 16 --gapextend 1">Existence: 16  Extension: 1</option>
-                                <option value="--gapopen 15 --gapextend 1">Existence: 15  Extension: 1</option>
-                            </param>
-                        </when>
-                        <when value="BLOSUM45">
-                            <param name="gap_costs" type="select" label="Gap Costs">
-                                <option value="--gapopen 13 --gapextend 3">Existence: 13  Extension: 3</option>
-                                <option value="--gapopen 12 --gapextend 3">Existence: 12  Extension: 3</option>
-                                <option value="--gapopen 11 --gapextend 3">Existence: 11  Extension: 3</option>
-                                <option value="--gapopen 10 --gapextend 3">Existence: 10  Extension: 3</option>
-                                <option value="--gapopen 15 --gapextend 2" selected="true">Existence: 15  Extension: 2</option>
-                                <option value="--gapopen 14 --gapextend 2">Existence: 14  Extension: 2</option>
-                                <option value="--gapopen 13 --gapextend 2">Existence: 13  Extension: 2</option>
-                                <option value="--gapopen 12 --gapextend 2">Existence: 12  Extension: 2</option>
-                                <option value="--gapopen 19 --gapextend 1">Existence: 19  Extension: 1</option>
-                                <option value="--gapopen 18 --gapextend 1">Existence: 18  Extension: 1</option>
-                                <option value="--gapopen 17 --gapextend 1">Existence: 17  Extension: 1</option>
-                                <option value="--gapopen 16 --gapextend 1">Existence: 16  Extension: 1</option>
-                            </param>
-                        </when>
-                        <when value="PAM250">
-                            <param name="gap_costs" type="select" label="Gap Costs">
-                                <option value="--gapopen 15 --gapextend 3">Existence: 15  Extension: 3</option>
-                                <option value="--gapopen 14 --gapextend 3">Existence: 14  Extension: 3</option>
-                                <option value="--gapopen 13 --gapextend 3">Existence: 13  Extension: 3</option>
-                                <option value="--gapopen 12 --gapextend 3">Existence: 12  Extension: 3</option>
-                                <option value="--gapopen 17 --gapextend 2">Existence: 17  Extension: 2</option>
-                                <option value="--gapopen 16 --gapextend 2">Existence: 16  Extension: 2</option>
-                                <option value="--gapopen 15 --gapextend 2">Existence: 15  Extension: 2</option>
-                                <option value="--gapopen 14 --gapextend 2" selected="true">Existence: 14  Extension: 2</option>
-                                <option value="--gapopen 13 --gapextend 2">Existence: 13  Extension: 2</option>
-                                <option value="--gapopen 21 --gapextend 1">Existence: 21  Extension: 1</option>
-                                <option value="--gapopen 20 --gapextend 1">Existence: 20  Extension: 1</option>
-                                <option value="--gapopen 19 --gapextend 1">Existence: 19  Extension: 1</option>
-                                <option value="--gapopen 18 --gapextend 1">Existence: 18  Extension: 1</option>
-                                <option value="--gapopen 17 --gapextend 1">Existence: 17  Extension: 1</option>
-                            </param>
-                        </when>
-                        <when value="PAM70">
-                            <param name="gap_costs" type="select" label="Gap Costs">
-                                <option value="--gapopen 12 --gapextend 3">Existence: 12 Extension: 3</option>
-                                <option value="--gapopen 11 --gapextend 2">Existence: 11 Extension: 2</option>
-                                <option value="--gapopen 8 --gapextend 2">Existence: 8  Extension: 2</option>
-                                <option value="--gapopen 7 --gapextend 2">Existence: 7  Extension: 2</option>
-                                <option value="--gapopen 6 --gapextend 2">Existence: 6  Extension: 2</option>
-                                <option value="--gapopen 11 --gapextend 1">Existence: 11  Extension: 1</option>
-                                <option value="--gapopen 10 --gapextend 1" selected="true">Existence: 10  Extension: 1</option>
-                                <option value="--gapopen 9 --gapextend 1">Existence: 9  Extension: 1</option>
-                            </param>
-                        </when>
-                        <when value="PAM30">
-                            <param name="gap_costs" type="select" label="Gap Costs">
-                                <option value="--gapopen 15 --gapextend 3">Existence: 15 Extension: 3</option>
-                                <option value="--gapopen 13 --gapextend 3">Existence: 13 Extension: 3</option>
-                                <option value="--gapopen 14 --gapextend 2">Existence: 14 Extension: 2</option>
-                                <option value="--gapopen 7 --gapextend 2">Existence: 7  Extension: 2</option>
-                                <option value="--gapopen 6 --gapextend 2">Existence: 6  Extension: 2</option>
-                                <option value="--gapopen 5 --gapextend 2">Existence: 5  Extension: 2</option>
-                                <option value="--gapopen 14 --gapextend 1">Existence: 14 Extension: 1</option>
-                                <option value="--gapopen 10 --gapextend 1">Existence: 10  Extension: 1</option>
-                                <option value="--gapopen 9 --gapextend 1" selected="true">Existence: 9  Extension: 1</option>
-                                <option value="--gapopen 8 --gapextend 1">Existence: 8  Extension: 1</option>
-                            </param>
-                        </when>
-                    </conditional>
+                <when value="BLOSUM50">
+                    <param name="gap_costs" type="select" label="Gap Costs">
+                        <option value="--gapopen 13 --gapextend 3">Existence: 13  Extension: 3</option>
+                        <option value="--gapopen 12 --gapextend 3">Existence: 12  Extension: 3</option>
+                        <option value="--gapopen 11 --gapextend 3">Existence: 11  Extension: 3</option>
+                        <option value="--gapopen 10 --gapextend 3">Existence: 10  Extension: 3</option>
+                        <option value="--gapopen 9 --gapextend 3">Existence: 9  Extension: 3</option>
+                        <option value="--gapopen 16 --gapextend 2">Existence: 16  Extension: 2</option>
+                        <option value="--gapopen 15 --gapextend 2">Existence: 15  Extension: 2</option>
+                        <option value="--gapopen 14 --gapextend 2">Existence: 14  Extension: 2</option>
+                        <option value="--gapopen 13 --gapextend 2" selected="true">Existence: 13  Extension: 2</option>
+                        <option value="--gapopen 12 --gapextend 2">Existence: 12  Extension: 2</option>
+                        <option value="--gapopen 19 --gapextend 1">Existence: 19  Extension: 1</option>
+                        <option value="--gapopen 18 --gapextend 1">Existence: 18  Extension: 1</option>
+                        <option value="--gapopen 17 --gapextend 1">Existence: 17  Extension: 1</option>
+                        <option value="--gapopen 16 --gapextend 1">Existence: 16  Extension: 1</option>
+                        <option value="--gapopen 15 --gapextend 1">Existence: 15  Extension: 1</option>
+                    </param>
+                </when>
+                <when value="BLOSUM45">
+                    <param name="gap_costs" type="select" label="Gap Costs">
+                        <option value="--gapopen 13 --gapextend 3">Existence: 13  Extension: 3</option>
+                        <option value="--gapopen 12 --gapextend 3">Existence: 12  Extension: 3</option>
+                        <option value="--gapopen 11 --gapextend 3">Existence: 11  Extension: 3</option>
+                        <option value="--gapopen 10 --gapextend 3">Existence: 10  Extension: 3</option>
+                        <option value="--gapopen 15 --gapextend 2" selected="true">Existence: 15  Extension: 2</option>
+                        <option value="--gapopen 14 --gapextend 2">Existence: 14  Extension: 2</option>
+                        <option value="--gapopen 13 --gapextend 2">Existence: 13  Extension: 2</option>
+                        <option value="--gapopen 12 --gapextend 2">Existence: 12  Extension: 2</option>
+                        <option value="--gapopen 19 --gapextend 1">Existence: 19  Extension: 1</option>
+                        <option value="--gapopen 18 --gapextend 1">Existence: 18  Extension: 1</option>
+                        <option value="--gapopen 17 --gapextend 1">Existence: 17  Extension: 1</option>
+                        <option value="--gapopen 16 --gapextend 1">Existence: 16  Extension: 1</option>
+                    </param>
+                </when>
+                <when value="PAM250">
+                    <param name="gap_costs" type="select" label="Gap Costs">
+                        <option value="--gapopen 15 --gapextend 3">Existence: 15  Extension: 3</option>
+                        <option value="--gapopen 14 --gapextend 3">Existence: 14  Extension: 3</option>
+                        <option value="--gapopen 13 --gapextend 3">Existence: 13  Extension: 3</option>
+                        <option value="--gapopen 12 --gapextend 3">Existence: 12  Extension: 3</option>
+                        <option value="--gapopen 17 --gapextend 2">Existence: 17  Extension: 2</option>
+                        <option value="--gapopen 16 --gapextend 2">Existence: 16  Extension: 2</option>
+                        <option value="--gapopen 15 --gapextend 2">Existence: 15  Extension: 2</option>
+                        <option value="--gapopen 14 --gapextend 2" selected="true">Existence: 14  Extension: 2</option>
+                        <option value="--gapopen 13 --gapextend 2">Existence: 13  Extension: 2</option>
+                        <option value="--gapopen 21 --gapextend 1">Existence: 21  Extension: 1</option>
+                        <option value="--gapopen 20 --gapextend 1">Existence: 20  Extension: 1</option>
+                        <option value="--gapopen 19 --gapextend 1">Existence: 19  Extension: 1</option>
+                        <option value="--gapopen 18 --gapextend 1">Existence: 18  Extension: 1</option>
+                        <option value="--gapopen 17 --gapextend 1">Existence: 17  Extension: 1</option>
+                    </param>
+                </when>
+                <when value="PAM70">
+                    <param name="gap_costs" type="select" label="Gap Costs">
+                        <option value="--gapopen 12 --gapextend 3">Existence: 12 Extension: 3</option>
+                        <option value="--gapopen 11 --gapextend 2">Existence: 11 Extension: 2</option>
+                        <option value="--gapopen 8 --gapextend 2">Existence: 8  Extension: 2</option>
+                        <option value="--gapopen 7 --gapextend 2">Existence: 7  Extension: 2</option>
+                        <option value="--gapopen 6 --gapextend 2">Existence: 6  Extension: 2</option>
+                        <option value="--gapopen 11 --gapextend 1">Existence: 11  Extension: 1</option>
+                        <option value="--gapopen 10 --gapextend 1" selected="true">Existence: 10  Extension: 1</option>
+                        <option value="--gapopen 9 --gapextend 1">Existence: 9  Extension: 1</option>
+                    </param>
+                </when>
+                <when value="PAM30">
+                    <param name="gap_costs" type="select" label="Gap Costs">
+                        <option value="--gapopen 15 --gapextend 3">Existence: 15 Extension: 3</option>
+                        <option value="--gapopen 13 --gapextend 3">Existence: 13 Extension: 3</option>
+                        <option value="--gapopen 14 --gapextend 2">Existence: 14 Extension: 2</option>
+                        <option value="--gapopen 7 --gapextend 2">Existence: 7  Extension: 2</option>
+                        <option value="--gapopen 6 --gapextend 2">Existence: 6  Extension: 2</option>
+                        <option value="--gapopen 5 --gapextend 2">Existence: 5  Extension: 2</option>
+                        <option value="--gapopen 14 --gapextend 1">Existence: 14 Extension: 1</option>
+                        <option value="--gapopen 10 --gapextend 1">Existence: 10  Extension: 1</option>
+                        <option value="--gapopen 9 --gapextend 1" selected="true">Existence: 9  Extension: 1</option>
+                        <option value="--gapopen 8 --gapextend 1">Existence: 8  Extension: 1</option>
+                    </param>
                 </when>
             </conditional>
+
+            <param name="query_cover" type="integer" value="0" min="0" max="100" label="Minimum query coverage" help="Report only alignments above the given percentage of query cover" />
+            <param name="subject_cover" type="integer" value="0" min="0" max="100" label="Minimum subject coverage" help="Report only alignments above the given percentage of subject cover" />
+        </section>
+
         <section name="annotation_options" expanded="false" title="Annotation Options">
-            <param name="tax_scope" type="select" optional="true" label="Set taxonomic scope">
-                <option value="NOG">All organisms  (NOG)</option>
-                <option value="aciNOG">Acidobacteria  (aciNOG)</option>
-                <option value="acidNOG">Acidobacteriia  (acidNOG)</option>
-                <option value="acoNOG">Aconoidasida  (acoNOG)</option>
-                <option value="actNOG">Actinobacteria  (actNOG)</option>
-                <option value="agaNOG">Agaricales  (agaNOG)</option>
-                <option value="agarNOG">Agaricomycetes  (agarNOG)</option>
-                <option value="apiNOG">Apicomplexa  (apiNOG)</option>
-                <option value="aproNOG">Proteobacteria_alpha  (aproNOG)</option>
-                <option value="aquNOG">Aquificae  (aquNOG)</option>
-                <option value="arNOG">Archaea  (arNOG)</option>
-                <option value="arcNOG">Archaeoglobi  (arcNOG)</option>
-                <option value="artNOG">Arthropoda  (artNOG)</option>
-                <option value="arthNOG">Arthrodermataceae  (arthNOG)</option>
-                <option value="ascNOG">Ascomycota  (ascNOG)</option>
-                <option value="aveNOG">Aves  (aveNOG)</option>
-                <option value="bacNOG">Bacilli  (bacNOG)</option>
-                <option value="bactNOG">Bacteria  (bactNOG)</option>
-                <option value="bacteNOG">Bacteroidia  (bacteNOG)</option>
-                <option value="basNOG">Basidiomycota  (basNOG)</option>
-                <option value="bctoNOG">Bacteroidetes  (bctoNOG)</option>
-                <option value="biNOG">Bilateria  (biNOG)</option>
-                <option value="bproNOG">Proteobacteria_beta  (bproNOG)</option>
-                <option value="braNOG">Brassicales  (braNOG)</option>
-                <option value="carNOG">Carnivora  (carNOG)</option>
-                <option value="chaNOG">Chaetomiaceae  (chaNOG)</option>
-                <option value="chlNOG">Chlorobi  (chlNOG)</option>
-                <option value="chlaNOG">Chlamydiae  (chlaNOG)</option>
-                <option value="chloNOG">Chloroflexi  (chloNOG)</option>
-                <option value="chlorNOG">Chloroflexi  (chlorNOG)</option>
-                <option value="chloroNOG">Chlorophyta  (chloroNOG)</option>
-                <option value="chorNOG">Chordata  (chorNOG)</option>
-                <option value="chrNOG">Chromadorea  (chrNOG)</option>
-                <option value="cloNOG">Clostridia  (cloNOG)</option>
-                <option value="cocNOG">Coccidia  (cocNOG)</option>
-                <option value="creNOG">Crenarchaeota  (creNOG)</option>
-                <option value="cryNOG">Cryptosporidiidae  (cryNOG)</option>
-                <option value="cyaNOG">Cyanobacteria  (cyaNOG)</option>
-                <option value="cytNOG">Cytophagia  (cytNOG)</option>
-                <option value="debNOG">Debaryomycetaceae  (debNOG)</option>
-                <option value="defNOG">Deferribacteres  (defNOG)</option>
-                <option value="dehNOG">Dehalococcoidetes  (dehNOG)</option>
-                <option value="deiNOG">Deinococcusthermus  (deiNOG)</option>
-                <option value="delNOG">delta/epsilon  (delNOG)</option>
-                <option value="dipNOG">Diptera  (dipNOG)</option>
-                <option value="dotNOG">Dothideomycetes  (dotNOG)</option>
-                <option value="dproNOG">Proteobacteria_delta  (dproNOG)</option>
-                <option value="droNOG">Drosophilidae  (droNOG)</option>
-                <option value="eproNOG">Proteobacteria_epsilon  (eproNOG)</option>
-                <option value="eryNOG">Erysipelotrichi  (eryNOG)</option>
-                <option value="euNOG">Eukaryotes  (euNOG)</option>
-                <option value="eurNOG">Euryarchaeota  (eurNOG)</option>
-                <option value="euroNOG">Eurotiomycetes  (euroNOG)</option>
-                <option value="eurotNOG">Eurotiales  (eurotNOG)</option>
-                <option value="fiNOG">Fishes  (fiNOG)</option>
-                <option value="firmNOG">Firmicutes  (firmNOG)</option>
-                <option value="flaNOG">Flavobacteriia  (flaNOG)</option>
-                <option value="fuNOG">Fungi  (fuNOG)</option>
-                <option value="fusoNOG">Fusobacteria  (fusoNOG)</option>
-                <option value="gproNOG">Proteobacteria_gamma  (gproNOG)</option>
-                <option value="haeNOG">Haemosporida  (haeNOG)</option>
-                <option value="halNOG">Halobacteria  (halNOG)</option>
-                <option value="homNOG">Hominidae  (homNOG)</option>
-                <option value="hymNOG">Hymenoptera  (hymNOG)</option>
-                <option value="hypNOG">Hypocreales  (hypNOG)</option>
-                <option value="inNOG">Insects  (inNOG)</option>
-                <option value="kinNOG">Kinetoplastida  (kinNOG)</option>
-                <option value="lepNOG">Lepidoptera  (lepNOG)</option>
-                <option value="lilNOG">Liliopsida  (lilNOG)</option>
-                <option value="maNOG">Mammals  (maNOG)</option>
-                <option value="magNOG">Magnaporthales  (magNOG)</option>
-                <option value="meNOG">Animals  (meNOG)</option>
-                <option value="metNOG">Methanobacteria  (metNOG)</option>
-                <option value="methNOG">Methanococci  (methNOG)</option>
-                <option value="methaNOG">Methanomicrobia  (methaNOG)</option>
-                <option value="necNOG">Nectriaceae  (necNOG)</option>
-                <option value="negNOG">Negativicutes  (negNOG)</option>
-                <option value="nemNOG">Nematodes  (nemNOG)</option>
-                <option value="onyNOG">Onygenales  (onyNOG)</option>
-                <option value="opiNOG">Opisthokonts  (opiNOG)</option>
-                <option value="perNOG">Peronosporales  (perNOG)</option>
-                <option value="plaNOG">Planctomycetes  (plaNOG)</option>
-                <option value="pleNOG">Pleosporales  (pleNOG)</option>
-                <option value="poaNOG">Poales  (poaNOG)</option>
-                <option value="prNOG">Primates  (prNOG)</option>
-                <option value="proNOG">Proteobacteria  (proNOG)</option>
-                <option value="rhaNOG">Rhabditida  (rhaNOG)</option>
-                <option value="roNOG">Rodents  (roNOG)</option>
-                <option value="sacNOG">Saccharomycetaceae  (sacNOG)</option>
-                <option value="saccNOG">Saccharomycetes  (saccNOG)</option>
-                <option value="sorNOG">Sordariales  (sorNOG)</option>
-                <option value="sordNOG">Sordariomycetes  (sordNOG)</option>
-                <option value="sphNOG">Sphingobacteriia  (sphNOG)</option>
-                <option value="spiNOG">Spirochaetes  (spiNOG)</option>
-                <option value="spriNOG">Supraprimates  (spriNOG)</option>
-                <option value="strNOG">Streptophyta  (strNOG)</option>
-                <option value="synNOG">Synergistetes  (synNOG)</option>
-                <option value="tenNOG">Tenericutes  (tenNOG)</option>
-                <option value="thaNOG">Thaumarchaeota  (thaNOG)</option>
-                <option value="theNOG">Thermoplasmata  (theNOG)</option>
-                <option value="therNOG">Thermotogae  (therNOG)</option>
-                <option value="thermNOG">Thermococci  (thermNOG)</option>
-                <option value="treNOG">Tremellales  (treNOG)</option>
-                <option value="veNOG">Vertebrates  (veNOG)</option>
-                <option value="verNOG">Verrucomicrobia  (verNOG)</option>
-                <option value="verrNOG">Verrucomicrobiae  (verrNOG)</option>
-                <option value="virNOG">Viridiplantae  (virNOG)</option>
-            </param>
+            <param name="tax_scope" type="integer" optional="true" label="Set taxonomic scope" help="NCBI taxonomy id" />
             <param name="target_orthologs" type="select" label="target orthologs for functional transfer">
                 <option value="one2one">one2one</option>
                 <option value="many2one">many2one</option>
@@ -348,13 +198,13 @@
         <section name="seed_ortholog_options" expanded="false" title="Seed Ortholog Search Options">
             <param name="seed_ortholog_evalue" type="float" value="0.001" min="0" label="Min E-value threshold">
                 <help>
-                Min E-value expected when searching for seed eggNOG ortholog. Applies to phmmer/diamond searches. 
+                Min E-value expected when searching for seed eggNOG ortholog. Applies to phmmer/diamond searches.
                 Queries not having a significant seed orthologs (E-value less than threshold) will not be annotated.
                 </help>
             </param>
             <param name="seed_ortholog_score" type="integer" value="60" min="0" label="Minimum bit score threshold">
                 <help>
-                Min bit score expected when searching for seed eggNOG ortholog. 
+                Min bit score expected when searching for seed eggNOG ortholog.
                 Queries not having a significant seed orthologs will not be annotated.
                 </help>
             </param>
@@ -369,24 +219,18 @@
         </section>
     </inputs>
     <outputs>
-        <data name="seed_orthologs" format="tabular" label="${tool.name} on ${on_string}: ${db.database}.seed_orthologs" from_work_dir="results.emapper.seed_orthologs">
+        <data name="seed_orthologs" format="tabular" label="${tool.name} on ${on_string}: seed_orthologs" from_work_dir="results.emapper.seed_orthologs">
             <actions>
                 <action name="column_names" type="metadata" default="query_name,seed_eggNOG_ortholog,seed_ortholog_evalue,seed_ortholog_score"/>
             </actions>
         </data>
-        <data name="annotations" format="tabular" label="${tool.name} on ${on_string}: ${db.database}.annotations" from_work_dir="results.emapper.annotations">
+        <data name="annotations" format="tabular" label="${tool.name} on ${on_string}: annotations" from_work_dir="results.emapper.annotations">
             <filter>not output_options['no_annot']</filter>
             <actions>
-                <action name="column_names" type="metadata" default="query_name,seed_eggNOG_ortholog,seed_ortholog_evalue,seed_ortholog_score,predicted_gene_name,GO_terms,KEGG_KO,BiGG_Reactions,Annotation_tax_scope,Matching_OGs,best_OG|evalue|score,COG_functional_categories,eggNOG_HMM_model_annotation"/>
+                <action name="column_names" type="metadata" default="query_name,seed_eggNOG_ortholog,seed_ortholog_evalue,seed_ortholog_score,predicted_taxonomic_group,predicted_protein_name,GO_terms,EC_number,KEGG_KO,KEGG_Pathway,KEGG_Module,KEGG_Reaction,KEGG_rclass,BRITE,KEGG_TC,CAZy,BiGG_Reactions,Annotation_tax_scope,Matching_OGs,best_OG|evalue|score,COG_functional_categories,eggNOG_free_text_description"/>
             </actions>
         </data>
-        <data name="hmm_hits" format="tabular" label="${tool.name} on ${on_string}: ${db.database}.hmm_hits"  from_work_dir="results.emapper.hmm_hits">
-            <filter>db['mode'] == 'hmmer'</filter>
-            <actions>
-                <action name="column_names" type="metadata" default="query_name,hit,evalue,sum_score,query_length,hmmfrom,hmmto,seqfrom,seqto,query_coverage"/>
-            </actions>
-        </data>
-        <data name="annotations_orthologs" format="tabular" label="${tool.name} on ${on_string}: ${db.database}.annotations.orthologs"  from_work_dir="results.emapper.annotations.orthologs">
+        <data name="annotations_orthologs" format="tabular" label="${tool.name} on ${on_string}: annotations.orthologs"  from_work_dir="results.emapper.annotations.orthologs">
             <filter>output_options['report_orthologs']</filter>
             <actions>
                 <action name="column_names" type="metadata" default="query_name,orthologs"/>
@@ -395,23 +239,32 @@
     </outputs>
     <tests>
         <test>
-            <param name="input" value="nlim_fragment.fasta" ftype="fasta"/>
-            <param name="database" value="ENOG411CB2I"/>
-            <param name="mode" value="hmmer"/>
-            <!--
-            <param name="test" value="true"/>
-            -->
-            <param name="eggnog_data" value="4.5"/>
+            <param name="input" value="Nmar_0135.fa" ftype="fasta"/>
+            <param name="eggnog_data" value="@EGGNOG_DB_VERSION@"/>
             <param name="no_annot" value="true"/>
             <param name="no_file_comments" value="true"/>
-            <output name="hmm_hits" file="HMM_nlim.emapper.hmm_hits" ftype="tabular"/>
+            <output name="seed_orthologs" file="DIA_nlim.emapper.seed_orthologs" ftype="tabular"/>
         </test>
         <test>
-            <param name="input" value="nlim_fragment.fasta" ftype="fasta"/>
-            <param name="eggnog_data" value="4.5"/> <!-- not passed in test, but required for test to work -->
-            <param name="no_annot" value="true"/>
-            <param name="mode" value="diamond"/>
+            <param name="input" value="Nmar_0135.fa" ftype="fasta"/>
+            <param name="eggnog_data" value="@EGGNOG_DB_VERSION@"/> <!-- not passed in test, but required for test to work -->
+            <param name="report_orthologs" value="true"/>
+            <param name="no_file_comments" value="true"/>
             <output name="seed_orthologs" file="DIA_nlim.emapper.seed_orthologs" ftype="tabular"/>
+            <output name="annotations" file="DIA_nlim.emapper.annotations" ftype="tabular"/>
+            <output name="annotations_orthologs" file="DIA_nlim.emapper.annotations_orthologs" ftype="tabular"/>
+        </test>
+        <test>
+            <param name="input" value="Nmar_0135.fa" ftype="fasta"/>
+            <param name="eggnog_data" value="@EGGNOG_DB_VERSION@"/> <!-- not passed in test, but required for test to work -->
+            <param name="report_orthologs" value="true"/>
+            <param name="no_file_comments" value="true"/>
+            <section name="annotation_options">
+                <param name="tax_scope" value="651137" />
+            </section>
+            <output name="seed_orthologs" file="scoped.emapper.seed_orthologs" ftype="tabular"/>
+            <output name="annotations" file="scoped.emapper.annotations" ftype="tabular"/>
+            <output name="annotations_orthologs" file="scoped.emapper.annotations_orthologs" ftype="tabular"/>
         </test>
     </tests>
     <help><![CDATA[
@@ -421,38 +274,22 @@
 Overview
 --------
 
-``eggnog-mapper`` is a tool for fast functional annotation of novel sequences (genes or proteins) using precomputed eggNOG-based orthology assignments. 
-Obvious examples include the annotation of novel genomes, transcriptomes or even metagenomic gene catalogs. 
-The use of orthology predictions for functional annotation is considered more precise than traditional homology searches, 
+``eggnog-mapper`` is a tool for fast functional annotation of novel sequences (genes or proteins) using precomputed eggNOG-based orthology assignments.
+Obvious examples include the annotation of novel genomes, transcriptomes or even metagenomic gene catalogs.
+The use of orthology predictions for functional annotation is considered more precise than traditional homology searches,
 as it avoids transferring annotations from paralogs (duplicate genes with a higher chance of being involved in functional divergence).
 
 EggNOG-mapper is also available as a public online resource:  `<http://beta-eggnogdb.embl.de/#/app/emapper>`_.
 
-Options
--------
-
-``eggnog-mapper`` can use two search algorithms: `HMMER <http://hmmer.org/>`_ and `DIAMOND <https://github.com/bbuchfink/diamond>`_. 
-HMMER is more sensitive, while DIAMOND is faster and useful for larger sets of query sequences. 
-
-
 Outputs
 -------
 
-**hmm_hits**
-
-For each query sequence, a list of significant 
-hits to eggNOG Orthologous Groups (OGs) is reported. 
-Each line in the file represents a hit, where evalue, bit-score, 
-query-coverage and the sequence coordinates of the match are reported. 
-If multiple hits exist for a given query, results are sorted by e-value.
-Only returned when using HMMER mode. 
-
 **seed_orthologs**
 
-each line in the file provides the best match of each query within the best Orthologous Group (OG) 
-reported in the [project].hmm_hits file, obtained running PHMMER against all sequences within the best OG. 
-The seed ortholog is used to fetch fine-grained orthology relationships from eggNOG. 
-If using the diamond search mode, seed orthologs are directly 
+each line in the file provides the best match of each query within the best Orthologous Group (OG)
+reported in the [project].hmm_hits file, obtained running PHMMER against all sequences within the best OG.
+The seed ortholog is used to fetch fine-grained orthology relationships from eggNOG.
+If using the diamond search mode, seed orthologs are directly
 obtained from the best matching sequences by running DIAMOND against the whole eggNOG protein space.
 
 **annotations**
@@ -463,14 +300,24 @@
 - ``seed_eggNOG_ortholog``: best protein match in eggNOG
 - ``seed_ortholog_evalue``: best protein match (e-value)
 - ``seed_ortholog_score``: best protein match (bit-score)
-- ``predicted_gene_name``: Predicted gene name for query sequences
+- ``predicted_taxonomic_group``
+- ``predicted_protein_name``: Predicted protein name for query sequences
 - ``GO_terms``: Comma delimited list of predicted Gene Ontology terms
-- ``KEGG_pathways``: Comma delimited list of predicted KEGG pathways
+- ``EC_number``
+- ``KEGG_KO``
+- ``KEGG_Pathway``: Comma delimited list of predicted KEGG pathways
+- ``KEGG_Module``
+- ``KEGG_Reaction``
+- ``KEGG_rclass``
+- ``BRITE``
+- ``KEGG_TC``
+- ``CAZy``
+- ``BiGG_Reactions``
 - ``Annotation_tax_scope``: The taxonomic scope used to annotate this query sequence
 - ``Matching_OGs``: Comma delimited list of matching eggNOG Orthologous Groups
-- ``best_OG|evalue|score``: Best matching Orthologous Groups (only in HMM mode)
-- ``COG functional categories``: COG functional category inferred from best matching OG
-- ``eggNOG_HMM_model_annotation``: eggNOG functional description inferred from best matching OG
+- ``best_OG|evalue|score``: Best matching Orthologous Groups (deprecated, use smallest from eggnog OGs)
+- ``COG_functional_categories``: COG functional category inferred from best matching OG
+- ``eggNOG_free_text_description``
 
     ]]></help>
     <expand macro="citations"/>
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/DIA_nlim.emapper.annotations	Sat Sep 05 07:21:28 2020 +0000
@@ -0,0 +1,1 @@
+Nmar_0135	436308.Nmar_0135	3.8e-149	510.8	Thaumarchaeota													Archaea	41T2K@651137,COG1083@1,arCOG04817@2157	NA|NA|NA	M	Cytidylyltransferase
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/DIA_nlim.emapper.annotations_orthologs	Sat Sep 05 07:21:28 2020 +0000
@@ -0,0 +1,1 @@
+Nmar_0135	
--- a/test-data/DIA_nlim.emapper.seed_orthologs	Mon Nov 11 11:50:36 2019 -0500
+++ b/test-data/DIA_nlim.emapper.seed_orthologs	Sat Sep 05 07:21:28 2020 +0000
@@ -1,1 +1,1 @@
-Nlim_1033886738.Nlim_1033Cytidyltransferase-like	886738.Nlim_1033	5.4e-20	78.6
+Nmar_0135	436308.Nmar_0135	3.8e-149	510.8
--- a/test-data/HMM_nlim.emapper.hmm_hits	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,1 +0,0 @@
-Nlim_1033886738.Nlim_1033Cytidyltransferase-like	ENOG411CB2I	2.3e-16	46.1	39	1	39	1	38	0.948717948718
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/Nmar_0135.fa	Sat Sep 05 07:21:28 2020 +0000
@@ -0,0 +1,6 @@
+>Nmar_0135
+MKFCNVGIIIQARTGSDRFPKKVLASIEKKPMIWHIVNRCKKVKNIDKIILATTTLKEDY
+PLISLAKKNKIEYFRGSKNDVLDRFYQCSTSNNLDIIIRITGDCPLVDPKLIDQFLDFFS
+HKKYDYVSNTINPTYPDGLDIEIFSFKALKKAWNMSKKKSNREHVTTFIKHHPEKFKIKN
+FENNTNLSNYRLTVDHKNDLKLIRKIYKEFRPNIKFSTKSVISLLNKNPELFKINQNISR
+NEGYEKSLLNDN
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/README	Sat Sep 05 07:21:28 2020 +0000
@@ -0,0 +1,1 @@
+cached_locally content is a reduced database, following instructions on https://github.com/galaxyproteomics/egglet
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2A.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
->1001994.MY1_1439
-MKIQIYILIGVVVLTLISVGIMTNQDQNTHENKIRVAYFPNISHAIPIVGIEKGFFSNHIGSDIDIQPILFDSGPQVIESIFAGSVDIAYVGPGPAINAFLKSEQHDVKILSGAASGGVSFIVHPKSEIKSVADFAGKRIAAPQIGNTQDISLRTYLSDNGLKPAEKGGSVIILNTGNSDIYILFAKGDIDGAWVPEPTATILVQQLGGTRLFNENELWPENKFATVVLIAKEEYVNSHPEIIQKWLEAHQQTADWINSNKEETKTIFFDFMKNEMGKSLPVELIDESLSNLEITSDPIVSSIDTIAKRADSLGYLGRHGYNLDGLFFDKNSNSQSQEVLVNNDQT
->436308.Nmar_1285
-MKIRSVIAAGIGAIIVFSALGIALSSSDTTYENKIRIAYFPNIGHAIPIVGMEKGFFAEHLGDDVKIETKVFDSGPQAIESLFANSIDIAYVGPGPAINGFLNSNNQNVKILAGAASGGASFIVHPDSEINTADDFAGKKIAAPQIGNTQDVSLRHFLAENQLKPAEKGGNVVVYNIPNPDIYTLFVKGDIDGAWVAEPWATILETELDGKRLFHEEELWPDKEFASVLLIGNVDYIDKNSVVWADYIRAHHETQIWIESNPIETRNVFNDFLDSYLGQSLSDDVVDVALSNIMITADPKPNSVVSFAEKADTLGYLGRNGYDLSGIFYSFDTNSLEEAST
->886738.Nlim_1020
-MKMRSIILAGIASIILILSVGIIVNTDGSTRENKIRVAYFPNITHVVPIIGLERGTFANEIGNTITIQPILFDSGPQVIESIFAGSVNIAYVGPGPAINGFLKSEHHNVKILSGAASGGVSFIVHPDSKINSAEDFIGKRIAAPQIGNSQDISLRTYLSANGLKPAEKGGSVIVLNVPNSDIYTLFAKGDIDAAWVAEPTATLLVQKLNGTRLFDEIDMWPDQKFASVLLIANEDYVNQHPEVIRKWLEAHQQTIDWINSNPEETRIIFNQFLKRELGKSLPDNLIDESLSKLQITSDPIVSSIETFAKRADSLGYLGRHGYSLDGIFFDINSNSQLQEVLIP
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2B.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
->1001994.MY1_0167
-MSYDGAIEALSTDALKFVKDDFVIGLGSGRAATAFVKSLSSFIKIKNYNIRGVPTSLQIKLIAEKGGIPLVEAEQVDHIDIVFDGADQIDSQKFVIKGGGGALLRENILFNLAKKVVVMADKSKFVKNFTRSVPVEVHPQARNLVTYEIKKLGGKAELRLIDRGYPFFTENGNIILDCDFGVIKNPKILSQKIKQVAGVIESGIFIRKPDVIYRAKTGGKFDII
->436308.Nmar_0218
-MSYDGAITALSNNALKFVKDDYVVGLGSGRAATVLVKSLGKLIKLKNYNIKGVPTSLQIKLIAEKVGIPLIEADQVEHIDVVFDGADQIDSQKFVIKGGGGALLRENILFSLAKKVVVMADKTKFVKNFTRTVPVEVHPLARNSVSKSMKKLGGKAELRSLDRGYPFFTENGNIILDCDFGTIKNPKALTQKIKATTGVLESGIFLRKPDVIYRAKTGEKFDIL
->886738.Nlim_1248
-MSYDDAIEALSTDALKFVKDGFVIGLGSGRAATSFVKSLSSFIKIKNYSIKAVPTSLQIKLIAEKGGIPLVEADHVEYIDVVFDGADQIDSQKFVIKGGGGALLRENILFNLSKKVVVMADKSKFVKNFTREVPVEVHPLARNSVIDAIRKLGGNAQLRSLDRGYPFFTENGNIILDCNFGTIKNPKSLTQKIKQITGVMESGIFLRKPDVIYKAKTGGKFEII
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2C.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,4 +0,0 @@
->1001994.MY1_1435
-MVQKEPFLTALQNRILLFDGAMGTEIQKYNPKPEDFPNNQDGFNDGLVITHPDWIKKIHKNYLDAGSDCIETNSFGSNKIKLDEYGFGDQTIEFNKKIAQLAVEVCSEYTDKPRYVIGSMGPSGYLPSSNDPDLGQKPLGEIRNAFELQAEGLILGGVDALLIETSQDILEVKLVIEACHNAMKKTGKKVPIIANTTLDQYGKMLLGTNIQAAYTTVSDMGIDVFGLNCSTGPAEMTPSVRWLDEQNEHNLLVVPNAGMPENQGGQAVYKMTPQKMGELLGDFLKQYKKVRIIGGCCGTNPEHIAVLRKVIDEKAYSVKG
->436308.Nmar_1268
-MTEKEPFLDALQNRVLLFDGAMGTEIQKFNPKPEDFPNNQDGFNDGLVVTRPDWIKQIHRHYLDAGADCIETNSFGSNKIKLDEYGFGDQTIEFNKKIAQLASEVCQEYSDRPRYVIGSMGPSGFLPSSNDPDLGQKPLDEIKEAFELQAEGLILGGVDALLIETSQDILEVKLVIEACHQAMEKTGKKIPIIANTTLDQYGKMLLGTNIQAAYTTVSDMGIDVFGMNCSTGPIEMTPSVRWLDEQNEHNILVVPNAGMPENEGGQAVYKMTPEKMGDALGDFLNQYKKVRIIGGCCGTNPEHIKVLRKVIDEKANSVEG
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2D.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
->1001994.MY1_0571
-MDKSGVIVGAISGAAIVAIIFAVILAVPPTAVKADVISDNKSIPSATGAILTDYSKKLSLIEIFEKSEPGVVRINVQRAEQSNGTSGVGSGFVFDKQGHIITNAHVVKNVKKVVVTFLDGRSYNAEIVGSDQYTDIGVIKVNADLSLLQPLPLGDSANLKVGEPIAAIGNPFGLSGSMTSGIISQLGRLLPSGAGYSIPDVIQTDAAINPGNSGGPLLNMRGEIVGINTAIQSTTGEFTGVGFAVPSQTLAKIVPKIIVDGKYIHPWIGIAGRDIDPDLAKVLNLNDAVGFLVITVVDDSPAAKAGIHGSNETVEVDGIKYLIGGDIILSVDGNQVRKIDDILIHLQRAKSVGDEMVLEVLRDGRTTNIIITLDERPNGN
->436308.Nmar_0594
-MDKSGVFVGGAIGAVIVVAIFAVLFVSPPESVKPDIVVSNGHGPSTVGEVTPVYSKDLSLIEIFEKSEPGVVRVNVQREEVSDVGGVGSGFVFDKQGHIITNEHVIDDAKKIIITFLDGRSYNAEIIGTDEFTDLAVVKVNADLALLHPLSIGDSSNLKVGEPIAAIGNPFGLSGSMTSGIVSQLGRLLPSGSGYSIPDVIQTDAAINPGNSGGPLLNMRGEIVGINTAIQSATGEFTGVGFAIPSQTVAKIVPTLIEDGDYKHPWIGISGRDIDPDLAKVLELPDAVGFLVVTVIEDSPASKAGLIGSEKTIDVDGVNYPMGGDIILAVDGIEVRKIDDILIHLQRAKSVGDEMVLEVLRDGRTTDISIILQERPNGN
->886738.Nlim_0162
-MSKSEMLVGAAIGASVVAVIFAIILISPAAITKSEINTSDKSIPSVTQTAPAYSTNLSLIDIFEKSEPGVVRVNVQRTDQSNGTSGLGSGFVFDKKGDIITNAHVVKNAKNIVVTFLDGRSYNADLIGSDEFTDIAVIKVNADLTRLHPLSLGDSSSLKVGESIAAIGNPFGLSGSMTSGIVSQLGRLLPSGSGYSIPDVIQTDAAINPGNSGGPLLNMRGEIVGINTAIQSTTGEFTGVGFAVPSQTIVKIVPSLIQDGTYHHPWIGITGRDIEPDLAKVLKLNDAVGFLIVSVIDDSPAAKAGLHGSNETVQVDGLNYQIGGDIILSVDGKQVRKIDDILVHLQRAKSVGDEMVLEILRDGRTTNITINLEERPNGN
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2E.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
->1001994.MY1_1525
-MEPSLVTSIGKIQLERPVMLASGILGISLDVFNRLYRSGAGAVVSKSLSTEPWDGYPNPTIFGINGGGWINAVGLSNPGAPNFAKMIEPNKDVPIIISLVGSIPEDFSTMVEQFKNSKVIAYELNLSCPHVAKVGLEVGDDPELVKKIVSTVKNSTNVPVIAKVGLGTTHYLNTVSAAIDSGIDAITAINTIRAIAIDVETQRPILSNKFGGLSGTPIKPIALRCVYEISSKYDIPIIGCGGISTWEDALEFILAGASAIQIGSAIGDNWIHVFNDINKGILQYMKRKGYSKIDEMIGLAKKS
->436308.Nmar_1390
-MEPNLATSIGPIQLDRPVMLASGILGISLDVFSRLYRSGAGAVVTKSLSTEPWEGYPNPTIFSVKGGGWINAVGLSNPGAENFAKMIEPNQDVPIIVSLVGSIPEDFEKMIKQFENCKVTAYELNLSCPHVAKVGLEVGDDPELVKKIVTTVKNSTNVPVIAKVGLGTTHYLNTVGTAIESGIDAITAINTVRSMAIDVETQRPILSNKFGGLSGTPIKPIALRCVYEISSKYDIPIIGCGGISTWEDAVEFFLAGASSVQLGSAIGDNWIDVFNEINTGILQYMEKKNYSKIEEMIGLAKKS
->886738.Nlim_1764
-MEPSLVTSIGKIQLERPVMLASGILGISLDVFNRLYRSGAGAVVTKSLSTEPWDGYPNPTIFSVNGGGWINAVGLSNPGAPNFAKMIESNTTVPIIVSLVGSIAEDFEMMVSQFKNCKVTAYELNLSCPHVAKVGLEVGDDPELVKKIVSTVKNSTAVPVIAKVGLGTTHYLNTVKTAIDSGIDAITAINTVRAMAIDVETQRPILSNKFGGLSGTPIKPIALRCVYEISSKYDIPIIGCGGISTWEDAIEFILGGASAIQLGSAIGDRWLNVFNDINDGIIRYMKRKGYSKLDEMVGLAKKS
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2F.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
->1001994.MY1_0238
-MLEISSTPLVIIAILGTVGILLPIISIARKEKGSNSFYAVIAFAALIVSIGYVAYQFVNGNILPSALFSEDVLVDDAFGGFFAIAMLIVAIFTTVGSFNYMRKKNYPAVYYSLILLSTIGMVLVAYSTDLVMLFVAWELMSIPTYVLAGFMKKNPSSNEAALKYFLFGALSSAIIVYGISLSYGLTGSTNIGEVIQGYATLDPSLLPLALLSVGMFIAGFGFKMGLVPFHQWLPDTYEGAPPTITTLLAAGTKKAGFAATIRIVVLGMVVLNLDWTLALGVIAVMTMTIGNIAAIMQKNLARMLAYSSIAHAGYILIGLAVSPYSSLGLQGSLYHILNHAVMKGMAFIAVTGIITTLAVTHIDKLKGLGRRMPITALGLIISLFALAGVPPLAGFWSKLVLFGGALDAGTSIWWAPWLAIAGVLNSALSLAYYGWITRKMYFEGENEKRVSEPKSIIAIMIFSIVFLVGFGIYPDPIIKFVEFAAPTFSLGVMP
->436308.Nmar_0286
-MLEITSTPLILIAILGTVGVILPIISIARKEKGSNSFYAVIAFAALIVSMAYVGYEFINENVAASALFSDDVIVDDAFGGFFAIAMLIVALFTTVGSFNYMRKHNSPAVYYSLILLATIGMILVAYSTDLVMLFVAWELMSIPTYILVGYMKKNPSSNEAALKYFLFGALSSAIIVYGIAISYGLTGSTNIGEVIEGYSTLDPSLLPLALLSVGMFIAGFGFKMGLVPFHQWLPDTYEGAPSPVTALLAAATKKAGFAAAIRIIVLGMMALNLDWTLALGIIAVMTMTIGNVAAIMQKNLSRMLAYSSIAHAGYILIGLAVAPYSSLGLQGSLYQIFNHAVMKGAAFIAIAGIVTTLAVTHIDKLKGLGRRMPITALGMVISLFALAGVPPLSGFWSKLMLFGSALDASTALWWAPWLAIAGVLNSALSLAYYGWITRKMYFEGETEKRVSEPKSIVAVMIFSIIFLVGFGVYPEPLLKFVEFATPVVSLGLMP
->886738.Nlim_1181
-MLEITSTPLVIIAILGTVGVLLPIISIARKEKGSNSFYAIIAFAALIVSIGYVAYQFINDNVLPSALFSEDVLVDDAFGGFFAIAMLIVAIFTTIGSFNYMRKKNYPAVYYSLILLSTIGMVLVAYSTDLVMLFVAWELMSIPTYVLVGFMKKNPSSNEAALKYFLFGALSSAIIVYGISLSYGLTGSTNIGEVIQGYATLDASLLPLALLSVGMFIAGFGFKMGLVPFHQWLPDTYEGAPPTITTLLAAGTKKAGFAATIRIVVLGMVVLNLDWTLALGVIAVMTMTIGNIAAIMQKNLARMLAYSSIAHAGYILIGLAVSPYSSLGLQGSLYQILNHAVMKGMAFIAVTGIVTTLAVTHIDKLKGLGRRMPITAFGLVISLFALAGVPPLAGFWSKLMLFGGALDAGSTIWWAPWLAIAGVLNSALSLAYYGWITRKMYFEGETEKRVREPKSIIAIMVFSIIFLVGFGVYPDPIIKFVEFAAPTFSLGIMP
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2G.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
->1001994.MY1_1852
-MISLNRFVIILIVGIFVSGILTISFISNSYVDANSTKKINFTKTIISSQDPGQGHENHQLSLILSPNEGTLYDGSMTFTSNEPVDVVVLHEITGNDVKGQPTWTIDGKTIYAMSLIDLKSKSDSFEFTGAALALHSSNSKEFTATVSVDGWIRGQPTEVIMQKIQVEKDPSLMLSRANVEATMPMHEGLYKGNSIFYIITDTSREEYSKKITEKQDWKVQTSTLIEKMPEEILQKIFIFNNGVRGQGIYGHQKEIFSSTPVQESKYSALNSVIEVSWKKGQNAKVLESFEDVIDAEKNGRIEFTKTGVVINSPQIIWPNGQMLVRNDTKITDDLTFSGGQITKINKDEMTVTFVAHRMWGPDGKTIYAIVTDATPSNPSEIMGIPFSPVYDNLITNSSAADLFQFQNGIKGSGSLGYQPGITSVNSDQENYSPIWRIYNVEWHNPKDAKILQTMSDIDSFKAKDLISVSLARPMNSHHIINGPLIDPFQ
->436308.Nmar_1753
-MLRKLIAILIIGIFATSIITASSLSDQFADAGSRKKIHFTQTFTSSQDPGQGHENHQLSLILSPNQGTIYDGSMTFTSSEPVQIVVLHEINSDDAKGQPTWSIDGNTVYGLSLIDLQEKSGSFEFTGAALGLHSPNSKQFTSTVSVDGWIRGQPTEVIMQKIELEKEEPMSLLSRANVPATIPIHEGIYGGEKVLYIITDGSDEEYARELSEKQEWNVELAPVLADVPEDALQKIFVFKNGVKGEGLYGFQNEIFSSTPQQESEYSALSSVIEVTWKTGQKEIVFESANDVIAAEENGRIEFDETGVVLNTPHIVWPGGQMQVRADQEIADDMPYGGGQITEINEEEMTVTFVAHRGWGPDGRTIYYIVTDATPFGPAEMMGVTSSPTSANLIAHSGAVDLFQFKNGIKGTGPLGFQAGIAAASLGDENYSPMWRIYLIEWNDSENAKILETKSDIDSFRADDLITVSITRPTNSDHIVNCPFIDPFQ
->886738.Nlim_1479
-MNRFTIILIVGIFIIGALTVSFVSDNYVNANSTKKINFTKTITSSQDPGQGHENHQLALILSPNQGTLYVGSMTFTSSEPVEIVVLHEINNDDVKGQSTWTIDGKTVYAISLIELKAKSGSLEFTGAALALHSTNSKEFTATVSIDGWIRGQPTEVTMQKIQVQQNPPLELSRANIAASIPMHEGFYDGKSVFYIITDSSQKEYAEMITKKQNWKVEVAPEIKKISENTLQTIFIFKNGVNGDGIYGRQKEVFSSTPSQVQKYSALNSVIEVTWKKGQNASTLESYEDIINAEKNGRIEFSKTGIVINTPQIIWPDGQMLVRNNKEITNNLKFDGGQITEINKDEMTVTFVAHRGWGPDGKTIYYIITDTTPSGPAKIMGIPFSPVSEHLITNSSKSDLYQFKNGIKSSGSLGYQAEIISVMPGDDSYSPIWRVYNIEWNNPENASILETISDITSSKIKDLILVSLARSMNNQYVINGPIIDPFQ
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2H.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,4 +0,0 @@
->436308.Nmar_0483
-MTALATKSENIEKQIISDPSDTIDSEKYKMIAENVTISYDGIQAVKNITMKFKEKSVTALIGPSGCGKTTFLRCLNRMHDMTKNAKVDGKVMIDNIDLYDQSIDPIYHRRKVGMVFQKPNPFPTMSIYDNVTAGLKLNGVKDKRILDEIVEDSLKMAYLWDEVKGDLKKSAIELSGGQQQRLCIARALAIQPEVLLMDEPASALDPIATQKIEETITELKKEYTIIIVTHNMQQAVRVSDYTGFMYLGDLVEFRETKKLFTDPKNELTAKYVQGQFG
->886738.Nlim_0922
-MTAMTTKPTHAETSFTSKSQPTLDSDKYKMIAENITVSYGGVDAVKNVTMKFKEKSVTALIGPSGCGKTTFLRCLNRMHDMTKNAKVTGKVMIDNIDLYAKDIDPIYHRRKVGMVFQKPNPFPTMSVYDNVTAGLRLNGVRDKRILDEIVEDSLKMAYLWDEVKNDLKKSAIELSGGQQQRLCIARALAIQPEVLLMDEPASALDPIATQKIEETIIELKKDYTIIIVTHNMQQAIRVSDYTGFMYLGDLIEFRETKKLFTDPKDDLTAKYVQGHFG
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2I.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
->1001994.MY1_1452
-MELIEKIILTQIYLSGITGKSYKDNLKTKKGFTENIINSKIDELVKNKLITEDKSALTELGRSSLRVVLAGGVFDIIHPGHIHTLNAAKILGDVLVVVVATDNTAIKMKKRQPLHSKEQRQELVNSLSMVDLCLIGQEDDIFKTVNLVKPQIIALGYDQVHQEKFIIEGCKKINLDAKVARLQSPIPESSSSKIQKEYGESIHGI
->436308.Nmar_1298
-MLEQSQRTILSTIYVCQIEGTNPIEKIKRKTAFSDDQINSKIEELIKKQLVNEDKKTLTESGRDSLKVVLAGGVFDIIHPGHIHTLNAAKELGDALVVVVATDNTAVKMKKRRPLHSQEQRQELVNSLSMVDLCLIGQEDDIFKTVNNVRPQIIALGYDQAHQEKFITEGCKKINLDAKVARLQSPIPDSSSSKIEKEYGESIHGI
->886738.Nlim_1033
-MELIKKSILTELYLSGITGKSHIDNLTKKGFTQKLIDLEIDELIKNKLVKEDRAILTELGRSSLRVVLAGGVFDIIHPGHIYTLNAAKSLGDVLIVVVATDNTALKMKKRQPLHSKEQRQELVNSLIMVDLCLIGQEDDIFKTVNLVKPQIIALGYDQVHQEKFIIDGCKKIQLDAKVARLQSPIPESSSSKIQKEYGESIHGI
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2J.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
->1001994.MY1_1646
-MSCSGEIVDEEKLIQIKPGILQQLKKAKYGVADHSTVELCHWTKKSFKHEGSCYKHKFYGISTHRCMEFSPAGMHCENRCVYCWRPMEFYDSLKMEPEKVSEPKEILTKLMEERKKLIMGYYGDSRNDKQRLDESLLPSHYAISLSGEPTMYPKLPELIKYLKSLEATKSIFLVTNGQEPDMIQRLQDKDALPTQLYLSTNAADYDSFLKINRPKYDDSWQRWNRTLEMLKHLDTRTVLRITLIRNYNDQKEMIPAFAAMLKQASPHFIEIKSYMHIGRSTNRLEHSNMLEMEEVRRFSEEVAKHSEIFSIMDESLVSRIVILQNNQRSINRWISAYSNTN
->436308.Nmar_1529
-MSCSGEVVEEEQLIQIKPAISEQLKKAKYGVSDHSTVELCHWTKKSFKHEGSCYKHKFYGISTHRCMEFSPAGMHCENRCVYCWRPMEFYDSLEMKPEQVAEPEEILTKLMAERKKLINGYYGDSRNDKQRLDESLLPSHYAISLSGEPTMYPKLPELIKYLNSLEATKSIFLVTNGQEPDMIQKLQDEDALPTQLYLSTNAADYESFLKINKPKYDDSWERWNRTLGMLKHLNTRTVLRITLIRNYNDQKSMIPAFAKMFKEASPHFIEIKSYMHIGRSTNRLEHSNMLEMEEVKRFSEQIAKQSQIFSVMDESFVSRISILQNNERFIDRWIPAYVNTN
->886738.Nlim_1932
-MSCSGEIVDEERLIQIKPGISQQLKKAKYGVADHSTVELCHWTKKSFKHEGSCYKHKFYGISTHRCMEFSPAGMHCENRCVYCWRPMEFYDSLKMDPEKVAEPKEILTKLMAERKKLINGYYGDSRNDKQRLDESLLPSHYAISLSGEPTMYPKLPELIKYLKSLEETKSIFLVTNGQEPDMIQRLQDEDALPTQLYLSTNAADYESFLKINKPKYDDSWQRWNRTLEMLKKLDTRTVLRITLIRNYNDQEEMIPAFAAMLKQASPHFIEIKSYMHIGRSTNRLEHSNMLEMEEVRKFSESVAEHSQIFSVMDESLVSRIVILQNNQRTIDRWIPAYANTN
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2K.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,4 +0,0 @@
->436308.Nmar_0061
-MPNFDKTWARQETQSVTGKLREAVKPQGALKPRIQTAVNKLQVQISKMDSMLGKLHERDAQLFQRVVTAMQQHDTSTSRVLSNELAEIRKVTKMLGNARMSLEQVQLRLTTIHDLGDAMVAIGPAMSTMKGLKSSLGRFMPEADSELNTMTQTLNGLMMDSLAGDSFNMESDVSSEETEKILQEASAVAEQQIGDKFPSVPSSTGLSSGTSTSTFE
->886738.Nlim_1611
-MPNFDKTWARQETPGVTEKLRETIKPQGALKPRIQTAVNKLQVQISKMDSMLGKLHERDAQLFQRVVTAMQQHDTSTSRVLSNELAEIRKVTKMLGNARMSLEQVQLRLTTIHDLGDAMVAIGPAMSTMKGLKSSLGRFMPEADSELNSMTQTLNGLMMDSLAGDSFSMETGASSEETERILQEASAVAEQQIGDKFPSVPTSTGLSQSSQSTY
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2M.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
->1001994.MY1_0188
-MLSTGMWVEKYRPSKLSEIVNQKEIIGSLEALIKDPTDMPHLMFSGSAGVGKTTTALCISRQILGEYAKDYTLELNASDERGIGMVREKVKKFSRFAGMVDVPFKIIILDEADEMTSDAQTALRRIIEDTAKYCRFILIANNISKIIDPIQSRCATFKFTSIPEEDVINHLENIAKKEKVKSDKKGLKAIYDYSEGDLRHAINLMQATASIGEISEENVKSSAGLTKTSDVDIVLKMALSGKIVDAREKMIELTKVYGMSESDFLKYLNSAVFKIKHDNISDILEVIAKYDYRILVGANPEIQLTAMLAELGKLEK
->436308.Nmar_0240
-MAATGMWVEKYRPMKLSEVVNQTEIIGSLEALIKDPTDMPHLLFSGSAGVGKTTTALCISRQILGDYAKDYTLELNASDERGIGMVREKVKKFSRYAGMADVPFKIIILDEADEMTSDAQTALRRIIEDTAKICRFILIANNISKIIDPIQSRCATFKFTAVPEEDVIKRLEEIAKKEKVKADKKGLKAIYDYSEGDLRHAINLMQATASLGSISEDNVKASAGLTKTTDVDEVLKIALSGKVPEAREKMIELIKVYGMSESDFLKYLNSAVFKSKHDKLSDILEIIAKYDYRILVGSNSEIQLSAMLAELAKVEN
->886738.Nlim_1226
-MLSTGMWVEKYRPTKLSEIVNQTEIIGSLEALIKDPTDMPHLMFSGSAGVGKTTTALCIARQILGEYAKDYTLELNASDERGIGMVREKVKKFSRFAGMAEVPFKIIILDEADEMTADAQTALRRIIEDTAKYCRFILIANNISKIIDPIQSRCATFKFTSIPQEDVINHLESISKKEKIKSDKKGLKAIYDYSEGDLRHAINLLQATASLGEVTEENVKASAGLTKTSDVDEVLKMALAGKVLEAREKMIELIKVYGMSESDFLKYINSAVFKTKHEKLSDILQVIAKYDFRILSGANSEIQLSALLAELSTLK
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2N.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
->1001994.MY1_0435
-MNKVNLNIKQRKIISDKIFKIGVTTAGAYVLIVVVLIAFQLVSESYPVWEEEGLSFITKTDWNAVEGRESFGALPYILGTLTTSAIAMMIGVPLSIGIAMFISDAPPKIGAPLGFLVELLAAVPSVIYGLWGLYVFRIYFRDWFETPLHDAFGDNIWLFSGNPYGLDILTASVILAIMIIPTVSAVSREIMKAVPQQQKEAAYMLGATKWEMFKLAIFPYSKTGLIGASILGLGRAVGETMAVTMLIGNATGLGAIPSSLFGPSQTMSSIIANEFVEASPASIHMPALIGIGLILLLIAIVINVVAHLLVTRMLKIKEGAINN
->436308.Nmar_0481
-MGRPKLNPPKVGRRPISDKIFKVGATVAGVYVLVVIVLLAFQLISESAPIWDEYGLSFIVKSEWNAIDDRQDFGVLPYIFGTLVTSALAMVIGVPLSIGIAMFISDAPSKIGGPLGFLVELLAAVPSVIYGLWGLFVFRVYFVDWVEKPLHNTFGDSIWLFSGTPFGLDILTASVILAIMIIPTVSAVSREVMKAVPQQQKEAAYMLGATKWEMFKLAVFPYSKTGLIGASILGLGRAVGETMAVTMLIGNATGPNAFADSLFDPSQTMSSIIANEFNEASLGTLHLPALIGVAVVLLLIAIAINVVAHILVTRMLKVKEGAINN
->886738.Nlim_0924
-MISDKVFKIGATVAGTYVLVVVVLIAFQLISESYPIWEKEGLSFITSTDWNAVEGRESFGALPYIIGTLTTSAIAMAIGVPLSIGIAMFISDAPAKIGGPLGFLVELLAAVPSVIYGLWGLFVFRIYFRDWIETPLHNAFGDNIWLFSGNPYGLDIITASVILAIMIIPTVSAVSREIMKAVPQQQKEAAYMLGATKWEMFKLAVFPYSKTGLIGASILGLGRAVGETMAVTMLIGNATGIGAIPSSLFGPSQTMSSIIANEFVEASPASVHMPALIGIGLILLLIAIVINVIAHLLVTKMLKIKEGAINN
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2P.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,4 +0,0 @@
->1001994.MY1_1290
-MTPSELNEEKLVEIPAEHTFSELYDDVKYDPDIRPGRELQERDSLHEVLLKRRLRQKLVELNPGNPDIVYDIAVQKIELISEPTLIETNRAFHQMLLSGIKVAYQEDNQTKYSVMKLIDFDNPEKNDFIAVRQFLLVQHEERRLDHVIFVNGIPLIILEYKSMADKNATIVDAFHQLGKTKYQRDIPIIFRYNAFLVISDRLNAKYGTINAPFERFSDWNDLTQPDKKVANRLEILQKLLLNKTTILDVIKNFIEYESDGKNLIKKICQQHQYHAVNTIVKKTSDVYSQQGENRIGVVWHTTGSGKSLTMIYYVNSLSQIEKFENPTFIIITDRRDLDEQLNHFFRIAGFPYPKPETAILEADSILDLREKLQVPSGKIIFTTIQKFQTTEEEREGKVKYPKISDRRNIIIIADEAHRSQYKKMAQNLQTALPNALRIGFTGTPIELEDRSTTQVFGDIISSYKIPEAVRDGATVQISCETHPVTLLLLNKFIGKDFEEITQGLDEENVTTLARRGAEFTKLVEDPDRIKTIANDIVSHFNKKQKIFKGKAMIATSTKLAAARFADYISSLKVAPECTCIVSGATSQKPESTPEKRTREAIIQKHYKDKLTIENILTRFKDENDPLSLLIVCDMYLTGFDAPLIHTMYIDKPLRDHNLIQAISRVNRVWKNKPGGAIIDYIGIADDLDRAFSAYAQDDVKGAMIPTAEIIEIMKKKHSDLINFFDPKISNRQGLDESQELQLIYDAIDEIVYDDIVKREFIKIVTELTKAYAVCTPHPSCLDVEDDLRFFQKLRKILLKATSNVPVDLTEMESAISDLVEQGIGADQVVKGFKISFDPKKQDISKEYLNDIKKLKQKNLKAELAYKLLDDAIQAKFKRNLVKRKSFQDRIEEALSKYHARFWDNDDTIQKLEEVGKEITNESSREQELGLNDEEIAFYDVVSLGKDYVKSDAVIKQISLDLTKYLKGNIRIDWINQENIKAEIRMGVRKILLRADFPTDKIEEIVPKIMDQAETNYG
->436308.Nmar_0608
-MNFRIEDNEEGRQVELPALELITALGYTYIPNYELNIPKERPDHRQVLLYPRLRAAIKRLNDFDDDGIEQAIAQIHEDNFPIGMPMIDANEKIRIKLTGRAGENAIAQPITIKQYGKKGIEYPTVKFFDFDPKKIGTKEDKNEYLVTNQFKHLGNRTEIECDIVIFVNGIPLVLIECKKPTTIDLMKTVWKENLEKYQRDGSHSLGHEKLFFFNHVIMATSAIQARYGTLKALPNKYAKWTSLTNITTKELEKLVGRKPTPQDIMLAGMIKKETLLDMLKNFVLYEIEEHKKIKKVAKHQQYRVVTKSVDRISHHKKVEDKGGVIWHTQGSGKSLSMVWFATQLYYKFSRPTIMVITDRRQLNKQIFDTFRNCGFPEPEKPRNRSQLAKTLQYSKGKTIMVNLQKFDKPEKFVETKEKIYVLVDEAHRSQYKWTAGYMRKAMPNAVFFAFTGTPLDRENKNTYRRFGPLIDKYSFTESKEDGATVKVEHMGLLPEIEIEGGNSLNNIFDNLFGHLPKAQQAEIRRKYATKKKIASSPARIRKICEKIVDHYTKKILPNGYKAMIVAPTRAAAVTYKRELEDLTKLPARIIMDSKKDEVGPDEFSWADYYLPQNEALKKAEEFTNPDDPTKFLIVVDMLLVGYDAPIVQVMYLDRPLREHALLQAIARVNRIYDEHKDRGFIIDFWGVTRDLQNALKMFEEQDVQGALDNVDDDLLELDVRHKDFMEKIQGIDSKDHNEIAKRFEDEDEQEEFEYAFKRFAKALEAVLPDKEAVPYEKDLKKGYEIRGKIRAWFYGDRADLSEYGKKVQKIIDKHIRAIGISEISGSKEITYDNFLGFIAKFKGDNRAKAALIKKRATLVIREMSPDNPAFYQKLKERLEKLIQDEKERRVDDAQYFEGIRDIFEEALSGPEKLQKQTGIKDRFQLAIYMLLEEKHSDLKQNKKYSEEIFKKVKKAASVKDWRDKEPQENEIELAVIDTLDKKIFDEKTRDKLASEVYKMAVNNNEW
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2Q.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
->1001994.MY1_1750
-MDRKILGISGGIAVIIAIVAVMLLTPNLESTPIQKHNEKIGLVINAPHSAISLQDLNQIYAEASSTGIGRSNVYMFWNIVEPVRGEYDWKQSDVLMSFNKNNNLKVTLFFSVINGETLGPFPNWIGKPSLNAIGEDRLVNVLDAILSRYDIIDTVVIAGETESQFRYHEQNIPVYKELFNGVYAKLKEKHPDVQIGNGFALHNVLNKNLEHIVSDLAIGDFVAFSYFPVDTLNDIVKTPEEAKADLQKTFEIIPDKKIGLFEVSWSTSDFVGGNETSQQIFLEKSFEFYTENESKIEFFTWYRQYDRPDGTCVIDKPEIANQTLTVGGGSGLGSSEYIMERLSHYICNSGLLDVDGTPKSSWNEFKNQIELIN
->436308.Nmar_1626
-MDKKILGVGIGVAVVIAIIAGVLSIPSDSNPEVTPVKTNEKIGLVINSPNQSVTLQELDEIYSTASESGIGRSNVYLFWNLIEPEHREYNWQYSDALMSFNQKNDLKVTLYFSIINGETLGPFPDWIGKPPIQSLNEDRVVSVLDAILSRYHIVDTVILAGETESQFRYYEQNIPPYKELFVGVYDKIKEKHPDVKIGNAFALHQVLNKDLQNIVTDLDVGDFVAFSYSPVDTVGDMVKTPQQAKEDLEQIIDLAGDRNAAIFEISWSTSDFVGGSEESQTEFLEKSFEFYAENESELEFFTWYRQNDKPEGTCAFEVQEVGEDKLTVGGSGFGSSEHVIERLDHYVCNAGLFDENGNPKSGWNEFKNQIQMLN
->886738.Nlim_1388
-MDKKILSIGIGIAIVIALVLVVIGFQSAEIITNQKQDEKIGLVINTPNPSISLKELHKIYADASSTGIGRSNVYIFWNVVEPVKGEFDWTQSDVLMSYNKNNDLKVTLYFSVINGETLGPFPNWIGKPSLNAIGEDRVVSVLDAILSRYDIIDTVVIAGETESQFRYYEQNIPVYKELFTGVYDKIKEKHPTVKIGNAFALHNVLNKNLEYIVTDLSLGDFVAFSYSPVDTLNEIVKTPQEAKEDLQKIFEIVPDKKIGLFEISWSTSDFVGGNSTSQQEFLEKSFEFYKENKSKIEFFTWYRQYDKPDGTCVIEKPEIGNKTLSVGGGSGLGSSEYVIERLSHYVCSVGLLDADGTPKPSWNEFKNQIELINQ
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2R.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,4 +0,0 @@
->1001994.MY1_0222
-MWSEKYRPQNISDMIGNEESRSSIIEWFTKWKKGTKPLLLVGPPGIGKTTIAYLTAKQFQYDMVGLNASDVRSKSRINEILSPVLGNVSILGLPMIFIDEVDGIHGRGDYGGAEALIEILKEPTIPIILAANSDTSDKMKSIKKVVKTISFKPIPPRLLKIYLENILKKENVTLSPGSIIKVIDRSRGDVRSMINLTQSLVTGFNPQTEKSFESINVEDGINAFFKANSFDEARGVLYSMQIDPRLKIDAFYSSIVTSNLDNQTLAKLLEIISEADILYGKIMKTQNWRLLRYLNEILIRLYLNDERIRYSQYNLSWPLLNRIRWDGKKIKSLSSVMAKTLHLSSSAFVTICLPYILFCIKNKKLSLDLEETFGDVIEKEIELIK
->436308.Nmar_0270
-MWSEKYRPQIISDMVGNEESRAAIMEWFAKWKKGTKPLLLAGPPGIGKTTMAFLVAKQFGYDMIGLNASDVRSKSRINEILTPVLGNVSVLGTPMIFVDEVDGIHGRGDYGGVAALVDILKEPTVPIILAANDDTSDKMKNIKKVVKTISFKKIPPRLLRVYLENILKKESAKLSPGSLIKVIDKSRGDIRSMINLTQSMVTGFNPQTETTFENIDVEDGVNAFFKSKSVDEARGVLYSMQIDPREKINAFYSSIVMSSLDPETLAKYLEIISEADMLYGKIVRTQNWRLLRYLNDILIKLYHDDDRVRYAQYNLSWPLLNRIRWDGSKIKSLSSVMAKKLHLSSSAFVTFGLPFVLFCIKNNALELELEETFGDIIEKEIELIQ
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2S.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,4 +0,0 @@
->1001994.MY1_0691
-MSFKSLIDEIENNLHKILEDMSIYDISFTVEPAKPGFGDASSNISFLLAKSLKKSPKEIANLMSEKYRQSQNILVLKVEPHQTGYLNFFADWEKLNQLILSESNLNEFGFIDLGHNSEIVVEHTSVNPNKALHIGHIRNIVLGDTVARILKKSNYKVNVLNYVDDSGLQVADIIVGFKHLGFAQQSPTGKKFDHYCGDDVYVKTTEKYEQDPNFEEIRKNTLKELEDGASETAKFADTITRRVLENQLETCWNLGVYYDCLNFESQIIRSGLWSKIFEKLKEMNLVEFENDGKNAGCWIIRGENNEEDKVIVRSNGTATYIAKDIPYAAWKLGLIEDPFSYKKYEKTQPGNKILWQTTLTATNEPKQNFTGNKVITVIDSRQARLQKIITGLMSKFKSTNDAYVHLGYESVTLSSDTAQTLGLDTDGKQAQMSGRKGLYVDADSVYDLLKNKTIEETKKRHPEMSDSEIEQIAHYVSVGTLRYEMIKQDLDKMITFDLTKSLSLEGDTAPYIQYTHARASRIIEKSARNPSIDVDFSLLNDASELSLIKIIGLFEIYVLDAAKNLSPKVIARYCHNLAVAFNSFYEHVKVLELGDEKLENSRLCLVNSFKITLEKALELLGITAPEKM
->436308.Nmar_0686
-MTFKSILDEIENNLNKILDDLSISDVKFSVEPAKPGFGDVSSNVSFLLAKQLKKSPKEISEMLSEKYSQCVSTLVSKSESHPSGYLNFYADWPKLNQLILSESNLPEFGDVDIGKNSTIVVEHTSVNPNKALHIGHIRNIIIGDTISRILQKANYKVNVLNYVDDSGLQVADIIVGFKHFGYPIEPPQGKKFDHYCGDDVYVKTTEKYEQDSSLEEIRKNVLKELEDGTSETAQFADKITRRVLSNQLETCWNLAVSYDCLNFESQIIRSGLWDGIFEKLKEMNLVEFENDGKNAGCWVIRGEGKEEDKVIVRSNGTATYIAKDIPYAAWKLGLLDDPFHYEKYEKEQPNSRVLWQTILNDGASESQNFSGDKVITVIDSRQARLQKIITSLMGKFKSIPDAYVHLGYESVTLSSDTAKILGLETDGKQAQMSGRKGLYVNADSVYDLLKEKTTEETKKRHPEMDDSEIEKISHSVSVATLRYEMIKQDLDKIIAFDLTKSLSLEGDTAPYIQYTHARASRILEKSGRTPSIDVDFSLLKEQSEIDLVKMIGLFNLQVRDAANNLSPKVISRYCHDLAVTFNSFYEKSKVLDLGDEKLENSRLCLVNSFKITIEKALNLLGISAPDKM
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2T.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
->1001994.MY1_0879
-MSTEQIEKFQEVVDIPAGVKVTLKKNMMHFEGPLGKTHKNFRNIPVNIEIKEGKVILKSQGYRKRDYSILHTARSVIRNLCEGLVVGYTIKMKIAFAHFPITVKVQDRTVLIENFQGERSSRITKIIGNTKVVPKGEDVILTGEVWNHITQTAANIELRSKVKDKDHRVFLDGVYVYEKKKGIEK
->436308.Nmar_0794
-MSTSQLEKMQDQVEIPEGVTVTQNKNMLLFEGPLGKTHKNFRNIPVKIEIADGKVNLKTIGERKRDYAILHTARSIIRNICEGLVEGYTIKMKVVFAHFPITVKVEGKKILIENFQGERAPRSTHIMGNTKVIPKGEDVLLTGEVWTDITQTAANIELTTKVKNKDHRVFLDGIYVYEKKKGIEK
->886738.Nlim_0395
-MSTEQIEKFQEVVEIPKGVTVTLKKHMLHFQGPLGKTHKNFRNIPVNIEVKDGKVILKSQGYRKRDYSILHTARSIIRNICEGLITGYTIKMKIVFAHFPITVKVQDKTVLIENFQGERSARVTRIIGNTKVVPKGEDVILTGEVWNDITQTAANIELRSKVKDKDHRVFLDGVYSYEKKKGIDK
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2U.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
->1001994.MY1_1727
-MVIEVVRIGQRLVRDDRVTTHVALVARAFGCSKIFMTEVNPEIKDTLEKINNTWGGDFVVEFIDNWKSIVKMKKKDSKIVHLTMYGESINEVDMQLRKEENLLIVVGAEKVPREIYELADYNVGIGNQPHSEISALAIILDRIQKGEQFKNSFPGAKRKIIPTRNGKNVLVRGTRD
->436308.Nmar_1606
-MVIEVVRIGQRLVRDDRVTTHVALVSRAFGAERIFMTEINPEIKDTLGKINDTWGGNFEIEFIDSWKPIVKKKKEEGFKIVHLSMYGEKINDAQEEIRKEENLLIVVGAEKVPREIYELADFNVGVGSQPHSEISALAILLDRIQGGQQFEKEFPNAKRKIIPTKTGKNVQVKETRD
->886738.Nlim_1365
-MVLEVVRIGQRLVRDDRVTTHVALVARAFGCTKIFMTEVNPEIKDTVEKINKTWGGDFVVEFIDNWKSIVKKKKEEYKIVHLTMYGESIDDVDEQLRKEKNLLIVVGAEKVPREIYELADYNISIGNQPHSEISALAITLDRIQKGKQFKNSFSGAKRKIIPTKKGKNVFVSGTRD
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2V.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
->1001994.MY1_1241
-MKIRIFDTTLRDGEQTIGVSLSPDQKLAIAKKLDELGVDAIEAGFPVISAGEFKAVKMIAAAGLSCEIAGLTRTIKNDIDAAVDAGLNYIHTFIATSDIHLQYKLKMTREQALEKAIEAVEYGKSRGLQVEFSAEDATRTDREFLKKVFGDVAKAGADRVNIPDTVGYSTPEYMAVLTKDTVEVTKLPVSVHCHNDFGLAVANSLAGIHAGASCAHVTINGIGERAGNASLEEFSMALKCLPFEKKYETNIKSELIYDTSRFISKTVGIIVQPNKAIVGTNAFGHESGIHTHGVLSNPLTYEPISPELVGRKRWLQVGKHAGIHGMNAMLAEYGVKPTEEQSKQILDKVKTLGDAGKQITDVELLSIASDVLGEKELKRIVQLTGFSVSTGIGTMPYAFVKLNIDGQDHIGTDYGVGPVDAALNAIQKITGKISEIRIKDYGLASISGGSSALCEVTVKVEDAFGNKVSAKSVGEDIVTTSVKAVIDAINRIMLKKMLQEKQVR
->436308.Nmar_1070
-MTNVRIFDTTLRDGEQTLGVSLSPDQKLAIAKKLDELGVDAIEAGFPVISEGELQAVKMITAAGLSSEICGLTRTIKKDIDAAIDAGLNYVHTFIATSDIHLEHKLQMTREQALEKAIEAVEYGKSHGLQVEFSAEDASRTDREFLKKVFSEVAKAGADRVNIPDTVGYSTPEYMAQITKDTIEATNLPVSVHCHNDFGLAVANALAGIHVGAACAHVTINGIGERAGNASLEELSMALKCLPYEQKYETNIKSELIYDVSRFISKTVGIIVQPNKAIVGANAFGHESGIHTHGVLNNPLTYEPISPELVGRKRWLKVGKHAGVHGMNAMLEEYGVKPTEDQAKQILEKVKVLGDQGKQITDVELLSMASEVLGKKDLKRIVQLTGFSVSTGIGTMPYAFVKLNVDGQDHIGTDYGVGPVDAALNAIQKITGKISEIRIKDYGLASISGGSGALCEVTVKVEDPLGNKVSAKSVGEDIVTTSVKAVIDAINRIMLKKMLQEKQVS
->886738.Nlim_0759
-MKVRIFDTTLRDGEQTIGVSLSPDQKLAIAKKLDELGVDAIEAGFPVISSGEFKAVKMIASEGLSCEIAGLTRTIKNDVDAAVNAGLNYIHTFIATSDIHLQYKLKMTREQALEKAIEAVEYGKSRGLQVEFSAEDATRTDREFLKKVFGDVAKAGADRVNIPDTVGYSTPEYMAELTRDTVEATHLPVSVHCHNDFGLAVANSLAGIHAGASCAHVTINGIGERAGNASLEEFSMALKCLPFEQKYETNIKSELIYETSRFISKTVGIIVQPNKAIVGTNAFGHESGIHTHGVLSNPLTYEPISPELVGRKRWLQVGKHAGIHGMNAMLAEYGVKPTEEQSKQILDKVKTLGDAGKQITDVELLSIASDVLGEKELKRIVQLTGFSVSTGIGTMPYAFVKLNIDGQDHIGTDYGVGPVDAALNAIQKITGKISEIRIKDYGLASISGGSSALCEVTVKVEDALGNKVSAKSVGEDIVTTSVKAVIDAINRIMLKKMLQEKQVR
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2W.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
->1001994.MY1_1343
-MQNQKSEWATNESPRIMSYTLANFRQLPQIQKLGEEKQFEMEVVGNVLPFKTNNYVVEQLIDWNNIPDDPMFVLTFPQRGMLIPEHYAKMEAALKKGDKKEIQNTANEIRLQLNPHPAGQMELNVPTLKDGTKLYGMQHKYKETCLFFPSQSQTCHAYCSFCFRWPQFVGMDELKFAMKEGEQLVQYLQEHPEISDVLFTGGDPMIMKARIFSTYINPLLEANLPNLRTIRIGTKALSYWPYKFLTDDDAEEMLDIFKRVVDKGIHLALMGHFNHTVELKTDAVKEAIKKVRATGAQIRTQSPILRHINDDSEMWAEMWKTQVQLGCIPYYMFVVRDTGAQHYFGIPLIEAQRIFRDAYKKVTGLARTVRGPSMSATPGKVQILGIAEYGGEKLMVLRFLQGRNPDWVQIPFLAKYDEKAIWLDDLKPATGDKFFFEDELNEKMKVIKNQDYPES
->436308.Nmar_1772
-MTYQESVWDDSPSLKSYTLSNFRDLPQIQNISEEKQFEMEVVGNVLPFKANNYVVEQLINWNDIPNDPMYVLTFPQRGMLKPEHYAKMENTLKNTSDKKEIANVANEIRLQLNPHPAGQMELNVPTLKDGTKLYGMQHKYKETCLFFPSQSQTCHAYCSFCFRWPQFVGMDEMKFAMQEGEQLVQYVSEHPEISDVLFTGGDPMIMKAKMFSKYVDALIEAKLPNLKTIRIGTKALSYWPYKFLTDSDSQEMLQVFQKITDSGLHLAFMAHFNHLNELSTNAVKSAIKEVRKTGAQIRTQSPLLAHINDDAEMWANMWTKQVQLGCIPYYMFVVRDTGAQHYFGVPLVKAYEIFSQAYSTVSGLGRTVRGPSMSATPGKVQVVGTTQINGEKLLILRFLQGRNPNWIKEPFFAKYDENAIWLDDLKPAFGDKFFFEDELDAIKASKTS
->886738.Nlim_0892
-MQRQDSAWGVKESPRLKSYTLANFRELPQIQKMGAKKQFEMEVVGNVLPFKTNNYVIEQLIDWNNIPNDPMFVLTFPQRGMLIPEHYSKMESALKKGDKKEIQNTANEIRLQLNPHPAGQMELNVPTLKDGTKLYGMQHKYKETCLFFPSQSQTCHAYCSFCFRWPQFVGMDELKFAMREGEQLVQYLREHPEISDVLFTGGDPMIMKAKIFSTYINPLLEANLPNLRTIRIGTKALSYWPYKFLTEDDAEEMLDIFKRVVDKGIHLAVMGHFNHLVELKTDAVKEAIKKIRATGAQIRTQSPLLRHINDDADMWAEMWKVQVQLGCIPYYMFVVRDTGAQHYFGISLIDAQRIFRDAYKKVTGLARTVRGPSMSATPGKVQILGITEVNDEKFMVLRFLQGRNPDWVQIPFLAKYDEKAIWLDDLKPATGDKFFFENELKEMMMTIKNEDYPES
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2X.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
->1001994.MY1_1050
-MKFLIIDNYDSFVYNIAQYLGELGVDCDVIRNDKITLEKIKQNNYDAVIISPGPGTPTDRKYFGICSDVIKDMGSTTPILGVCLGHQGIIHAFGGKVTNAGCVRHGKTSPVDHTNSDLFKDVKNPFRATRYHSLVGDKTIIPDVLEVTAVAADDGEVMAVRHKEYLIEGVQFHPESIMTEDGKKILANFIKQVKDRK
->436308.Nmar_0912
-MKFLIIDNYDSFVYNIAQYLGELGVDCDVIRNDKITLNEIQEKKYDAIIISPGPGTPEDKKYFGVCSEVIKDMGSSTPILGVCLGHQGIIDAFGGKVTNAGCVRHGKTSPVNHEDSKLFKDVKNPFRATRYHSLVGDKTIIPEVLKVTATASDDGEVMAIEHKDYLIQGVQFHPESIMTEDGKKILSNFIQQVKEKQK
->886738.Nlim_0576
-MKFLIIDNYDSFVYNIAQYLGELGVDSDVIRNDKITVEQIKQNKYDAIIISPGPGTPSDRKYFGVCGDVIKDIGPITPILGVCLGHQGIIEAFGGKVTNARCVRHGKTSPVDHTNSELFKDVKNPFRATRYHSLVGDKTIIPDALEITAIAADDGEVMAVRHKKYLIEGVQFHPESIMTEDGKKILANFIKQVKSKK
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2Y.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
->1001994.MY1_1793
-MMGDRDYRSIIKNAVDSIGRELEIEIDAKDIKTIHLKEVVQCLRRSYYDRIEPKEVERRGFNDLLSGLLRKLQYGSDPKEFSIEDIKLRGHADMIADNSIILFRPTNASLESPLANDLLYLNACMWIYDKTDGVIIYITGDREEIMFSLTRDKKMFEEIIRRVRVLNDLLKEQKTPILEPSSDCMECQYYQRCFITKKNTKQVSLAEMLGLGKD
->436308.Nmar_1701
-MMGDRDFRTTIQNAIKSIGNELEIDIDSKDFETIHLQEVVRCMRRSYYDRVEPLEIERRGFNELLSGLLRKLEYGSNPKDFDINEIKLRGQADMMVDDAILLFRSATEELENPHASDVLYLNACMWIYDKEDGMIVYITGDRKESTFSLTRNKKMFEDTIRRVRVLNNLLKEQKTPILEPSAECTECQYYERCFTKRKNTKQTSLAEMLGLGKQD
->886738.Nlim_1425
-MMGDRDFRSIVKNAVDTIGRELEIQIDAKNIKTIHLKEVVQCLRRSYYDRIDPKEVERRGFNDLLSGLLRKLHYGSDPKEFSIDEIKLRGQADMIADDSIVLFRPSKTVIEAPVANDLLYLNACMWIYDKTDGIIVYITGDREEIMFSLTRDKKMFEEIIRRVRVLNDLLKEQKTPILEPSNDCAECQYYQRCFTTKKNTKQVSLAEMIGLGKD
--- a/test-data/cached_locally/OG_fasta/thaNOG/1CB2Z.fa	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
->1001994.MY1_1440
-MAEKGILAFSGGLDTSVVIKYLQEEYNMDVITVTVDVGQGDDQKKIEAKAKKLGVIKHYNIDARKEFVENFIFPSIKANALYQKKYCLATALARPLIAEKVLEIAKKEKVTSLAHGCSGKGNDQVRFDITLRSGSDLPIIAPIRDKNLDRVTELEFAKKHGIEIDSVAKRFSIDQNLWGRAIEGGVLEDPYNEPPEDAFIWVKTKNLPDKPTYLEIKFEKGIPVSVDGKILEPIKLIEYVNKKAGDAGVGIVDHIEDRVVGIKSREVYETPGALCLIEAHSDLEKMVHTKHENKFKSIIDDEWAYLAYSGLWQDPLKQDLDAFIQASQKPVSGTVKLKLFKGSIRVVGRKSDYSLYNHKIATYGTESTFDQRLAKGFVELWGIQSTEANKLQKKRSTKT
->436308.Nmar_1286
-MTQKGILAFSGGLDTSVVVKYLQDEHDMDVITVTVDVGQGDDNKKIAAKAKKLGVKKHYNIDARKEFVKDYIFPSIKANALYQKKYCLATALARPLIAEKVLEIAKKEKVTSLAHGCSGKGNDQVRFDITLRSGSNLPIIAPIRDKNLDRVTELKFAKKHGIEIDTVAKKFSIDQNLWGRAIEGGVLEDPYNEPPDDAFIWVKTKNLPDKPTYLEIKFEKGIPVGVDGKTMDGQKLIEYINKKAGDAGVGIVDHIEDRVVGIKSREVYETPAATCLIEAHSDLEKMVHTKHENKFKSIIDDEWAYLAYSGLWQDPLKSDLDGFIEASQKPVTGTVKLKLYKGSLRVVGRKSKNSLYSHEIATYGTESTFDQRLAKGFVELWGMQSTEANKLQKKRSTKI
->886738.Nlim_1021
-MTEKGILAFSGGLDTSVVVKYLQEEYDMDVITVTVDVGQGDDQRKIEAKAKKLGVKKHYNIDARKEFVEKFIFPSIKANALYQKKYCLATALARPLIAEKVLEIAKKEKVTSLAHGCSGKGNDQVRFDITLRSGSDLPIIAPIRDKNLDRVTELAFAKKHGIEIDSVAKRFSIDQNLWGRAIEGGVLEDPYSEPPDDAFIWVKTKNLPDKPTYIEIKFEKGIPVAVDGKILEPIKLIEYVNKKAGDAGVGIVDHIEDRVVGIKSREVYETPGALCLIEAHSDLEKMVHTKHENKFKSIIDDEWAYLAYSGLWQDPLKQDLDSFIETSQKPVTGTVKIKLFKGSMRVVGRKSDYSLYSHKIATYGSESTFDQKMAKGFVELWGIQSTEANKLQKKRSTKI
Binary file test-data/cached_locally/eggnog.db has changed
--- a/test-data/cached_locally/eggnog_mapper_db.loc	Mon Nov 11 11:50:36 2019 -0500
+++ b/test-data/cached_locally/eggnog_mapper_db.loc	Sat Sep 05 07:21:28 2020 +0000
@@ -1,2 +1,2 @@
 #value	name	path
-4.5	eggNOG_4.5	${__HERE__}
+5.0	eggNOG_5.0	${__HERE__}
--- a/test-data/cached_locally/eggnog_mapper_hmm_dbs.loc	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,2 +0,0 @@
-#key	db_version	value	name	path
-4.5_ENOG411CB2I	4.5	ENOG411CB2I	ENOG411CB2I	${__HERE__}/hmmdb_levels/ENOG411CB2I/ENOG411CB2I
Binary file test-data/cached_locally/eggnog_proteins.dmnd has changed
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/cached_locally/eggnog_proteins.fa	Sat Sep 05 07:21:28 2020 +0000
@@ -0,0 +1,8 @@
+>1001994.MY1_1452
+MELIEKIILTQIYLSGITGKSYKDNLKTKKGFTENIINSKIDELVKNKLITEDKSALTELGRSSLRVVLAGGVFDIIHPGHIHTLNAAKILGDVLVVVVATDNTAIKMKKRQPLHSKEQRQELVNSLSMVDLCLIGQEDDIFKTVNLVKPQIIALGYDQVHQEKFIIEGCKKINLDAKVARLQSPIPESSSSKIQKEYGESIHGI
+>436308.Nmar_1298
+MLEQSQRTILSTIYVCQIEGTNPIEKIKRKTAFSDDQINSKIEELIKKQLVNEDKKTLTESGRDSLKVVLAGGVFDIIHPGHIHTLNAAKELGDALVVVVATDNTAVKMKKRRPLHSQEQRQELVNSLSMVDLCLIGQEDDIFKTVNNVRPQIIALGYDQAHQEKFITEGCKKINLDAKVARLQSPIPDSSSSKIEKEYGESIHGI
+>886738.Nlim_1033
+MELIKKSILTELYLSGITGKSHIDNLTKKGFTQKLIDLEIDELIKNKLVKEDRAILTELGRSSLRVVLAGGVFDIIHPGHIYTLNAAKSLGDVLIVVVATDNTALKMKKRQPLHSKEQRQELVNSLIMVDLCLIGQEDDIFKTVNLVKPQIIALGYDQVHQEKFIIDGCKKIQLDAKVARLQSPIPESSSSKIQKEYGESIHGI
+>436308.Nmar_0135
+MKFCNVGIIIQARTGSDRFPKKVLASIEKKPMIWHIVNRCKKVKNIDKIILATTTLKEDYPLISLAKKNKIEYFRGSKNDVLDRFYQCSTSNNLDIIIRITGDCPLVDPKLIDQFLDFFSHKKYDYVSNTINPTYPDGLDIEIFSFKALKKAWNMSKKKSNREHVTTFIKHHPEKFKIKNFENNTNLSNYRLTVDHKNDLKLIRKIYKEFRPNIKFSTKSVISLLNKNPELFKINQNISRNEGYEKSLLNDN
--- a/test-data/cached_locally/hmmdb_levels/ENOG411CB2I/ENOG411CB2I	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,637 +0,0 @@
-HMMER3/f [3.1b1 | May 2013]
-NAME  ENOG411CB2I
-LENG  205
-ALPH  amino
-RF    no
-MM    no
-CONS  yes
-CS    no
-MAP   yes
-DATE  Thu Apr 16 06:29:18 2015
-NSEQ  3
-EFFN  0.454102
-CKSUM 2514733105
-STATS LOCAL MSV      -10.6020  0.70508
-STATS LOCAL VITERBI  -11.4006  0.70508
-STATS LOCAL FORWARD   -4.9608  0.70508
-HMM          A        C        D        E        F        G        H        I        K        L        M        N        P        Q        R        S        T        V        W        Y   
-            m->m     m->i     m->d     i->m     i->i     d->m     d->d
-  COMPO   2.60488  4.26537  2.86806  2.68812  3.48541  2.84597  3.68190  2.58658  2.57105  2.36046  3.71753  3.12796  3.51194  3.07828  3.00549  2.67857  2.91482  2.52396  5.16454  3.68907
-          2.68619  4.42226  2.77521  2.73125  3.46355  2.40514  3.72496  3.29355  2.67742  2.69356  4.24578  2.90348  2.73741  3.18148  2.89802  2.37888  2.77521  2.98520  4.58478  3.61505
-          0.17176  1.91497  4.55917  0.35031  1.21898  0.00000        *
-      1   3.06761  4.52439  4.31327  3.78099  3.05250  4.16350  4.46561  2.17607  3.57234  1.30879  1.91901  4.09154  4.45690  3.86045  3.77957  3.51234  3.30962  2.23580  5.01687  3.83610      2 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-      2   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810      3 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-      3   2.78351  4.58087  3.32911  2.88754  3.40933  3.59103  3.84122  2.81006  2.61259  1.66760  3.45029  3.30455  4.01739  2.39416  2.89621  2.95209  3.03282  2.70991  4.99124  3.67436      4 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-      4   2.53418  4.23705  3.59368  3.16853  3.49025  3.42404  4.06074  1.74993  3.06664  2.43412  3.49971  3.45907  3.96332  3.42386  3.35145  2.21772  2.86823  2.25074  5.06222  3.78462      5 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-      5   2.78589  5.09914  2.65704  2.00312  4.42838  3.36184  3.58271  3.84850  1.89046  3.35615  4.18804  2.85104  3.82604  2.22691  2.52714  2.75121  3.01078  3.49213  5.49453  4.17260      6 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-      6   2.93327  5.02405  3.29627  2.69847  4.43219  3.55593  3.56756  3.79912  1.41937  3.28272  4.16078  3.11215  3.94769  2.71245  1.76026  2.94298  3.11879  3.48852  5.35872  4.16856      7 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-      7   2.42315  4.21787  3.44026  2.97006  3.62502  3.28653  3.93296  2.25259  2.89478  2.62127  3.57447  3.29089  3.83488  3.23909  3.22031  2.19519  2.23227  2.47087  5.09408  3.85175      8 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-      8   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866      9 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-      9   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377     10 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     10   2.21970  4.14708  3.27216  2.97236  4.05658  2.94753  4.04583  3.36566  2.97325  3.13664  4.01775  3.19548  3.65760  3.31810  3.28297  1.86435  1.69294  2.93575  5.43271  4.18954     11 t - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     11   2.67125  4.89170  2.63995  2.01286  4.19991  3.30620  3.62584  3.60098  2.37369  3.19109  4.03621  2.84971  3.79086  2.33541  2.77812  2.67728  2.37271  3.26758  5.41474  4.07676     12 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     12   3.08388  4.45892  4.50779  3.99931  3.20318  4.29602  4.67441  1.39467  3.81924  1.46323  3.07061  4.27722  4.58606  4.09884  4.01845  3.66823  3.33503  1.84767  5.18001  3.96570     13 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     13   3.19664  4.70006  3.78606  3.50925  2.29569  3.78896  3.60349  3.21093  3.36780  2.67393  3.88982  3.68029  4.26389  3.68239  3.55861  3.33670  3.48329  3.07987  3.93791  1.02720     14 y - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     14   2.98251  4.43779  4.31388  3.82115  3.20877  4.08952  4.54007  2.00695  3.64555  1.30599  3.09552  4.09798  4.45211  3.94746  3.86362  3.46665  3.25564  1.64211  5.13725  3.91385     15 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     15   2.15254  2.45969  3.69479  3.31339  3.86059  2.92557  4.16344  3.17236  3.21287  2.97886  3.87676  3.36254  3.65358  3.52003  3.46091  1.53946  2.62341  2.77195  5.29578  4.07476     16 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     16   2.59251  4.66552  2.70968  2.48311  4.18488  1.89749  3.77255  3.67484  2.56229  3.27203  4.14808  2.94825  3.77150  2.19715  2.92693  2.65455  2.93244  3.29447  5.43421  4.12493     17 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     17   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866     18 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     18   2.60329  4.67395  2.70600  2.00150  4.09633  3.24110  3.74529  3.37050  2.56262  3.09514  3.99481  2.93437  3.79294  2.94110  2.95657  2.66876  1.95122  3.05941  5.40020  4.08679     19 t - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     19   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634     20 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     20   2.65547  4.70380  3.01820  2.59794  4.14489  3.34071  3.68321  3.44079  1.66289  3.10417  3.99661  3.03826  3.83752  2.85967  2.55384  2.72496  2.29676  3.12897  5.34446  4.08131     21 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     21   2.41051  4.45743  2.76314  2.55610  4.16025  3.04300  3.85109  3.67733  2.73646  3.31958  4.16963  2.20738  3.70062  3.07277  3.12216  1.67816  2.81237  3.22852  5.47353  4.13338     22 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     22   2.65353  4.59175  3.08992  2.62618  3.21831  3.45751  2.78699  3.20248  2.55484  2.81536  3.72079  3.07821  2.83953  2.94374  2.92698  2.74675  2.89512  2.94118  4.70593  2.60361     23 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     23   2.72437  4.43914  3.47351  2.98245  3.55531  3.61673  3.90477  1.80448  2.22279  2.42136  3.50035  3.37449  4.03540  3.18688  2.94028  2.95940  2.97488  2.33967  5.07615  3.82063     24 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     24   2.86943  5.37025  1.48720  1.68161  4.65650  3.15841  3.70427  4.15303  2.71392  3.68857  4.55432  2.63699  3.77801  2.87679  3.29068  2.76612  3.15953  3.74941  5.84870  4.37021     25 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     25   2.75188  4.95425  2.64292  2.37822  4.30694  3.30335  3.64804  3.77364  1.89460  3.33558  4.19487  1.92755  3.82286  2.81601  2.63305  2.75003  3.01785  3.41959  5.46070  4.12901     26 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     26   3.11252  4.49860  4.49768  3.98112  3.12965  4.30058  4.64392  1.65480  3.79730  1.21127  2.99244  4.26847  4.57626  4.06087  3.99147  3.66694  3.35840  1.96471  5.12672  3.92986     27 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.15852  3.83682  2.07920  0.61958  0.77255  0.48576  0.95510
-     27   2.83586  4.77841  3.00116  2.66224  4.12832  3.33459  3.69011  3.54935  1.27962  3.15323  4.13068  3.09104  3.85234  2.89630  2.42938  2.89266  3.10512  3.26853  5.25424  4.04656     28 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03685  3.71515  4.43750  0.61958  0.77255  0.43000  1.05127
-     28   2.54621  4.50545  3.20868  2.74070  3.97594  3.28582  3.75341  3.30020  2.38979  2.97470  3.88469  3.12680  3.81520  2.96087  2.13200  2.66599  1.92060  2.99170  5.25951  4.00783     29 t - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     29   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744     30 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     30   2.65547  4.70380  3.01820  2.59794  4.14489  3.34071  3.68321  3.44079  1.66289  3.10417  3.99661  3.03826  3.83752  2.85967  2.55384  2.72496  2.29676  3.12897  5.34446  4.08131     31 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     31   1.67965  4.13282  3.20050  2.99025  4.21129  1.65226  4.12825  3.55509  3.11281  3.30619  4.17417  3.19398  3.63080  3.40845  3.42192  2.37211  2.68272  3.05705  5.55180  4.33965     32 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     32   3.21381  4.62626  4.18968  3.89787  1.07193  3.91098  3.86281  2.74242  3.80591  2.12098  3.47821  3.97935  4.37076  3.98386  3.93443  3.48527  3.51513  2.73041  4.12335  2.49519     33 f - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     33   2.21970  4.14708  3.27216  2.97236  4.05658  2.94753  4.04583  3.36566  2.97325  3.13664  4.01775  3.19548  3.65760  3.31810  3.28297  1.86435  1.69294  2.93575  5.43271  4.18954     34 t - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     34   2.78560  5.27768  1.86934  1.80297  4.55819  3.20409  3.64189  4.04711  2.54675  3.55896  4.38459  2.66950  3.76604  2.26443  3.07420  2.70307  3.05119  3.64483  5.72667  4.27496     35 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     35   2.74146  5.16867  1.96020  2.15061  4.47368  3.22791  3.62910  3.95193  2.08633  3.47754  4.29703  2.24711  3.76617  2.77862  2.96847  2.68168  3.00386  3.55795  5.64114  4.21923     36 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     36   2.73346  4.43500  3.54559  3.00804  3.33649  3.68461  3.91834  2.17057  2.80785  1.85388  3.27994  3.41358  4.05637  2.54293  3.11320  2.97298  2.96843  2.42744  4.96172  3.70767     37 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     37   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866     38 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     38   2.77722  5.15078  1.82843  2.12879  4.47753  3.15657  3.71066  4.02219  2.68750  3.58179  4.43991  1.74962  3.76841  2.89067  3.22378  2.71870  3.08261  3.61743  5.71348  4.25873     39 n - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     39   2.45597  4.30590  3.31493  2.92949  3.59235  3.23911  3.91663  2.93910  2.83564  2.15190  3.70088  3.25283  3.82703  3.22966  3.14634  1.76401  2.81984  2.68563  5.08737  3.75388     40 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     40   2.83118  5.07744  2.67793  1.98780  4.42427  3.36968  3.61250  3.81813  1.58680  3.35361  4.21372  2.88881  3.85157  2.76412  2.49900  2.80566  3.06178  3.47926  5.48885  4.19088     41 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     41   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866     42 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     42   2.86943  5.37025  1.48720  1.68161  4.65650  3.15841  3.70427  4.15303  2.71392  3.68857  4.55432  2.63699  3.77801  2.87679  3.29068  2.76612  3.15953  3.74941  5.84870  4.37021     43 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     43   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810     44 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     44   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377     45 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     45   2.98218  4.36435  4.50676  4.01602  3.41593  4.21472  4.76340  1.31823  3.88417  1.93426  3.25140  4.26634  4.56730  4.17326  4.10433  3.59756  3.25691  1.43933  5.35433  4.14022     46 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     46   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744     47 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     47   2.75188  4.95425  2.64292  2.37822  4.30694  3.30335  3.64804  3.77364  1.89460  3.33558  4.19487  1.92755  3.82286  2.81601  2.63305  2.75003  3.01785  3.41959  5.46070  4.12901     48 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     48   2.86373  5.03364  2.94780  2.52511  4.37763  3.45619  3.58659  3.79054  1.52604  3.28970  4.16353  2.99281  3.89419  2.18248  2.29299  2.85789  3.07486  3.46820  5.40183  4.14567     49 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     49   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377     50 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     50   2.95538  4.34998  4.46519  3.97421  3.44340  4.17486  4.73541  1.53480  3.84613  1.98408  3.28440  4.22615  4.54129  4.14279  4.07467  3.55589  3.23351  1.23791  5.35898  4.13629     51 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     51   2.62807  4.78281  2.78831  2.42268  4.17647  3.30029  3.64139  3.57162  2.00712  3.17535  4.01673  2.35136  3.79101  2.80630  2.69626  2.66185  2.39010  3.22791  5.38004  4.06884     52 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     52   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810     53 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     53   2.95223  5.07347  0.97056  2.31460  4.44594  3.18448  3.90108  4.02620  2.97869  3.64115  4.61902  2.86894  3.83483  3.14057  3.48961  2.91901  3.29024  3.66938  5.62143  4.32544     54 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     54   2.93141  5.02217  3.28901  2.69609  4.42911  3.55320  3.56890  3.79722  1.40255  3.28209  4.16057  3.11062  3.94663  2.71421  1.78950  2.94137  3.11801  3.48658  5.35892  4.16755     55 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     55   2.09160  4.54437  2.93693  2.55500  4.08653  3.20811  3.72677  3.45764  2.04565  3.10826  3.95687  2.99292  3.75456  2.91527  2.82865  2.15831  2.81636  3.09745  5.34999  4.06451     56 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     56   2.09834  4.21393  3.63818  3.16006  3.59735  3.41465  4.08382  2.01654  3.07616  2.46472  3.50667  3.45568  3.94973  3.40948  3.38457  2.77593  2.25989  2.18458  5.15304  3.92789     57 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     57   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377     58 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     58   2.39455  4.23936  3.39744  3.14846  3.93835  3.07965  4.16837  3.06118  3.09072  2.92591  3.97919  3.36317  3.78080  3.48748  3.35079  2.59548  1.23382  2.75997  5.37933  4.15515     59 t - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     59   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810     60 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     60   2.53740  4.30609  3.44344  3.04034  3.43823  3.36488  3.95560  2.72470  2.91173  1.72639  3.53663  3.35667  3.91294  3.30728  3.20010  2.16764  2.87491  2.53075  4.99683  3.67231     61 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     61   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634     62 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     62   2.96625  4.80679  3.45337  2.97263  4.15236  3.46036  3.80014  3.69206  2.22547  3.21453  4.21617  3.33481  3.96516  3.02271  1.03430  3.05246  3.23495  3.41769  5.25017  4.08800     63 r - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     63   2.58438  4.77631  1.95430  2.29138  4.31072  3.11585  3.75871  3.78750  2.70849  3.40618  4.25641  2.80456  3.73389  2.94856  3.19776  1.76287  2.93068  3.37430  5.58789  4.19762     64 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     64   2.29842  4.21804  3.17637  2.99106  4.04109  2.94862  4.10162  3.55914  3.06240  3.28234  4.21181  3.22118  3.68461  3.41464  3.34915  1.14610  2.77598  3.10206  5.41656  4.12456     65 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     65   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377     66 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     66   2.94147  5.01553  3.32901  2.71954  4.42322  3.56413  3.56951  3.78865  1.59365  3.27420  4.15599  3.12624  3.95439  2.71612  1.53777  2.95513  3.12575  3.48193  5.35045  4.16577     67 r - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     67   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203     68 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     68   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203     69 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     69   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377     70 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     70   1.06641  4.17525  3.42720  3.21749  4.01762  3.00061  4.24364  3.13786  3.23284  3.02105  4.05729  3.37586  3.73652  3.57742  3.48548  2.52610  2.80101  2.79847  5.44836  4.24477     71 a - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     71   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634     72 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     72   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634     73 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     73   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203     74 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     74   3.21381  4.62626  4.18968  3.89787  1.07193  3.91098  3.86281  2.74242  3.80591  2.12098  3.47821  3.97935  4.37076  3.98386  3.93443  3.48527  3.51513  2.73041  4.12335  2.49519     75 f - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     75   2.95223  5.07347  0.97056  2.31460  4.44594  3.18448  3.90108  4.02620  2.97869  3.64115  4.61902  2.86894  3.83483  3.14057  3.48961  2.91901  3.29024  3.66938  5.62143  4.32544     76 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     76   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866     77 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     77   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866     78 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     78   2.95756  4.78041  3.09252  2.84941  3.26099  3.41845  1.21998  3.65490  2.69349  3.15313  4.19373  3.25996  3.96930  3.21533  2.96107  3.02872  3.25993  3.39076  4.72643  3.21297     79 h - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     79   2.70596  4.46862  3.30939  3.14372  4.14097  3.15818  4.22369  3.67772  3.19807  3.30824  4.35696  3.45374  0.89665  3.58796  3.44718  2.87246  3.14485  3.32711  5.33681  4.26134     80 p - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     80   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634     81 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     81   2.95756  4.78041  3.09252  2.84941  3.26099  3.41845  1.21998  3.65490  2.69349  3.15313  4.19373  3.25996  3.96930  3.21533  2.96107  3.02872  3.25993  3.39076  4.72643  3.21297     82 h - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     82   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866     83 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     83   2.95685  4.72307  3.36949  2.96212  2.47047  3.68533  1.98810  3.33465  2.79887  2.82832  3.86666  3.30986  4.09634  3.20411  3.09533  3.03134  3.19357  3.12279  4.08013  1.96146     84 y - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     84   2.39455  4.23936  3.39744  3.14846  3.93835  3.07965  4.16837  3.06118  3.09072  2.92591  3.97919  3.36317  3.78080  3.48748  3.35079  2.59548  1.23382  2.75997  5.37933  4.15515     85 t - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     85   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377     86 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     86   2.69481  4.68927  2.69030  2.57246  4.04729  3.16078  3.89379  3.75053  2.79480  3.40163  4.35752  1.22278  3.81116  3.16695  3.14785  2.76366  3.07578  3.37635  5.35739  3.99855     87 n - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     87   1.06641  4.17525  3.42720  3.21749  4.01762  3.00061  4.24364  3.13786  3.23284  3.02105  4.05729  3.37586  3.73652  3.57742  3.48548  2.52610  2.80101  2.79847  5.44836  4.24477     88 a - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     88   1.06641  4.17525  3.42720  3.21749  4.01762  3.00061  4.24364  3.13786  3.23284  3.02105  4.05729  3.37586  3.73652  3.57742  3.48548  2.52610  2.80101  2.79847  5.44836  4.24477     89 a - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     89   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744     90 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     90   2.57184  4.54271  2.95423  2.17034  3.79055  3.36226  3.70710  2.54286  2.55589  2.81310  3.71020  3.01972  3.82272  2.92451  2.95186  2.29206  2.83457  2.79585  5.16112  3.86595     91 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     91   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377     92 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     92   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634     93 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     93   2.95223  5.07347  0.97056  2.31460  4.44594  3.18448  3.90108  4.02620  2.97869  3.64115  4.61902  2.86894  3.83483  3.14057  3.48961  2.91901  3.29024  3.66938  5.62143  4.32544     94 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     94   1.97479  4.18787  3.82042  3.42750  3.67318  3.37955  4.32185  2.25558  3.34416  2.45028  3.57942  3.61739  3.99491  3.67279  3.60942  2.80310  2.88207  1.47546  5.32111  4.09162     95 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     95   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377     96 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     96   2.95647  4.35010  4.46776  3.97647  3.44313  4.17741  4.73715  1.52911  3.84864  1.98302  3.28359  4.22840  4.54287  4.14475  4.07692  3.55827  3.23429  1.24117  5.35942  4.13723     97 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     97   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203     98 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     98   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203     99 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     99   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203    100 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    100   1.06641  4.17525  3.42720  3.21749  4.01762  3.00061  4.24364  3.13786  3.23284  3.02105  4.05729  3.37586  3.73652  3.57742  3.48548  2.52610  2.80101  2.79847  5.44836  4.24477    101 a - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    101   2.39455  4.23936  3.39744  3.14846  3.93835  3.07965  4.16837  3.06118  3.09072  2.92591  3.97919  3.36317  3.78080  3.48748  3.35079  2.59548  1.23382  2.75997  5.37933  4.15515    102 t - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    102   2.95223  5.07347  0.97056  2.31460  4.44594  3.18448  3.90108  4.02620  2.97869  3.64115  4.61902  2.86894  3.83483  3.14057  3.48961  2.91901  3.29024  3.66938  5.62143  4.32544    103 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    103   2.69481  4.68927  2.69030  2.57246  4.04729  3.16078  3.89379  3.75053  2.79480  3.40163  4.35752  1.22278  3.81116  3.16695  3.14785  2.76366  3.07578  3.37635  5.35739  3.99855    104 n - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    104   2.39455  4.23936  3.39744  3.14846  3.93835  3.07965  4.16837  3.06118  3.09072  2.92591  3.97919  3.36317  3.78080  3.48748  3.35079  2.59548  1.23382  2.75997  5.37933  4.15515    105 t - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    105   1.06641  4.17525  3.42720  3.21749  4.01762  3.00061  4.24364  3.13786  3.23284  3.02105  4.05729  3.37586  3.73652  3.57742  3.48548  2.52610  2.80101  2.79847  5.44836  4.24477    106 a - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    106   3.02941  4.39398  4.53178  3.99572  3.29468  4.29558  4.70725  1.58828  3.87172  1.54275  3.11713  4.27450  4.57894  4.11869  4.08541  3.64308  3.27717  1.49676  5.25052  4.07683    107 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    107   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    108 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    108   2.94190  4.49652  4.01144  3.60267  3.19328  3.80752  4.34609  2.36537  3.37252  1.79376  1.44801  3.88442  4.26833  3.75700  3.58193  3.28707  3.24672  2.36723  5.02908  3.78744    109 m - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    109   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    110 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    110   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    111 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    111   2.96625  4.80679  3.45337  2.97263  4.15236  3.46036  3.80014  3.69206  2.22547  3.21453  4.21617  3.33481  3.96516  3.02271  1.03430  3.05246  3.23495  3.41769  5.25017  4.08800    112 r - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    112   2.83198  4.94840  3.08255  2.59225  4.25470  3.47095  3.59254  3.70484  2.03534  3.20748  4.09327  3.04127  3.89737  1.89636  1.90297  2.84862  3.04747  3.39456  5.33082  4.07374    113 q - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    113   2.70596  4.46862  3.30939  3.14372  4.14097  3.15818  4.22369  3.67772  3.19807  3.30824  4.35696  3.45374  0.89665  3.58796  3.44718  2.87246  3.14485  3.32711  5.33681  4.26134    114 p - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    114   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377    115 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    115   2.95756  4.78041  3.09252  2.84941  3.26099  3.41845  1.21998  3.65490  2.69349  3.15313  4.19373  3.25996  3.96930  3.21533  2.96107  3.02872  3.25993  3.39076  4.72643  3.21297    116 h - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    116   2.29842  4.21804  3.17637  2.99106  4.04109  2.94862  4.10162  3.55914  3.06240  3.28234  4.21181  3.22118  3.68461  3.41464  3.34915  1.14610  2.77598  3.10206  5.41656  4.12456    117 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    117   2.86373  5.03364  2.94780  2.52511  4.37763  3.45619  3.58659  3.79054  1.52604  3.28970  4.16353  2.99281  3.89419  2.18248  2.29299  2.85789  3.07486  3.46820  5.40183  4.14567    118 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    118   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810    119 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    119   2.85365  4.83720  2.88061  2.63544  4.00086  3.34314  3.79321  3.62673  2.45886  3.13257  4.16207  3.09462  3.89649  1.29884  2.74347  2.90320  3.15094  3.35882  5.27952  3.97110    120 q - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    120   2.96625  4.80679  3.45337  2.97263  4.15236  3.46036  3.80014  3.69206  2.22547  3.21453  4.21617  3.33481  3.96516  3.02271  1.03430  3.05246  3.23495  3.41769  5.25017  4.08800    121 r - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    121   2.85365  4.83720  2.88061  2.63544  4.00086  3.34314  3.79321  3.62673  2.45886  3.13257  4.16207  3.09462  3.89649  1.29884  2.74347  2.90320  3.15094  3.35882  5.27952  3.97110    122 q - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    122   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810    123 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    123   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377    124 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    124   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203    125 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    125   2.69481  4.68927  2.69030  2.57246  4.04729  3.16078  3.89379  3.75053  2.79480  3.40163  4.35752  1.22278  3.81116  3.16695  3.14785  2.76366  3.07578  3.37635  5.35739  3.99855    126 n - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    126   2.29842  4.21804  3.17637  2.99106  4.04109  2.94862  4.10162  3.55914  3.06240  3.28234  4.21181  3.22118  3.68461  3.41464  3.34915  1.14610  2.77598  3.10206  5.41656  4.12456    127 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    127   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377    128 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    128   2.44713  4.25270  3.41786  3.00276  3.60289  3.27468  3.97069  2.20335  2.92512  2.61877  3.62871  3.31145  3.85161  3.28829  3.23805  1.80721  2.80493  2.49524  5.11088  3.81967    129 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    129   2.94190  4.49652  4.01144  3.60267  3.19328  3.80752  4.34609  2.36537  3.37252  1.79376  1.44801  3.88442  4.26833  3.75700  3.58193  3.28707  3.24672  2.36723  5.02908  3.78744    130 m - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    130   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203    131 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    131   2.95223  5.07347  0.97056  2.31460  4.44594  3.18448  3.90108  4.02620  2.97869  3.64115  4.61902  2.86894  3.83483  3.14057  3.48961  2.91901  3.29024  3.66938  5.62143  4.32544    132 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    132   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377    133 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    133   2.54748  1.01574  4.05735  3.78929  3.78938  3.17747  4.44428  2.92786  3.61619  2.84470  3.96505  3.78581  3.88159  3.96381  3.74670  2.81896  3.01132  2.67473  5.21244  4.07716    134 c - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    134   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377    135 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    135   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    136 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    136   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634    137 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    137   2.85365  4.83720  2.88061  2.63544  4.00086  3.34314  3.79321  3.62673  2.45886  3.13257  4.16207  3.09462  3.89649  1.29884  2.74347  2.90320  3.15094  3.35882  5.27952  3.97110    138 q - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    138   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810    139 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    139   2.95223  5.07347  0.97056  2.31460  4.44594  3.18448  3.90108  4.02620  2.97869  3.64115  4.61902  2.86894  3.83483  3.14057  3.48961  2.91901  3.29024  3.66938  5.62143  4.32544    140 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    140   2.95223  5.07347  0.97056  2.31460  4.44594  3.18448  3.90108  4.02620  2.97869  3.64115  4.61902  2.86894  3.83483  3.14057  3.48961  2.91901  3.29024  3.66938  5.62143  4.32544    141 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    141   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    142 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    142   3.21381  4.62626  4.18968  3.89787  1.07193  3.91098  3.86281  2.74242  3.80591  2.12098  3.47821  3.97935  4.37076  3.98386  3.93443  3.48527  3.51513  2.73041  4.12335  2.49519    143 f - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    143   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    144 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    144   2.39455  4.23936  3.39744  3.14846  3.93835  3.07965  4.16837  3.06118  3.09072  2.92591  3.97919  3.36317  3.78080  3.48748  3.35079  2.59548  1.23382  2.75997  5.37933  4.15515    145 t - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    145   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203    146 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    146   2.69481  4.68927  2.69030  2.57246  4.04729  3.16078  3.89379  3.75053  2.79480  3.40163  4.35752  1.22278  3.81116  3.16695  3.14785  2.76366  3.07578  3.37635  5.35739  3.99855    147 n - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    147   2.65226  4.48123  3.17348  2.80791  3.45655  3.42666  3.82043  2.87572  2.70671  1.80997  3.63798  2.41580  3.92497  3.13714  3.02278  2.81568  2.94329  2.67627  4.96987  3.59276    148 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    148   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203    149 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    149   2.93327  5.02405  3.29627  2.69847  4.43219  3.55593  3.56756  3.79912  1.41937  3.28272  4.16078  3.11215  3.94769  2.71245  1.76026  2.94298  3.11879  3.48852  5.35872  4.16856    150 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    150   2.70596  4.46862  3.30939  3.14372  4.14097  3.15818  4.22369  3.67772  3.19807  3.30824  4.35696  3.45374  0.89665  3.58796  3.44718  2.87246  3.14485  3.32711  5.33681  4.26134    151 p - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    151   2.85365  4.83720  2.88061  2.63544  4.00086  3.34314  3.79321  3.62673  2.45886  3.13257  4.16207  3.09462  3.89649  1.29884  2.74347  2.90320  3.15094  3.35882  5.27952  3.97110    152 q - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    152   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    153 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    153   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    154 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    154   1.06641  4.17525  3.42720  3.21749  4.01762  3.00061  4.24364  3.13786  3.23284  3.02105  4.05729  3.37586  3.73652  3.57742  3.48548  2.52610  2.80101  2.79847  5.44836  4.24477    155 a - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    155   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377    156 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    156   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634    157 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    157   3.19664  4.70006  3.78606  3.50925  2.29569  3.78896  3.60349  3.21093  3.36780  2.67393  3.88982  3.68029  4.26389  3.68239  3.55861  3.33670  3.48329  3.07987  3.93791  1.02720    158 y - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    158   2.95223  5.07347  0.97056  2.31460  4.44594  3.18448  3.90108  4.02620  2.97869  3.64115  4.61902  2.86894  3.83483  3.14057  3.48961  2.91901  3.29024  3.66938  5.62143  4.32544    159 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    159   2.85365  4.83720  2.88061  2.63544  4.00086  3.34314  3.79321  3.62673  2.45886  3.13257  4.16207  3.09462  3.89649  1.29884  2.74347  2.90320  3.15094  3.35882  5.27952  3.97110    160 q - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    160   1.97479  4.18787  3.82042  3.42750  3.67318  3.37955  4.32185  2.25558  3.34416  2.45028  3.57942  3.61739  3.99491  3.67279  3.60942  2.80310  2.88207  1.47546  5.32111  4.09162    161 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    161   2.95756  4.78041  3.09252  2.84941  3.26099  3.41845  1.21998  3.65490  2.69349  3.15313  4.19373  3.25996  3.96930  3.21533  2.96107  3.02872  3.25993  3.39076  4.72643  3.21297    162 h - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    162   2.85365  4.83720  2.88061  2.63544  4.00086  3.34314  3.79321  3.62673  2.45886  3.13257  4.16207  3.09462  3.89649  1.29884  2.74347  2.90320  3.15094  3.35882  5.27952  3.97110    163 q - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    163   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810    164 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    164   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    165 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    165   3.21381  4.62626  4.18968  3.89787  1.07193  3.91098  3.86281  2.74242  3.80591  2.12098  3.47821  3.97935  4.37076  3.98386  3.93443  3.48527  3.51513  2.73041  4.12335  2.49519    166 f - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    166   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    167 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    167   2.69812  4.28125  3.91402  3.45363  3.48566  3.69586  4.30567  1.55342  3.31817  2.19651  3.38369  3.73346  4.17805  3.67048  3.58344  3.07391  2.32096  1.93756  5.19637  3.96593    168 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    168   2.85250  5.33631  1.77405  1.45705  4.62463  3.16848  3.69601  4.11442  2.68271  3.65289  4.51317  2.64941  3.77739  2.86588  3.24482  2.75646  3.13848  3.71503  5.81423  4.34730    169 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    169   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634    170 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    170   2.54748  1.01574  4.05735  3.78929  3.78938  3.17747  4.44428  2.92786  3.61619  2.84470  3.96505  3.78581  3.88159  3.96381  3.74670  2.81896  3.01132  2.67473  5.21244  4.07716    171 c - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    171   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    172 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    172   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    173 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    173   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    174 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    174   2.73286  4.95160  2.53062  2.32167  4.23083  3.25729  3.66794  3.78803  2.41531  3.34358  4.21226  1.87081  3.80461  2.26403  2.79395  2.72676  3.01489  3.42864  5.45833  4.07687    175 n - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    175   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377    176 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    176   2.95223  5.07347  0.97056  2.31460  4.44594  3.18448  3.90108  4.02620  2.97869  3.64115  4.61902  2.86894  3.83483  3.14057  3.48961  2.91901  3.29024  3.66938  5.62143  4.32544    177 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    177   1.06641  4.17525  3.42720  3.21749  4.01762  3.00061  4.24364  3.13786  3.23284  3.02105  4.05729  3.37586  3.73652  3.57742  3.48548  2.52610  2.80101  2.79847  5.44836  4.24477    178 a - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    178   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    179 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    179   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203    180 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    180   1.06641  4.17525  3.42720  3.21749  4.01762  3.00061  4.24364  3.13786  3.23284  3.02105  4.05729  3.37586  3.73652  3.57742  3.48548  2.52610  2.80101  2.79847  5.44836  4.24477    181 a - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    181   2.96625  4.80679  3.45337  2.97263  4.15236  3.46036  3.80014  3.69206  2.22547  3.21453  4.21617  3.33481  3.96516  3.02271  1.03430  3.05246  3.23495  3.41769  5.25017  4.08800    182 r - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    182   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377    183 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    183   2.85365  4.83720  2.88061  2.63544  4.00086  3.34314  3.79321  3.62673  2.45886  3.13257  4.16207  3.09462  3.89649  1.29884  2.74347  2.90320  3.15094  3.35882  5.27952  3.97110    184 q - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    184   2.29842  4.21804  3.17637  2.99106  4.04109  2.94862  4.10162  3.55914  3.06240  3.28234  4.21181  3.22118  3.68461  3.41464  3.34915  1.14610  2.77598  3.10206  5.41656  4.12456    185 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    185   2.70596  4.46862  3.30939  3.14372  4.14097  3.15818  4.22369  3.67772  3.19807  3.30824  4.35696  3.45374  0.89665  3.58796  3.44718  2.87246  3.14485  3.32711  5.33681  4.26134    186 p - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    186   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    187 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    187   2.70596  4.46862  3.30939  3.14372  4.14097  3.15818  4.22369  3.67772  3.19807  3.30824  4.35696  3.45374  0.89665  3.58796  3.44718  2.87246  3.14485  3.32711  5.33681  4.26134    188 p - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    188   2.85405  5.34323  1.74169  1.47720  4.63099  3.16711  3.69593  4.12227  2.68527  3.65888  4.51884  2.64677  3.77697  2.86564  3.24995  2.75659  3.14022  3.72146  5.82005  4.35065    189 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    189   2.29842  4.21804  3.17637  2.99106  4.04109  2.94862  4.10162  3.55914  3.06240  3.28234  4.21181  3.22118  3.68461  3.41464  3.34915  1.14610  2.77598  3.10206  5.41656  4.12456    190 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    190   2.29842  4.21804  3.17637  2.99106  4.04109  2.94862  4.10162  3.55914  3.06240  3.28234  4.21181  3.22118  3.68461  3.41464  3.34915  1.14610  2.77598  3.10206  5.41656  4.12456    191 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    191   2.29842  4.21804  3.17637  2.99106  4.04109  2.94862  4.10162  3.55914  3.06240  3.28234  4.21181  3.22118  3.68461  3.41464  3.34915  1.14610  2.77598  3.10206  5.41656  4.12456    192 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    192   2.29842  4.21804  3.17637  2.99106  4.04109  2.94862  4.10162  3.55914  3.06240  3.28234  4.21181  3.22118  3.68461  3.41464  3.34915  1.14610  2.77598  3.10206  5.41656  4.12456    193 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    193   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    194 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    194   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    195 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    195   2.79709  5.08659  2.49459  1.88859  4.36827  3.29795  3.63911  3.82257  2.35064  3.35770  4.22674  2.81254  3.81850  1.90750  2.73001  2.76234  3.04847  3.47891  5.52674  4.17093    196 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    196   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    197 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    197   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810    198 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    198   3.19664  4.70006  3.78606  3.50925  2.29569  3.78896  3.60349  3.21093  3.36780  2.67393  3.88982  3.68029  4.26389  3.68239  3.55861  3.33670  3.48329  3.07987  3.93791  1.02720    199 y - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    199   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634    200 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    200   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810    201 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    201   2.29842  4.21804  3.17637  2.99106  4.04109  2.94862  4.10162  3.55914  3.06240  3.28234  4.21181  3.22118  3.68461  3.41464  3.34915  1.14610  2.77598  3.10206  5.41656  4.12456    202 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    202   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    203 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    203   2.95756  4.78041  3.09252  2.84941  3.26099  3.41845  1.21998  3.65490  2.69349  3.15313  4.19373  3.25996  3.96930  3.21533  2.96107  3.02872  3.25993  3.39076  4.72643  3.21297    204 h - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    204   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634    205 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    205   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    206 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.02203  3.82629        *  0.61958  0.77255  0.00000        *
-//
Binary file test-data/cached_locally/hmmdb_levels/ENOG411CB2I/ENOG411CB2I.h3f has changed
Binary file test-data/cached_locally/hmmdb_levels/ENOG411CB2I/ENOG411CB2I.h3i has changed
Binary file test-data/cached_locally/hmmdb_levels/ENOG411CB2I/ENOG411CB2I.h3m has changed
Binary file test-data/cached_locally/hmmdb_levels/ENOG411CB2I/ENOG411CB2I.h3p has changed
--- a/test-data/cached_locally/hmmdb_levels/thaNOG/thaNOG	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,637 +0,0 @@
-HMMER3/f [3.1b1 | May 2013]
-NAME  thaNOG
-LENG  205
-ALPH  amino
-RF    no
-MM    no
-CONS  yes
-CS    no
-MAP   yes
-DATE  Thu Apr 16 06:29:18 2015
-NSEQ  3
-EFFN  0.454102
-CKSUM 2514733105
-STATS LOCAL MSV      -10.6020  0.70508
-STATS LOCAL VITERBI  -11.4006  0.70508
-STATS LOCAL FORWARD   -4.9608  0.70508
-HMM          A        C        D        E        F        G        H        I        K        L        M        N        P        Q        R        S        T        V        W        Y   
-            m->m     m->i     m->d     i->m     i->i     d->m     d->d
-  COMPO   2.60488  4.26537  2.86806  2.68812  3.48541  2.84597  3.68190  2.58658  2.57105  2.36046  3.71753  3.12796  3.51194  3.07828  3.00549  2.67857  2.91482  2.52396  5.16454  3.68907
-          2.68619  4.42226  2.77521  2.73125  3.46355  2.40514  3.72496  3.29355  2.67742  2.69356  4.24578  2.90348  2.73741  3.18148  2.89802  2.37888  2.77521  2.98520  4.58478  3.61505
-          0.17176  1.91497  4.55917  0.35031  1.21898  0.00000        *
-      1   3.06761  4.52439  4.31327  3.78099  3.05250  4.16350  4.46561  2.17607  3.57234  1.30879  1.91901  4.09154  4.45690  3.86045  3.77957  3.51234  3.30962  2.23580  5.01687  3.83610      2 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-      2   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810      3 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-      3   2.78351  4.58087  3.32911  2.88754  3.40933  3.59103  3.84122  2.81006  2.61259  1.66760  3.45029  3.30455  4.01739  2.39416  2.89621  2.95209  3.03282  2.70991  4.99124  3.67436      4 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-      4   2.53418  4.23705  3.59368  3.16853  3.49025  3.42404  4.06074  1.74993  3.06664  2.43412  3.49971  3.45907  3.96332  3.42386  3.35145  2.21772  2.86823  2.25074  5.06222  3.78462      5 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-      5   2.78589  5.09914  2.65704  2.00312  4.42838  3.36184  3.58271  3.84850  1.89046  3.35615  4.18804  2.85104  3.82604  2.22691  2.52714  2.75121  3.01078  3.49213  5.49453  4.17260      6 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-      6   2.93327  5.02405  3.29627  2.69847  4.43219  3.55593  3.56756  3.79912  1.41937  3.28272  4.16078  3.11215  3.94769  2.71245  1.76026  2.94298  3.11879  3.48852  5.35872  4.16856      7 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-      7   2.42315  4.21787  3.44026  2.97006  3.62502  3.28653  3.93296  2.25259  2.89478  2.62127  3.57447  3.29089  3.83488  3.23909  3.22031  2.19519  2.23227  2.47087  5.09408  3.85175      8 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-      8   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866      9 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-      9   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377     10 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     10   2.21970  4.14708  3.27216  2.97236  4.05658  2.94753  4.04583  3.36566  2.97325  3.13664  4.01775  3.19548  3.65760  3.31810  3.28297  1.86435  1.69294  2.93575  5.43271  4.18954     11 t - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     11   2.67125  4.89170  2.63995  2.01286  4.19991  3.30620  3.62584  3.60098  2.37369  3.19109  4.03621  2.84971  3.79086  2.33541  2.77812  2.67728  2.37271  3.26758  5.41474  4.07676     12 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     12   3.08388  4.45892  4.50779  3.99931  3.20318  4.29602  4.67441  1.39467  3.81924  1.46323  3.07061  4.27722  4.58606  4.09884  4.01845  3.66823  3.33503  1.84767  5.18001  3.96570     13 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     13   3.19664  4.70006  3.78606  3.50925  2.29569  3.78896  3.60349  3.21093  3.36780  2.67393  3.88982  3.68029  4.26389  3.68239  3.55861  3.33670  3.48329  3.07987  3.93791  1.02720     14 y - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     14   2.98251  4.43779  4.31388  3.82115  3.20877  4.08952  4.54007  2.00695  3.64555  1.30599  3.09552  4.09798  4.45211  3.94746  3.86362  3.46665  3.25564  1.64211  5.13725  3.91385     15 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     15   2.15254  2.45969  3.69479  3.31339  3.86059  2.92557  4.16344  3.17236  3.21287  2.97886  3.87676  3.36254  3.65358  3.52003  3.46091  1.53946  2.62341  2.77195  5.29578  4.07476     16 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     16   2.59251  4.66552  2.70968  2.48311  4.18488  1.89749  3.77255  3.67484  2.56229  3.27203  4.14808  2.94825  3.77150  2.19715  2.92693  2.65455  2.93244  3.29447  5.43421  4.12493     17 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     17   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866     18 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     18   2.60329  4.67395  2.70600  2.00150  4.09633  3.24110  3.74529  3.37050  2.56262  3.09514  3.99481  2.93437  3.79294  2.94110  2.95657  2.66876  1.95122  3.05941  5.40020  4.08679     19 t - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     19   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634     20 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     20   2.65547  4.70380  3.01820  2.59794  4.14489  3.34071  3.68321  3.44079  1.66289  3.10417  3.99661  3.03826  3.83752  2.85967  2.55384  2.72496  2.29676  3.12897  5.34446  4.08131     21 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     21   2.41051  4.45743  2.76314  2.55610  4.16025  3.04300  3.85109  3.67733  2.73646  3.31958  4.16963  2.20738  3.70062  3.07277  3.12216  1.67816  2.81237  3.22852  5.47353  4.13338     22 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     22   2.65353  4.59175  3.08992  2.62618  3.21831  3.45751  2.78699  3.20248  2.55484  2.81536  3.72079  3.07821  2.83953  2.94374  2.92698  2.74675  2.89512  2.94118  4.70593  2.60361     23 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     23   2.72437  4.43914  3.47351  2.98245  3.55531  3.61673  3.90477  1.80448  2.22279  2.42136  3.50035  3.37449  4.03540  3.18688  2.94028  2.95940  2.97488  2.33967  5.07615  3.82063     24 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     24   2.86943  5.37025  1.48720  1.68161  4.65650  3.15841  3.70427  4.15303  2.71392  3.68857  4.55432  2.63699  3.77801  2.87679  3.29068  2.76612  3.15953  3.74941  5.84870  4.37021     25 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     25   2.75188  4.95425  2.64292  2.37822  4.30694  3.30335  3.64804  3.77364  1.89460  3.33558  4.19487  1.92755  3.82286  2.81601  2.63305  2.75003  3.01785  3.41959  5.46070  4.12901     26 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     26   3.11252  4.49860  4.49768  3.98112  3.12965  4.30058  4.64392  1.65480  3.79730  1.21127  2.99244  4.26847  4.57626  4.06087  3.99147  3.66694  3.35840  1.96471  5.12672  3.92986     27 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.15852  3.83682  2.07920  0.61958  0.77255  0.48576  0.95510
-     27   2.83586  4.77841  3.00116  2.66224  4.12832  3.33459  3.69011  3.54935  1.27962  3.15323  4.13068  3.09104  3.85234  2.89630  2.42938  2.89266  3.10512  3.26853  5.25424  4.04656     28 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03685  3.71515  4.43750  0.61958  0.77255  0.43000  1.05127
-     28   2.54621  4.50545  3.20868  2.74070  3.97594  3.28582  3.75341  3.30020  2.38979  2.97470  3.88469  3.12680  3.81520  2.96087  2.13200  2.66599  1.92060  2.99170  5.25951  4.00783     29 t - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     29   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744     30 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     30   2.65547  4.70380  3.01820  2.59794  4.14489  3.34071  3.68321  3.44079  1.66289  3.10417  3.99661  3.03826  3.83752  2.85967  2.55384  2.72496  2.29676  3.12897  5.34446  4.08131     31 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     31   1.67965  4.13282  3.20050  2.99025  4.21129  1.65226  4.12825  3.55509  3.11281  3.30619  4.17417  3.19398  3.63080  3.40845  3.42192  2.37211  2.68272  3.05705  5.55180  4.33965     32 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     32   3.21381  4.62626  4.18968  3.89787  1.07193  3.91098  3.86281  2.74242  3.80591  2.12098  3.47821  3.97935  4.37076  3.98386  3.93443  3.48527  3.51513  2.73041  4.12335  2.49519     33 f - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     33   2.21970  4.14708  3.27216  2.97236  4.05658  2.94753  4.04583  3.36566  2.97325  3.13664  4.01775  3.19548  3.65760  3.31810  3.28297  1.86435  1.69294  2.93575  5.43271  4.18954     34 t - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     34   2.78560  5.27768  1.86934  1.80297  4.55819  3.20409  3.64189  4.04711  2.54675  3.55896  4.38459  2.66950  3.76604  2.26443  3.07420  2.70307  3.05119  3.64483  5.72667  4.27496     35 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     35   2.74146  5.16867  1.96020  2.15061  4.47368  3.22791  3.62910  3.95193  2.08633  3.47754  4.29703  2.24711  3.76617  2.77862  2.96847  2.68168  3.00386  3.55795  5.64114  4.21923     36 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     36   2.73346  4.43500  3.54559  3.00804  3.33649  3.68461  3.91834  2.17057  2.80785  1.85388  3.27994  3.41358  4.05637  2.54293  3.11320  2.97298  2.96843  2.42744  4.96172  3.70767     37 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     37   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866     38 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     38   2.77722  5.15078  1.82843  2.12879  4.47753  3.15657  3.71066  4.02219  2.68750  3.58179  4.43991  1.74962  3.76841  2.89067  3.22378  2.71870  3.08261  3.61743  5.71348  4.25873     39 n - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     39   2.45597  4.30590  3.31493  2.92949  3.59235  3.23911  3.91663  2.93910  2.83564  2.15190  3.70088  3.25283  3.82703  3.22966  3.14634  1.76401  2.81984  2.68563  5.08737  3.75388     40 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     40   2.83118  5.07744  2.67793  1.98780  4.42427  3.36968  3.61250  3.81813  1.58680  3.35361  4.21372  2.88881  3.85157  2.76412  2.49900  2.80566  3.06178  3.47926  5.48885  4.19088     41 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     41   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866     42 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     42   2.86943  5.37025  1.48720  1.68161  4.65650  3.15841  3.70427  4.15303  2.71392  3.68857  4.55432  2.63699  3.77801  2.87679  3.29068  2.76612  3.15953  3.74941  5.84870  4.37021     43 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     43   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810     44 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     44   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377     45 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     45   2.98218  4.36435  4.50676  4.01602  3.41593  4.21472  4.76340  1.31823  3.88417  1.93426  3.25140  4.26634  4.56730  4.17326  4.10433  3.59756  3.25691  1.43933  5.35433  4.14022     46 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     46   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744     47 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     47   2.75188  4.95425  2.64292  2.37822  4.30694  3.30335  3.64804  3.77364  1.89460  3.33558  4.19487  1.92755  3.82286  2.81601  2.63305  2.75003  3.01785  3.41959  5.46070  4.12901     48 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     48   2.86373  5.03364  2.94780  2.52511  4.37763  3.45619  3.58659  3.79054  1.52604  3.28970  4.16353  2.99281  3.89419  2.18248  2.29299  2.85789  3.07486  3.46820  5.40183  4.14567     49 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     49   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377     50 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     50   2.95538  4.34998  4.46519  3.97421  3.44340  4.17486  4.73541  1.53480  3.84613  1.98408  3.28440  4.22615  4.54129  4.14279  4.07467  3.55589  3.23351  1.23791  5.35898  4.13629     51 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     51   2.62807  4.78281  2.78831  2.42268  4.17647  3.30029  3.64139  3.57162  2.00712  3.17535  4.01673  2.35136  3.79101  2.80630  2.69626  2.66185  2.39010  3.22791  5.38004  4.06884     52 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     52   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810     53 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     53   2.95223  5.07347  0.97056  2.31460  4.44594  3.18448  3.90108  4.02620  2.97869  3.64115  4.61902  2.86894  3.83483  3.14057  3.48961  2.91901  3.29024  3.66938  5.62143  4.32544     54 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     54   2.93141  5.02217  3.28901  2.69609  4.42911  3.55320  3.56890  3.79722  1.40255  3.28209  4.16057  3.11062  3.94663  2.71421  1.78950  2.94137  3.11801  3.48658  5.35892  4.16755     55 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     55   2.09160  4.54437  2.93693  2.55500  4.08653  3.20811  3.72677  3.45764  2.04565  3.10826  3.95687  2.99292  3.75456  2.91527  2.82865  2.15831  2.81636  3.09745  5.34999  4.06451     56 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     56   2.09834  4.21393  3.63818  3.16006  3.59735  3.41465  4.08382  2.01654  3.07616  2.46472  3.50667  3.45568  3.94973  3.40948  3.38457  2.77593  2.25989  2.18458  5.15304  3.92789     57 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     57   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377     58 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     58   2.39455  4.23936  3.39744  3.14846  3.93835  3.07965  4.16837  3.06118  3.09072  2.92591  3.97919  3.36317  3.78080  3.48748  3.35079  2.59548  1.23382  2.75997  5.37933  4.15515     59 t - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     59   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810     60 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     60   2.53740  4.30609  3.44344  3.04034  3.43823  3.36488  3.95560  2.72470  2.91173  1.72639  3.53663  3.35667  3.91294  3.30728  3.20010  2.16764  2.87491  2.53075  4.99683  3.67231     61 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     61   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634     62 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     62   2.96625  4.80679  3.45337  2.97263  4.15236  3.46036  3.80014  3.69206  2.22547  3.21453  4.21617  3.33481  3.96516  3.02271  1.03430  3.05246  3.23495  3.41769  5.25017  4.08800     63 r - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     63   2.58438  4.77631  1.95430  2.29138  4.31072  3.11585  3.75871  3.78750  2.70849  3.40618  4.25641  2.80456  3.73389  2.94856  3.19776  1.76287  2.93068  3.37430  5.58789  4.19762     64 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     64   2.29842  4.21804  3.17637  2.99106  4.04109  2.94862  4.10162  3.55914  3.06240  3.28234  4.21181  3.22118  3.68461  3.41464  3.34915  1.14610  2.77598  3.10206  5.41656  4.12456     65 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     65   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377     66 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     66   2.94147  5.01553  3.32901  2.71954  4.42322  3.56413  3.56951  3.78865  1.59365  3.27420  4.15599  3.12624  3.95439  2.71612  1.53777  2.95513  3.12575  3.48193  5.35045  4.16577     67 r - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     67   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203     68 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     68   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203     69 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     69   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377     70 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     70   1.06641  4.17525  3.42720  3.21749  4.01762  3.00061  4.24364  3.13786  3.23284  3.02105  4.05729  3.37586  3.73652  3.57742  3.48548  2.52610  2.80101  2.79847  5.44836  4.24477     71 a - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     71   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634     72 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     72   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634     73 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     73   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203     74 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     74   3.21381  4.62626  4.18968  3.89787  1.07193  3.91098  3.86281  2.74242  3.80591  2.12098  3.47821  3.97935  4.37076  3.98386  3.93443  3.48527  3.51513  2.73041  4.12335  2.49519     75 f - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     75   2.95223  5.07347  0.97056  2.31460  4.44594  3.18448  3.90108  4.02620  2.97869  3.64115  4.61902  2.86894  3.83483  3.14057  3.48961  2.91901  3.29024  3.66938  5.62143  4.32544     76 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     76   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866     77 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     77   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866     78 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     78   2.95756  4.78041  3.09252  2.84941  3.26099  3.41845  1.21998  3.65490  2.69349  3.15313  4.19373  3.25996  3.96930  3.21533  2.96107  3.02872  3.25993  3.39076  4.72643  3.21297     79 h - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     79   2.70596  4.46862  3.30939  3.14372  4.14097  3.15818  4.22369  3.67772  3.19807  3.30824  4.35696  3.45374  0.89665  3.58796  3.44718  2.87246  3.14485  3.32711  5.33681  4.26134     80 p - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     80   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634     81 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     81   2.95756  4.78041  3.09252  2.84941  3.26099  3.41845  1.21998  3.65490  2.69349  3.15313  4.19373  3.25996  3.96930  3.21533  2.96107  3.02872  3.25993  3.39076  4.72643  3.21297     82 h - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     82   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866     83 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     83   2.95685  4.72307  3.36949  2.96212  2.47047  3.68533  1.98810  3.33465  2.79887  2.82832  3.86666  3.30986  4.09634  3.20411  3.09533  3.03134  3.19357  3.12279  4.08013  1.96146     84 y - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     84   2.39455  4.23936  3.39744  3.14846  3.93835  3.07965  4.16837  3.06118  3.09072  2.92591  3.97919  3.36317  3.78080  3.48748  3.35079  2.59548  1.23382  2.75997  5.37933  4.15515     85 t - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     85   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377     86 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     86   2.69481  4.68927  2.69030  2.57246  4.04729  3.16078  3.89379  3.75053  2.79480  3.40163  4.35752  1.22278  3.81116  3.16695  3.14785  2.76366  3.07578  3.37635  5.35739  3.99855     87 n - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     87   1.06641  4.17525  3.42720  3.21749  4.01762  3.00061  4.24364  3.13786  3.23284  3.02105  4.05729  3.37586  3.73652  3.57742  3.48548  2.52610  2.80101  2.79847  5.44836  4.24477     88 a - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     88   1.06641  4.17525  3.42720  3.21749  4.01762  3.00061  4.24364  3.13786  3.23284  3.02105  4.05729  3.37586  3.73652  3.57742  3.48548  2.52610  2.80101  2.79847  5.44836  4.24477     89 a - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     89   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744     90 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     90   2.57184  4.54271  2.95423  2.17034  3.79055  3.36226  3.70710  2.54286  2.55589  2.81310  3.71020  3.01972  3.82272  2.92451  2.95186  2.29206  2.83457  2.79585  5.16112  3.86595     91 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     91   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377     92 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     92   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634     93 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     93   2.95223  5.07347  0.97056  2.31460  4.44594  3.18448  3.90108  4.02620  2.97869  3.64115  4.61902  2.86894  3.83483  3.14057  3.48961  2.91901  3.29024  3.66938  5.62143  4.32544     94 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     94   1.97479  4.18787  3.82042  3.42750  3.67318  3.37955  4.32185  2.25558  3.34416  2.45028  3.57942  3.61739  3.99491  3.67279  3.60942  2.80310  2.88207  1.47546  5.32111  4.09162     95 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     95   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377     96 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     96   2.95647  4.35010  4.46776  3.97647  3.44313  4.17741  4.73715  1.52911  3.84864  1.98302  3.28359  4.22840  4.54287  4.14475  4.07692  3.55827  3.23429  1.24117  5.35942  4.13723     97 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     97   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203     98 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     98   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203     99 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-     99   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203    100 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    100   1.06641  4.17525  3.42720  3.21749  4.01762  3.00061  4.24364  3.13786  3.23284  3.02105  4.05729  3.37586  3.73652  3.57742  3.48548  2.52610  2.80101  2.79847  5.44836  4.24477    101 a - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    101   2.39455  4.23936  3.39744  3.14846  3.93835  3.07965  4.16837  3.06118  3.09072  2.92591  3.97919  3.36317  3.78080  3.48748  3.35079  2.59548  1.23382  2.75997  5.37933  4.15515    102 t - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    102   2.95223  5.07347  0.97056  2.31460  4.44594  3.18448  3.90108  4.02620  2.97869  3.64115  4.61902  2.86894  3.83483  3.14057  3.48961  2.91901  3.29024  3.66938  5.62143  4.32544    103 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    103   2.69481  4.68927  2.69030  2.57246  4.04729  3.16078  3.89379  3.75053  2.79480  3.40163  4.35752  1.22278  3.81116  3.16695  3.14785  2.76366  3.07578  3.37635  5.35739  3.99855    104 n - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    104   2.39455  4.23936  3.39744  3.14846  3.93835  3.07965  4.16837  3.06118  3.09072  2.92591  3.97919  3.36317  3.78080  3.48748  3.35079  2.59548  1.23382  2.75997  5.37933  4.15515    105 t - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    105   1.06641  4.17525  3.42720  3.21749  4.01762  3.00061  4.24364  3.13786  3.23284  3.02105  4.05729  3.37586  3.73652  3.57742  3.48548  2.52610  2.80101  2.79847  5.44836  4.24477    106 a - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    106   3.02941  4.39398  4.53178  3.99572  3.29468  4.29558  4.70725  1.58828  3.87172  1.54275  3.11713  4.27450  4.57894  4.11869  4.08541  3.64308  3.27717  1.49676  5.25052  4.07683    107 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    107   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    108 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    108   2.94190  4.49652  4.01144  3.60267  3.19328  3.80752  4.34609  2.36537  3.37252  1.79376  1.44801  3.88442  4.26833  3.75700  3.58193  3.28707  3.24672  2.36723  5.02908  3.78744    109 m - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    109   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    110 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    110   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    111 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    111   2.96625  4.80679  3.45337  2.97263  4.15236  3.46036  3.80014  3.69206  2.22547  3.21453  4.21617  3.33481  3.96516  3.02271  1.03430  3.05246  3.23495  3.41769  5.25017  4.08800    112 r - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    112   2.83198  4.94840  3.08255  2.59225  4.25470  3.47095  3.59254  3.70484  2.03534  3.20748  4.09327  3.04127  3.89737  1.89636  1.90297  2.84862  3.04747  3.39456  5.33082  4.07374    113 q - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    113   2.70596  4.46862  3.30939  3.14372  4.14097  3.15818  4.22369  3.67772  3.19807  3.30824  4.35696  3.45374  0.89665  3.58796  3.44718  2.87246  3.14485  3.32711  5.33681  4.26134    114 p - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    114   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377    115 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    115   2.95756  4.78041  3.09252  2.84941  3.26099  3.41845  1.21998  3.65490  2.69349  3.15313  4.19373  3.25996  3.96930  3.21533  2.96107  3.02872  3.25993  3.39076  4.72643  3.21297    116 h - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    116   2.29842  4.21804  3.17637  2.99106  4.04109  2.94862  4.10162  3.55914  3.06240  3.28234  4.21181  3.22118  3.68461  3.41464  3.34915  1.14610  2.77598  3.10206  5.41656  4.12456    117 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    117   2.86373  5.03364  2.94780  2.52511  4.37763  3.45619  3.58659  3.79054  1.52604  3.28970  4.16353  2.99281  3.89419  2.18248  2.29299  2.85789  3.07486  3.46820  5.40183  4.14567    118 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    118   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810    119 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    119   2.85365  4.83720  2.88061  2.63544  4.00086  3.34314  3.79321  3.62673  2.45886  3.13257  4.16207  3.09462  3.89649  1.29884  2.74347  2.90320  3.15094  3.35882  5.27952  3.97110    120 q - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    120   2.96625  4.80679  3.45337  2.97263  4.15236  3.46036  3.80014  3.69206  2.22547  3.21453  4.21617  3.33481  3.96516  3.02271  1.03430  3.05246  3.23495  3.41769  5.25017  4.08800    121 r - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    121   2.85365  4.83720  2.88061  2.63544  4.00086  3.34314  3.79321  3.62673  2.45886  3.13257  4.16207  3.09462  3.89649  1.29884  2.74347  2.90320  3.15094  3.35882  5.27952  3.97110    122 q - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    122   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810    123 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    123   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377    124 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    124   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203    125 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    125   2.69481  4.68927  2.69030  2.57246  4.04729  3.16078  3.89379  3.75053  2.79480  3.40163  4.35752  1.22278  3.81116  3.16695  3.14785  2.76366  3.07578  3.37635  5.35739  3.99855    126 n - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    126   2.29842  4.21804  3.17637  2.99106  4.04109  2.94862  4.10162  3.55914  3.06240  3.28234  4.21181  3.22118  3.68461  3.41464  3.34915  1.14610  2.77598  3.10206  5.41656  4.12456    127 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    127   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377    128 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    128   2.44713  4.25270  3.41786  3.00276  3.60289  3.27468  3.97069  2.20335  2.92512  2.61877  3.62871  3.31145  3.85161  3.28829  3.23805  1.80721  2.80493  2.49524  5.11088  3.81967    129 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    129   2.94190  4.49652  4.01144  3.60267  3.19328  3.80752  4.34609  2.36537  3.37252  1.79376  1.44801  3.88442  4.26833  3.75700  3.58193  3.28707  3.24672  2.36723  5.02908  3.78744    130 m - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    130   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203    131 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    131   2.95223  5.07347  0.97056  2.31460  4.44594  3.18448  3.90108  4.02620  2.97869  3.64115  4.61902  2.86894  3.83483  3.14057  3.48961  2.91901  3.29024  3.66938  5.62143  4.32544    132 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    132   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377    133 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    133   2.54748  1.01574  4.05735  3.78929  3.78938  3.17747  4.44428  2.92786  3.61619  2.84470  3.96505  3.78581  3.88159  3.96381  3.74670  2.81896  3.01132  2.67473  5.21244  4.07716    134 c - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    134   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377    135 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    135   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    136 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    136   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634    137 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    137   2.85365  4.83720  2.88061  2.63544  4.00086  3.34314  3.79321  3.62673  2.45886  3.13257  4.16207  3.09462  3.89649  1.29884  2.74347  2.90320  3.15094  3.35882  5.27952  3.97110    138 q - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    138   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810    139 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    139   2.95223  5.07347  0.97056  2.31460  4.44594  3.18448  3.90108  4.02620  2.97869  3.64115  4.61902  2.86894  3.83483  3.14057  3.48961  2.91901  3.29024  3.66938  5.62143  4.32544    140 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    140   2.95223  5.07347  0.97056  2.31460  4.44594  3.18448  3.90108  4.02620  2.97869  3.64115  4.61902  2.86894  3.83483  3.14057  3.48961  2.91901  3.29024  3.66938  5.62143  4.32544    141 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    141   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    142 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    142   3.21381  4.62626  4.18968  3.89787  1.07193  3.91098  3.86281  2.74242  3.80591  2.12098  3.47821  3.97935  4.37076  3.98386  3.93443  3.48527  3.51513  2.73041  4.12335  2.49519    143 f - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    143   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    144 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    144   2.39455  4.23936  3.39744  3.14846  3.93835  3.07965  4.16837  3.06118  3.09072  2.92591  3.97919  3.36317  3.78080  3.48748  3.35079  2.59548  1.23382  2.75997  5.37933  4.15515    145 t - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    145   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203    146 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    146   2.69481  4.68927  2.69030  2.57246  4.04729  3.16078  3.89379  3.75053  2.79480  3.40163  4.35752  1.22278  3.81116  3.16695  3.14785  2.76366  3.07578  3.37635  5.35739  3.99855    147 n - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    147   2.65226  4.48123  3.17348  2.80791  3.45655  3.42666  3.82043  2.87572  2.70671  1.80997  3.63798  2.41580  3.92497  3.13714  3.02278  2.81568  2.94329  2.67627  4.96987  3.59276    148 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    148   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203    149 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    149   2.93327  5.02405  3.29627  2.69847  4.43219  3.55593  3.56756  3.79912  1.41937  3.28272  4.16078  3.11215  3.94769  2.71245  1.76026  2.94298  3.11879  3.48852  5.35872  4.16856    150 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    150   2.70596  4.46862  3.30939  3.14372  4.14097  3.15818  4.22369  3.67772  3.19807  3.30824  4.35696  3.45374  0.89665  3.58796  3.44718  2.87246  3.14485  3.32711  5.33681  4.26134    151 p - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    151   2.85365  4.83720  2.88061  2.63544  4.00086  3.34314  3.79321  3.62673  2.45886  3.13257  4.16207  3.09462  3.89649  1.29884  2.74347  2.90320  3.15094  3.35882  5.27952  3.97110    152 q - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    152   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    153 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    153   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    154 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    154   1.06641  4.17525  3.42720  3.21749  4.01762  3.00061  4.24364  3.13786  3.23284  3.02105  4.05729  3.37586  3.73652  3.57742  3.48548  2.52610  2.80101  2.79847  5.44836  4.24477    155 a - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    155   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377    156 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    156   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634    157 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    157   3.19664  4.70006  3.78606  3.50925  2.29569  3.78896  3.60349  3.21093  3.36780  2.67393  3.88982  3.68029  4.26389  3.68239  3.55861  3.33670  3.48329  3.07987  3.93791  1.02720    158 y - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    158   2.95223  5.07347  0.97056  2.31460  4.44594  3.18448  3.90108  4.02620  2.97869  3.64115  4.61902  2.86894  3.83483  3.14057  3.48961  2.91901  3.29024  3.66938  5.62143  4.32544    159 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    159   2.85365  4.83720  2.88061  2.63544  4.00086  3.34314  3.79321  3.62673  2.45886  3.13257  4.16207  3.09462  3.89649  1.29884  2.74347  2.90320  3.15094  3.35882  5.27952  3.97110    160 q - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    160   1.97479  4.18787  3.82042  3.42750  3.67318  3.37955  4.32185  2.25558  3.34416  2.45028  3.57942  3.61739  3.99491  3.67279  3.60942  2.80310  2.88207  1.47546  5.32111  4.09162    161 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    161   2.95756  4.78041  3.09252  2.84941  3.26099  3.41845  1.21998  3.65490  2.69349  3.15313  4.19373  3.25996  3.96930  3.21533  2.96107  3.02872  3.25993  3.39076  4.72643  3.21297    162 h - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    162   2.85365  4.83720  2.88061  2.63544  4.00086  3.34314  3.79321  3.62673  2.45886  3.13257  4.16207  3.09462  3.89649  1.29884  2.74347  2.90320  3.15094  3.35882  5.27952  3.97110    163 q - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    163   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810    164 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    164   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    165 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    165   3.21381  4.62626  4.18968  3.89787  1.07193  3.91098  3.86281  2.74242  3.80591  2.12098  3.47821  3.97935  4.37076  3.98386  3.93443  3.48527  3.51513  2.73041  4.12335  2.49519    166 f - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    166   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    167 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    167   2.69812  4.28125  3.91402  3.45363  3.48566  3.69586  4.30567  1.55342  3.31817  2.19651  3.38369  3.73346  4.17805  3.67048  3.58344  3.07391  2.32096  1.93756  5.19637  3.96593    168 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    168   2.85250  5.33631  1.77405  1.45705  4.62463  3.16848  3.69601  4.11442  2.68271  3.65289  4.51317  2.64941  3.77739  2.86588  3.24482  2.75646  3.13848  3.71503  5.81423  4.34730    169 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    169   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634    170 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    170   2.54748  1.01574  4.05735  3.78929  3.78938  3.17747  4.44428  2.92786  3.61619  2.84470  3.96505  3.78581  3.88159  3.96381  3.74670  2.81896  3.01132  2.67473  5.21244  4.07716    171 c - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    171   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    172 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    172   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    173 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    173   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    174 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    174   2.73286  4.95160  2.53062  2.32167  4.23083  3.25729  3.66794  3.78803  2.41531  3.34358  4.21226  1.87081  3.80461  2.26403  2.79395  2.72676  3.01489  3.42864  5.45833  4.07687    175 n - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    175   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377    176 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    176   2.95223  5.07347  0.97056  2.31460  4.44594  3.18448  3.90108  4.02620  2.97869  3.64115  4.61902  2.86894  3.83483  3.14057  3.48961  2.91901  3.29024  3.66938  5.62143  4.32544    177 d - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    177   1.06641  4.17525  3.42720  3.21749  4.01762  3.00061  4.24364  3.13786  3.23284  3.02105  4.05729  3.37586  3.73652  3.57742  3.48548  2.52610  2.80101  2.79847  5.44836  4.24477    178 a - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    178   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    179 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    179   2.78010  4.33317  4.07550  3.73808  3.52466  3.68642  4.54616  2.05401  3.60530  2.21828  3.49579  3.93347  4.24932  3.96792  3.82113  3.18815  3.14277  1.07114  5.30288  4.03203    180 v - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    180   1.06641  4.17525  3.42720  3.21749  4.01762  3.00061  4.24364  3.13786  3.23284  3.02105  4.05729  3.37586  3.73652  3.57742  3.48548  2.52610  2.80101  2.79847  5.44836  4.24477    181 a - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    181   2.96625  4.80679  3.45337  2.97263  4.15236  3.46036  3.80014  3.69206  2.22547  3.21453  4.21617  3.33481  3.96516  3.02271  1.03430  3.05246  3.23495  3.41769  5.25017  4.08800    182 r - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    182   3.11581  4.58898  4.13200  3.77226  3.12310  3.93638  4.43920  2.32589  3.54034  0.92039  3.15824  4.05113  4.37826  3.91722  3.72201  3.50392  3.41191  2.35386  4.98887  3.70377    183 l - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    183   2.85365  4.83720  2.88061  2.63544  4.00086  3.34314  3.79321  3.62673  2.45886  3.13257  4.16207  3.09462  3.89649  1.29884  2.74347  2.90320  3.15094  3.35882  5.27952  3.97110    184 q - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    184   2.29842  4.21804  3.17637  2.99106  4.04109  2.94862  4.10162  3.55914  3.06240  3.28234  4.21181  3.22118  3.68461  3.41464  3.34915  1.14610  2.77598  3.10206  5.41656  4.12456    185 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    185   2.70596  4.46862  3.30939  3.14372  4.14097  3.15818  4.22369  3.67772  3.19807  3.30824  4.35696  3.45374  0.89665  3.58796  3.44718  2.87246  3.14485  3.32711  5.33681  4.26134    186 p - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    186   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    187 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    187   2.70596  4.46862  3.30939  3.14372  4.14097  3.15818  4.22369  3.67772  3.19807  3.30824  4.35696  3.45374  0.89665  3.58796  3.44718  2.87246  3.14485  3.32711  5.33681  4.26134    188 p - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    188   2.85405  5.34323  1.74169  1.47720  4.63099  3.16711  3.69593  4.12227  2.68527  3.65888  4.51884  2.64677  3.77697  2.86564  3.24995  2.75659  3.14022  3.72146  5.82005  4.35065    189 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    189   2.29842  4.21804  3.17637  2.99106  4.04109  2.94862  4.10162  3.55914  3.06240  3.28234  4.21181  3.22118  3.68461  3.41464  3.34915  1.14610  2.77598  3.10206  5.41656  4.12456    190 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    190   2.29842  4.21804  3.17637  2.99106  4.04109  2.94862  4.10162  3.55914  3.06240  3.28234  4.21181  3.22118  3.68461  3.41464  3.34915  1.14610  2.77598  3.10206  5.41656  4.12456    191 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    191   2.29842  4.21804  3.17637  2.99106  4.04109  2.94862  4.10162  3.55914  3.06240  3.28234  4.21181  3.22118  3.68461  3.41464  3.34915  1.14610  2.77598  3.10206  5.41656  4.12456    192 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    192   2.29842  4.21804  3.17637  2.99106  4.04109  2.94862  4.10162  3.55914  3.06240  3.28234  4.21181  3.22118  3.68461  3.41464  3.34915  1.14610  2.77598  3.10206  5.41656  4.12456    193 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    193   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    194 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    194   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    195 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    195   2.79709  5.08659  2.49459  1.88859  4.36827  3.29795  3.63911  3.82257  2.35064  3.35770  4.22674  2.81254  3.81850  1.90750  2.73001  2.76234  3.04847  3.47891  5.52674  4.17093    196 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    196   2.94036  4.90159  3.11392  2.74278  4.27986  3.43307  3.74090  3.70703  1.08817  3.28019  4.24408  3.16863  3.93637  2.93480  2.42690  2.98500  3.19656  3.41702  5.34960  4.15744    197 k - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    197   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810    198 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    198   3.19664  4.70006  3.78606  3.50925  2.29569  3.78896  3.60349  3.21093  3.36780  2.67393  3.88982  3.68029  4.26389  3.68239  3.55861  3.33670  3.48329  3.07987  3.93791  1.02720    199 y - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    199   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634    200 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    200   2.92273  5.02492  2.47434  1.07719  4.36685  3.25185  3.83632  3.81369  2.71243  3.43683  4.41304  2.91439  3.85493  3.05312  3.11711  2.90913  3.22689  3.50145  5.54519  4.26810    201 e - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    201   2.29842  4.21804  3.17637  2.99106  4.04109  2.94862  4.10162  3.55914  3.06240  3.28234  4.21181  3.22118  3.68461  3.41464  3.34915  1.14610  2.77598  3.10206  5.41656  4.12456    202 s - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    202   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    203 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    203   2.95756  4.78041  3.09252  2.84941  3.26099  3.41845  1.21998  3.65490  2.69349  3.15313  4.19373  3.25996  3.96930  3.21533  2.96107  3.02872  3.25993  3.39076  4.72643  3.21297    204 h - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    204   2.62209  4.40041  3.28850  3.18371  4.32546  0.78630  4.30564  3.91689  3.36007  3.57539  4.55128  3.45295  3.79040  3.68714  3.59951  2.79308  3.10058  3.45214  5.42949  4.42634    205 g - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.03256  3.83682  4.55917  0.61958  0.77255  0.48576  0.95510
-    205   3.00341  4.43279  4.28393  3.89883  3.35077  4.02713  4.63395  1.12320  3.72623  1.94475  3.29234  4.14920  4.46227  4.07854  3.92692  3.51945  3.30343  1.84653  5.23382  3.96866    206 i - - -
-          2.68618  4.42225  2.77519  2.73123  3.46354  2.40513  3.72494  3.29354  2.67741  2.69355  4.24690  2.90347  2.73739  3.18146  2.89801  2.37887  2.77519  2.98518  4.58477  3.61503
-          0.02203  3.82629        *  0.61958  0.77255  0.00000        *
-//
Binary file test-data/cached_locally/hmmdb_levels/thaNOG/thaNOG.h3f has changed
Binary file test-data/cached_locally/hmmdb_levels/thaNOG/thaNOG.h3i has changed
Binary file test-data/cached_locally/hmmdb_levels/thaNOG/thaNOG.h3m has changed
Binary file test-data/cached_locally/hmmdb_levels/thaNOG/thaNOG.h3p has changed
Binary file test-data/cached_locally/hmmdb_levels/thaNOG_hmm/thaNOG_hmm.all_hmm.h3f has changed
Binary file test-data/cached_locally/hmmdb_levels/thaNOG_hmm/thaNOG_hmm.all_hmm.h3i has changed
Binary file test-data/cached_locally/hmmdb_levels/thaNOG_hmm/thaNOG_hmm.all_hmm.h3m has changed
Binary file test-data/cached_locally/hmmdb_levels/thaNOG_hmm/thaNOG_hmm.all_hmm.h3p has changed
--- a/test-data/cached_locally/hmmdb_levels/thaNOG_hmm/thaNOG_hmm.all_hmm.idmap	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,1465 +0,0 @@
- 
-1 thaNOG.ENOG411CBXW.meta_raw
-2 thaNOG.ENOG411CB9A.meta_raw
-3 thaNOG.ENOG411CBE9.meta_raw
-4 thaNOG.ENOG411CBDJ.meta_raw
-5 thaNOG.ENOG411CC6Z.meta_raw
-6 thaNOG.ENOG411CBDE.meta_raw
-7 thaNOG.ENOG411CC3U.meta_raw
-8 thaNOG.ENOG411CBAN.meta_raw
-9 thaNOG.ENOG411CBN8.meta_raw
-10 thaNOG.ENOG411CC99.meta_raw
-11 thaNOG.ENOG411CC08.meta_raw
-12 thaNOG.ENOG411CBZ3.meta_raw
-13 thaNOG.ENOG411CBTB.meta_raw
-14 thaNOG.ENOG411CB5Y.meta_raw
-15 thaNOG.ENOG411CBTK.meta_raw
-16 thaNOG.ENOG411CCB4.meta_raw
-17 thaNOG.ENOG411CBCR.meta_raw
-18 thaNOG.ENOG411CC69.meta_raw
-19 thaNOG.ENOG411CB7A.meta_raw
-20 thaNOG.ENOG411CBNA.meta_raw
-21 thaNOG.ENOG411CBB9.meta_raw
-22 thaNOG.ENOG411CBWE.meta_raw
-23 thaNOG.ENOG411CCBA.meta_raw
-24 thaNOG.ENOG411CC4D.meta_raw
-25 thaNOG.ENOG411CC9I.meta_raw
-26 thaNOG.ENOG411CBCM.meta_raw
-27 thaNOG.ENOG411CBZ6.meta_raw
-28 thaNOG.ENOG411CBZV.meta_raw
-29 thaNOG.ENOG411CBBR.meta_raw
-30 thaNOG.ENOG411CBGU.meta_raw
-31 thaNOG.ENOG411CBBB.meta_raw
-32 thaNOG.ENOG411CBEW.meta_raw
-33 thaNOG.ENOG411CC6X.meta_raw
-34 thaNOG.ENOG411CC8E.meta_raw
-35 thaNOG.ENOG411CBXR.meta_raw
-36 thaNOG.ENOG411CC5U.meta_raw
-37 thaNOG.ENOG411CBAJ.meta_raw
-38 thaNOG.ENOG411CBDV.meta_raw
-39 thaNOG.ENOG411CBRB.meta_raw
-40 thaNOG.ENOG411CB60.meta_raw
-41 thaNOG.ENOG411CBNP.meta_raw
-42 thaNOG.ENOG411CB8J.meta_raw
-43 thaNOG.ENOG411CBT9.meta_raw
-44 thaNOG.ENOG411CBJ5.meta_raw
-45 thaNOG.ENOG411CB5T.meta_raw
-46 thaNOG.ENOG411CBN2.meta_raw
-47 thaNOG.ENOG411CBMW.meta_raw
-48 thaNOG.ENOG411CBGJ.meta_raw
-49 thaNOG.ENOG411CB56.meta_raw
-50 thaNOG.ENOG411CB47.meta_raw
-51 thaNOG.ENOG411CBI7.meta_raw
-52 thaNOG.ENOG411CBY7.meta_raw
-53 thaNOG.ENOG411CBIS.meta_raw
-54 thaNOG.ENOG411CBP3.meta_raw
-55 thaNOG.ENOG411CBXK.meta_raw
-56 thaNOG.ENOG411CBT6.meta_raw
-57 thaNOG.ENOG411CBCT.meta_raw
-58 thaNOG.ENOG411CBJT.meta_raw
-59 thaNOG.ENOG411CBJ9.meta_raw
-60 thaNOG.ENOG411CBN3.meta_raw
-61 thaNOG.ENOG411CBR1.meta_raw
-62 thaNOG.ENOG411CBKA.meta_raw
-63 thaNOG.ENOG411CBY9.meta_raw
-64 thaNOG.ENOG411CBNK.meta_raw
-65 thaNOG.ENOG411CC8I.meta_raw
-66 thaNOG.ENOG411CBN0.meta_raw
-67 thaNOG.ENOG411CBP2.meta_raw
-68 thaNOG.ENOG411CBDZ.meta_raw
-69 thaNOG.ENOG411CC0R.meta_raw
-70 thaNOG.ENOG411CBRC.meta_raw
-71 thaNOG.ENOG411CBF2.meta_raw
-72 thaNOG.ENOG411CC3S.meta_raw
-73 thaNOG.ENOG411CBIX.meta_raw
-74 thaNOG.ENOG411CBMB.meta_raw
-75 thaNOG.ENOG411CB4H.meta_raw
-76 thaNOG.ENOG411CB4G.meta_raw
-77 thaNOG.ENOG411CBC0.meta_raw
-78 thaNOG.ENOG411CBFX.meta_raw
-79 thaNOG.ENOG411CC30.meta_raw
-80 thaNOG.ENOG411CBSC.meta_raw
-81 thaNOG.ENOG411CBRN.meta_raw
-82 thaNOG.ENOG411CBAA.meta_raw
-83 thaNOG.ENOG411CBPY.meta_raw
-84 thaNOG.ENOG411CBDW.meta_raw
-85 thaNOG.ENOG411CBMS.meta_raw
-86 thaNOG.ENOG411CBP1.meta_raw
-87 thaNOG.ENOG411CBB3.meta_raw
-88 thaNOG.ENOG411CB74.meta_raw
-89 thaNOG.ENOG411CC4M.meta_raw
-90 thaNOG.ENOG411CC9S.meta_raw
-91 thaNOG.ENOG411CBZE.meta_raw
-92 thaNOG.ENOG411CC6C.meta_raw
-93 thaNOG.ENOG411CBID.meta_raw
-94 thaNOG.ENOG411CBXY.meta_raw
-95 thaNOG.ENOG411CB4A.meta_raw
-96 thaNOG.ENOG411CBGZ.meta_raw
-97 thaNOG.ENOG411CBU5.meta_raw
-98 thaNOG.ENOG411CBJC.meta_raw
-99 thaNOG.ENOG411CB34.meta_raw
-100 thaNOG.ENOG411CBXH.meta_raw
-101 thaNOG.ENOG411CB44.meta_raw
-102 thaNOG.ENOG411CBAI.meta_raw
-103 thaNOG.ENOG411CC4Y.meta_raw
-104 thaNOG.ENOG411CBQV.meta_raw
-105 thaNOG.ENOG411CC26.meta_raw
-106 thaNOG.ENOG411CBC2.meta_raw
-107 thaNOG.ENOG411CB8B.meta_raw
-108 thaNOG.ENOG411CBH2.meta_raw
-109 thaNOG.ENOG411CBCU.meta_raw
-110 thaNOG.ENOG411CBG2.meta_raw
-111 thaNOG.ENOG411CBDX.meta_raw
-112 thaNOG.ENOG411CBW6.meta_raw
-113 thaNOG.ENOG411CB84.meta_raw
-114 thaNOG.ENOG411CB97.meta_raw
-115 thaNOG.ENOG411CBUX.meta_raw
-116 thaNOG.ENOG411CBJH.meta_raw
-117 thaNOG.ENOG411CBCC.meta_raw
-118 thaNOG.ENOG411CC7R.meta_raw
-119 thaNOG.ENOG411CBNW.meta_raw
-120 thaNOG.ENOG411CB9H.meta_raw
-121 thaNOG.ENOG411CBRZ.meta_raw
-122 thaNOG.ENOG411CB4W.meta_raw
-123 thaNOG.ENOG411CBBI.meta_raw
-124 thaNOG.ENOG411CB6U.meta_raw
-125 thaNOG.ENOG411CC5W.meta_raw
-126 thaNOG.ENOG411CBUQ.meta_raw
-127 thaNOG.ENOG411CC2F.meta_raw
-128 thaNOG.ENOG411CCAD.meta_raw
-129 thaNOG.ENOG411CBQT.meta_raw
-130 thaNOG.ENOG411CBCA.meta_raw
-131 thaNOG.ENOG411CC3I.meta_raw
-132 thaNOG.ENOG411CB2E.meta_raw
-133 thaNOG.ENOG411CB3P.meta_raw
-134 thaNOG.ENOG411CBES.meta_raw
-135 thaNOG.ENOG411CC0C.meta_raw
-136 thaNOG.ENOG411CC2E.meta_raw
-137 thaNOG.ENOG411CBTI.meta_raw
-138 thaNOG.ENOG411CBS1.meta_raw
-139 thaNOG.ENOG411CC5A.meta_raw
-140 thaNOG.ENOG411CBEM.meta_raw
-141 thaNOG.ENOG411CBRP.meta_raw
-142 thaNOG.ENOG411CC06.meta_raw
-143 thaNOG.ENOG411CBWF.meta_raw
-144 thaNOG.ENOG411CBG0.meta_raw
-145 thaNOG.ENOG411CBY0.meta_raw
-146 thaNOG.ENOG411CC7X.meta_raw
-147 thaNOG.ENOG411CBA5.meta_raw
-148 thaNOG.ENOG411CBXQ.meta_raw
-149 thaNOG.ENOG411CB9S.meta_raw
-150 thaNOG.ENOG411CC8X.meta_raw
-151 thaNOG.ENOG411CBZJ.meta_raw
-152 thaNOG.ENOG411CBZN.meta_raw
-153 thaNOG.ENOG411CC51.meta_raw
-154 thaNOG.ENOG411CC3C.meta_raw
-155 thaNOG.ENOG411CB2N.meta_raw
-156 thaNOG.ENOG411CC7D.meta_raw
-157 thaNOG.ENOG411CBHK.meta_raw
-158 thaNOG.ENOG411CBUM.meta_raw
-159 thaNOG.ENOG411CBJE.meta_raw
-160 thaNOG.ENOG411CC2A.meta_raw
-161 thaNOG.ENOG411CB6X.meta_raw
-162 thaNOG.ENOG411CBM6.meta_raw
-163 thaNOG.ENOG411CBKT.meta_raw
-164 thaNOG.ENOG411CBX9.meta_raw
-165 thaNOG.ENOG411CB8D.meta_raw
-166 thaNOG.ENOG411CBHS.meta_raw
-167 thaNOG.ENOG411CB9P.meta_raw
-168 thaNOG.ENOG411CB9R.meta_raw
-169 thaNOG.ENOG411CC0B.meta_raw
-170 thaNOG.ENOG411CBIA.meta_raw
-171 thaNOG.ENOG411CC73.meta_raw
-172 thaNOG.ENOG411CC3H.meta_raw
-173 thaNOG.ENOG411CCBB.meta_raw
-174 thaNOG.ENOG411CB77.meta_raw
-175 thaNOG.ENOG411CBMV.meta_raw
-176 thaNOG.ENOG411CB6N.meta_raw
-177 thaNOG.ENOG411CBQY.meta_raw
-178 thaNOG.ENOG411CBEZ.meta_raw
-179 thaNOG.ENOG411CB9T.meta_raw
-180 thaNOG.ENOG411CC1Z.meta_raw
-181 thaNOG.ENOG411CBAQ.meta_raw
-182 thaNOG.ENOG411CBGW.meta_raw
-183 thaNOG.ENOG411CBIP.meta_raw
-184 thaNOG.ENOG411CB4Y.meta_raw
-185 thaNOG.ENOG411CBPX.meta_raw
-186 thaNOG.ENOG411CC0X.meta_raw
-187 thaNOG.ENOG411CBCZ.meta_raw
-188 thaNOG.ENOG411CBVV.meta_raw
-189 thaNOG.ENOG411CBV7.meta_raw
-190 thaNOG.ENOG411CC8B.meta_raw
-191 thaNOG.ENOG411CBZ1.meta_raw
-192 thaNOG.ENOG411CBEQ.meta_raw
-193 thaNOG.ENOG411CBUF.meta_raw
-194 thaNOG.ENOG411CBSP.meta_raw
-195 thaNOG.ENOG411CBIN.meta_raw
-196 thaNOG.ENOG411CBA6.meta_raw
-197 thaNOG.ENOG411CBM1.meta_raw
-198 thaNOG.ENOG411CC6S.meta_raw
-199 thaNOG.ENOG411CBTV.meta_raw
-200 thaNOG.ENOG411CC4N.meta_raw
-201 thaNOG.ENOG411CBW1.meta_raw
-202 thaNOG.ENOG411CBZK.meta_raw
-203 thaNOG.ENOG411CC1G.meta_raw
-204 thaNOG.ENOG411CBRI.meta_raw
-205 thaNOG.ENOG411CB3C.meta_raw
-206 thaNOG.ENOG411CBKC.meta_raw
-207 thaNOG.ENOG411CC03.meta_raw
-208 thaNOG.ENOG411CBBH.meta_raw
-209 thaNOG.ENOG411CBHB.meta_raw
-210 thaNOG.ENOG411CC3T.meta_raw
-211 thaNOG.ENOG411CB98.meta_raw
-212 thaNOG.ENOG411CC1J.meta_raw
-213 thaNOG.ENOG411CBSU.meta_raw
-214 thaNOG.ENOG411CBTU.meta_raw
-215 thaNOG.ENOG411CB2V.meta_raw
-216 thaNOG.ENOG411CC87.meta_raw
-217 thaNOG.ENOG411CBIC.meta_raw
-218 thaNOG.ENOG411CBBJ.meta_raw
-219 thaNOG.ENOG411CB7T.meta_raw
-220 thaNOG.ENOG411CBUE.meta_raw
-221 thaNOG.ENOG411CBAD.meta_raw
-222 thaNOG.ENOG411CC0S.meta_raw
-223 thaNOG.ENOG411CC07.meta_raw
-224 thaNOG.ENOG411CBS4.meta_raw
-225 thaNOG.ENOG411CBU3.meta_raw
-226 thaNOG.ENOG411CBD6.meta_raw
-227 thaNOG.ENOG411CBSZ.meta_raw
-228 thaNOG.ENOG411CBMA.meta_raw
-229 thaNOG.ENOG411CB6R.meta_raw
-230 thaNOG.ENOG411CC47.meta_raw
-231 thaNOG.ENOG411CBVR.meta_raw
-232 thaNOG.ENOG411CC40.meta_raw
-233 thaNOG.ENOG411CBKN.meta_raw
-234 thaNOG.ENOG411CBUJ.meta_raw
-235 thaNOG.ENOG411CBCY.meta_raw
-236 thaNOG.ENOG411CC0D.meta_raw
-237 thaNOG.ENOG411CBAY.meta_raw
-238 thaNOG.ENOG411CBI0.meta_raw
-239 thaNOG.ENOG411CC00.meta_raw
-240 thaNOG.ENOG411CBVM.meta_raw
-241 thaNOG.ENOG411CB8M.meta_raw
-242 thaNOG.ENOG411CC91.meta_raw
-243 thaNOG.ENOG411CBJQ.meta_raw
-244 thaNOG.ENOG411CB3G.meta_raw
-245 thaNOG.ENOG411CBET.meta_raw
-246 thaNOG.ENOG411CBGQ.meta_raw
-247 thaNOG.ENOG411CC5K.meta_raw
-248 thaNOG.ENOG411CBGX.meta_raw
-249 thaNOG.ENOG411CC17.meta_raw
-250 thaNOG.ENOG411CBHJ.meta_raw
-251 thaNOG.ENOG411CBEX.meta_raw
-252 thaNOG.ENOG411CC4Q.meta_raw
-253 thaNOG.ENOG411CC3Y.meta_raw
-254 thaNOG.ENOG411CBPM.meta_raw
-255 thaNOG.ENOG411CB8P.meta_raw
-256 thaNOG.ENOG411CB2J.meta_raw
-257 thaNOG.ENOG411CB7Z.meta_raw
-258 thaNOG.ENOG411CCA8.meta_raw
-259 thaNOG.ENOG411CC1K.meta_raw
-260 thaNOG.ENOG411CB6Q.meta_raw
-261 thaNOG.ENOG411CBFU.meta_raw
-262 thaNOG.ENOG411CB49.meta_raw
-263 thaNOG.ENOG411CC53.meta_raw
-264 thaNOG.ENOG411CBTS.meta_raw
-265 thaNOG.ENOG411CBP5.meta_raw
-266 thaNOG.ENOG411CBVY.meta_raw
-267 thaNOG.ENOG411CC82.meta_raw
-268 thaNOG.ENOG411CB7D.meta_raw
-269 thaNOG.ENOG411CBKK.meta_raw
-270 thaNOG.ENOG411CBVF.meta_raw
-271 thaNOG.ENOG411CB7R.meta_raw
-272 thaNOG.ENOG411CBXB.meta_raw
-273 thaNOG.ENOG411CBE1.meta_raw
-274 thaNOG.ENOG411CB73.meta_raw
-275 thaNOG.ENOG411CC5N.meta_raw
-276 thaNOG.ENOG411CBYH.meta_raw
-277 thaNOG.ENOG411CB8H.meta_raw
-278 thaNOG.ENOG411CC4X.meta_raw
-279 thaNOG.ENOG411CBAR.meta_raw
-280 thaNOG.ENOG411CB6S.meta_raw
-281 thaNOG.ENOG411CBHA.meta_raw
-282 thaNOG.ENOG411CBWY.meta_raw
-283 thaNOG.ENOG411CBCH.meta_raw
-284 thaNOG.ENOG411CBRQ.meta_raw
-285 thaNOG.ENOG411CBH8.meta_raw
-286 thaNOG.ENOG411CBP8.meta_raw
-287 thaNOG.ENOG411CBDA.meta_raw
-288 thaNOG.ENOG411CBSN.meta_raw
-289 thaNOG.ENOG411CC28.meta_raw
-290 thaNOG.ENOG411CBBK.meta_raw
-291 thaNOG.ENOG411CC50.meta_raw
-292 thaNOG.ENOG411CBEV.meta_raw
-293 thaNOG.ENOG411CB4D.meta_raw
-294 thaNOG.ENOG411CBYR.meta_raw
-295 thaNOG.ENOG411CC1M.meta_raw
-296 thaNOG.ENOG411CBK5.meta_raw
-297 thaNOG.ENOG411CC9P.meta_raw
-298 thaNOG.ENOG411CB3N.meta_raw
-299 thaNOG.ENOG411CC6T.meta_raw
-300 thaNOG.ENOG411CB86.meta_raw
-301 thaNOG.ENOG411CB9W.meta_raw
-302 thaNOG.ENOG411CB5S.meta_raw
-303 thaNOG.ENOG411CBTN.meta_raw
-304 thaNOG.ENOG411CB40.meta_raw
-305 thaNOG.ENOG411CC44.meta_raw
-306 thaNOG.ENOG411CBHN.meta_raw
-307 thaNOG.ENOG411CBN4.meta_raw
-308 thaNOG.ENOG411CBEE.meta_raw
-309 thaNOG.ENOG411CBK8.meta_raw
-310 thaNOG.ENOG411CBBU.meta_raw
-311 thaNOG.ENOG411CC0P.meta_raw
-312 thaNOG.ENOG411CC5T.meta_raw
-313 thaNOG.ENOG411CBZ4.meta_raw
-314 thaNOG.ENOG411CCB8.meta_raw
-315 thaNOG.ENOG411CBP0.meta_raw
-316 thaNOG.ENOG411CCB6.meta_raw
-317 thaNOG.ENOG411CB7J.meta_raw
-318 thaNOG.ENOG411CC4R.meta_raw
-319 thaNOG.ENOG411CBNF.meta_raw
-320 thaNOG.ENOG411CB2X.meta_raw
-321 thaNOG.ENOG411CBV3.meta_raw
-322 thaNOG.ENOG411CC64.meta_raw
-323 thaNOG.ENOG411CBV8.meta_raw
-324 thaNOG.ENOG411CBB8.meta_raw
-325 thaNOG.ENOG411CBZZ.meta_raw
-326 thaNOG.ENOG411CBGS.meta_raw
-327 thaNOG.ENOG411CBKJ.meta_raw
-328 thaNOG.ENOG411CBQZ.meta_raw
-329 thaNOG.ENOG411CB8A.meta_raw
-330 thaNOG.ENOG411CBSS.meta_raw
-331 thaNOG.ENOG411CBXT.meta_raw
-332 thaNOG.ENOG411CC7F.meta_raw
-333 thaNOG.ENOG411CBYI.meta_raw
-334 thaNOG.ENOG411CB9J.meta_raw
-335 thaNOG.ENOG411CC8H.meta_raw
-336 thaNOG.ENOG411CB46.meta_raw
-337 thaNOG.ENOG411CBT2.meta_raw
-338 thaNOG.ENOG411CBF8.meta_raw
-339 thaNOG.ENOG411CB5N.meta_raw
-340 thaNOG.ENOG411CB8Y.meta_raw
-341 thaNOG.ENOG411CC5Q.meta_raw
-342 thaNOG.ENOG411CBG4.meta_raw
-343 thaNOG.ENOG411CB7W.meta_raw
-344 thaNOG.ENOG411CCB5.meta_raw
-345 thaNOG.ENOG411CBFK.meta_raw
-346 thaNOG.ENOG411CBTA.meta_raw
-347 thaNOG.ENOG411CC2U.meta_raw
-348 thaNOG.ENOG411CC5E.meta_raw
-349 thaNOG.ENOG411CBEH.meta_raw
-350 thaNOG.ENOG411CCAT.meta_raw
-351 thaNOG.ENOG411CBQE.meta_raw
-352 thaNOG.ENOG411CBMK.meta_raw
-353 thaNOG.ENOG411CBJX.meta_raw
-354 thaNOG.ENOG411CBZH.meta_raw
-355 thaNOG.ENOG411CBJM.meta_raw
-356 thaNOG.ENOG411CC4B.meta_raw
-357 thaNOG.ENOG411CBBY.meta_raw
-358 thaNOG.ENOG411CBAM.meta_raw
-359 thaNOG.ENOG411CBDK.meta_raw
-360 thaNOG.ENOG411CBIR.meta_raw
-361 thaNOG.ENOG411CBMJ.meta_raw
-362 thaNOG.ENOG411CB6C.meta_raw
-363 thaNOG.ENOG411CBSJ.meta_raw
-364 thaNOG.ENOG411CCAS.meta_raw
-365 thaNOG.ENOG411CC83.meta_raw
-366 thaNOG.ENOG411CC02.meta_raw
-367 thaNOG.ENOG411CC2B.meta_raw
-368 thaNOG.ENOG411CBDG.meta_raw
-369 thaNOG.ENOG411CBFI.meta_raw
-370 thaNOG.ENOG411CC3W.meta_raw
-371 thaNOG.ENOG411CBZU.meta_raw
-372 thaNOG.ENOG411CBHI.meta_raw
-373 thaNOG.ENOG411CC29.meta_raw
-374 thaNOG.ENOG411CBFR.meta_raw
-375 thaNOG.ENOG411CBPG.meta_raw
-376 thaNOG.ENOG411CC8C.meta_raw
-377 thaNOG.ENOG411CC9Z.meta_raw
-378 thaNOG.ENOG411CBH0.meta_raw
-379 thaNOG.ENOG411CB3I.meta_raw
-380 thaNOG.ENOG411CBUW.meta_raw
-381 thaNOG.ENOG411CCAW.meta_raw
-382 thaNOG.ENOG411CC0F.meta_raw
-383 thaNOG.ENOG411CB51.meta_raw
-384 thaNOG.ENOG411CB9X.meta_raw
-385 thaNOG.ENOG411CBG3.meta_raw
-386 thaNOG.ENOG411CBQ3.meta_raw
-387 thaNOG.ENOG411CC4G.meta_raw
-388 thaNOG.ENOG411CC3D.meta_raw
-389 thaNOG.ENOG411CC8A.meta_raw
-390 thaNOG.ENOG411CB9Q.meta_raw
-391 thaNOG.ENOG411CBC6.meta_raw
-392 thaNOG.ENOG411CBMU.meta_raw
-393 thaNOG.ENOG411CBJW.meta_raw
-394 thaNOG.ENOG411CB4Q.meta_raw
-395 thaNOG.ENOG411CBRS.meta_raw
-396 thaNOG.ENOG411CBKH.meta_raw
-397 thaNOG.ENOG411CB2U.meta_raw
-398 thaNOG.ENOG411CBD7.meta_raw
-399 thaNOG.ENOG411CBX1.meta_raw
-400 thaNOG.ENOG411CBK6.meta_raw
-401 thaNOG.ENOG411CBB2.meta_raw
-402 thaNOG.ENOG411CBI3.meta_raw
-403 thaNOG.ENOG411CC8G.meta_raw
-404 thaNOG.ENOG411CC4V.meta_raw
-405 thaNOG.ENOG411CBUC.meta_raw
-406 thaNOG.ENOG411CBIQ.meta_raw
-407 thaNOG.ENOG411CBE8.meta_raw
-408 thaNOG.ENOG411CC2H.meta_raw
-409 thaNOG.ENOG411CBVX.meta_raw
-410 thaNOG.ENOG411CB89.meta_raw
-411 thaNOG.ENOG411CBJN.meta_raw
-412 thaNOG.ENOG411CC78.meta_raw
-413 thaNOG.ENOG411CBPK.meta_raw
-414 thaNOG.ENOG411CBZ0.meta_raw
-415 thaNOG.ENOG411CB5C.meta_raw
-416 thaNOG.ENOG411CBW7.meta_raw
-417 thaNOG.ENOG411CC65.meta_raw
-418 thaNOG.ENOG411CB30.meta_raw
-419 thaNOG.ENOG411CB4K.meta_raw
-420 thaNOG.ENOG411CBKQ.meta_raw
-421 thaNOG.ENOG411CBXE.meta_raw
-422 thaNOG.ENOG411CBNG.meta_raw
-423 thaNOG.ENOG411CBTC.meta_raw
-424 thaNOG.ENOG411CBPQ.meta_raw
-425 thaNOG.ENOG411CBR8.meta_raw
-426 thaNOG.ENOG411CC2K.meta_raw
-427 thaNOG.ENOG411CB8E.meta_raw
-428 thaNOG.ENOG411CC9W.meta_raw
-429 thaNOG.ENOG411CC0Y.meta_raw
-430 thaNOG.ENOG411CB8Q.meta_raw
-431 thaNOG.ENOG411CBMP.meta_raw
-432 thaNOG.ENOG411CBKD.meta_raw
-433 thaNOG.ENOG411CBZB.meta_raw
-434 thaNOG.ENOG411CBVU.meta_raw
-435 thaNOG.ENOG411CBJ6.meta_raw
-436 thaNOG.ENOG411CBYQ.meta_raw
-437 thaNOG.ENOG411CB8C.meta_raw
-438 thaNOG.ENOG411CBXS.meta_raw
-439 thaNOG.ENOG411CC11.meta_raw
-440 thaNOG.ENOG411CB6H.meta_raw
-441 thaNOG.ENOG411CB4N.meta_raw
-442 thaNOG.ENOG411CBIF.meta_raw
-443 thaNOG.ENOG411CC04.meta_raw
-444 thaNOG.ENOG411CC2Q.meta_raw
-445 thaNOG.ENOG411CBN7.meta_raw
-446 thaNOG.ENOG411CBVB.meta_raw
-447 thaNOG.ENOG411CCA9.meta_raw
-448 thaNOG.ENOG411CBXV.meta_raw
-449 thaNOG.ENOG411CBKF.meta_raw
-450 thaNOG.ENOG411CC9U.meta_raw
-451 thaNOG.ENOG411CBKS.meta_raw
-452 thaNOG.ENOG411CB5B.meta_raw
-453 thaNOG.ENOG411CBGY.meta_raw
-454 thaNOG.ENOG411CC1I.meta_raw
-455 thaNOG.ENOG411CBEJ.meta_raw
-456 thaNOG.ENOG411CBJ8.meta_raw
-457 thaNOG.ENOG411CBQS.meta_raw
-458 thaNOG.ENOG411CB8V.meta_raw
-459 thaNOG.ENOG411CBEG.meta_raw
-460 thaNOG.ENOG411CB4Z.meta_raw
-461 thaNOG.ENOG411CBIE.meta_raw
-462 thaNOG.ENOG411CBXN.meta_raw
-463 thaNOG.ENOG411CC45.meta_raw
-464 thaNOG.ENOG411CBWA.meta_raw
-465 thaNOG.ENOG411CBDS.meta_raw
-466 thaNOG.ENOG411CC60.meta_raw
-467 thaNOG.ENOG411CBGK.meta_raw
-468 thaNOG.ENOG411CC4C.meta_raw
-469 thaNOG.ENOG411CBSM.meta_raw
-470 thaNOG.ENOG411CC1A.meta_raw
-471 thaNOG.ENOG411CB9C.meta_raw
-472 thaNOG.ENOG411CC3Z.meta_raw
-473 thaNOG.ENOG411CC6P.meta_raw
-474 thaNOG.ENOG411CC7T.meta_raw
-475 thaNOG.ENOG411CBH7.meta_raw
-476 thaNOG.ENOG411CB6I.meta_raw
-477 thaNOG.ENOG411CC2M.meta_raw
-478 thaNOG.ENOG411CC81.meta_raw
-479 thaNOG.ENOG411CB9Z.meta_raw
-480 thaNOG.ENOG411CBXC.meta_raw
-481 thaNOG.ENOG411CBMI.meta_raw
-482 thaNOG.ENOG411CBM4.meta_raw
-483 thaNOG.ENOG411CC2J.meta_raw
-484 thaNOG.ENOG411CBVI.meta_raw
-485 thaNOG.ENOG411CBEU.meta_raw
-486 thaNOG.ENOG411CB6G.meta_raw
-487 thaNOG.ENOG411CC3X.meta_raw
-488 thaNOG.ENOG411CC1N.meta_raw
-489 thaNOG.ENOG411CBIB.meta_raw
-490 thaNOG.ENOG411CBYE.meta_raw
-491 thaNOG.ENOG411CBKP.meta_raw
-492 thaNOG.ENOG411CB6P.meta_raw
-493 thaNOG.ENOG411CC6U.meta_raw
-494 thaNOG.ENOG411CCAJ.meta_raw
-495 thaNOG.ENOG411CC52.meta_raw
-496 thaNOG.ENOG411CBDU.meta_raw
-497 thaNOG.ENOG411CC6Y.meta_raw
-498 thaNOG.ENOG411CB6M.meta_raw
-499 thaNOG.ENOG411CBVJ.meta_raw
-500 thaNOG.ENOG411CBHX.meta_raw
-501 thaNOG.ENOG411CBJD.meta_raw
-502 thaNOG.ENOG411CBPB.meta_raw
-503 thaNOG.ENOG411CC9K.meta_raw
-504 thaNOG.ENOG411CC21.meta_raw
-505 thaNOG.ENOG411CBSD.meta_raw
-506 thaNOG.ENOG411CBHH.meta_raw
-507 thaNOG.ENOG411CBJR.meta_raw
-508 thaNOG.ENOG411CBB1.meta_raw
-509 thaNOG.ENOG411CC4T.meta_raw
-510 thaNOG.ENOG411CBFZ.meta_raw
-511 thaNOG.ENOG411CC76.meta_raw
-512 thaNOG.ENOG411CC57.meta_raw
-513 thaNOG.ENOG411CC8U.meta_raw
-514 thaNOG.ENOG411CC5B.meta_raw
-515 thaNOG.ENOG411CBTY.meta_raw
-516 thaNOG.ENOG411CBJG.meta_raw
-517 thaNOG.ENOG411CBZY.meta_raw
-518 thaNOG.ENOG411CBCD.meta_raw
-519 thaNOG.ENOG411CC1Q.meta_raw
-520 thaNOG.ENOG411CB99.meta_raw
-521 thaNOG.ENOG411CBJ1.meta_raw
-522 thaNOG.ENOG411CBD5.meta_raw
-523 thaNOG.ENOG411CB3V.meta_raw
-524 thaNOG.ENOG411CC55.meta_raw
-525 thaNOG.ENOG411CBXD.meta_raw
-526 thaNOG.ENOG411CBJF.meta_raw
-527 thaNOG.ENOG411CB5D.meta_raw
-528 thaNOG.ENOG411CBVG.meta_raw
-529 thaNOG.ENOG411CBV6.meta_raw
-530 thaNOG.ENOG411CBFP.meta_raw
-531 thaNOG.ENOG411CB3M.meta_raw
-532 thaNOG.ENOG411CBUV.meta_raw
-533 thaNOG.ENOG411CC9Y.meta_raw
-534 thaNOG.ENOG411CBUK.meta_raw
-535 thaNOG.ENOG411CBS8.meta_raw
-536 thaNOG.ENOG411CBRE.meta_raw
-537 thaNOG.ENOG411CC5D.meta_raw
-538 thaNOG.ENOG411CBSW.meta_raw
-539 thaNOG.ENOG411CBST.meta_raw
-540 thaNOG.ENOG411CBXZ.meta_raw
-541 thaNOG.ENOG411CBK4.meta_raw
-542 thaNOG.ENOG411CC4S.meta_raw
-543 thaNOG.ENOG411CB4J.meta_raw
-544 thaNOG.ENOG411CBAZ.meta_raw
-545 thaNOG.ENOG411CBI1.meta_raw
-546 thaNOG.ENOG411CBBN.meta_raw
-547 thaNOG.ENOG411CBPF.meta_raw
-548 thaNOG.ENOG411CBMD.meta_raw
-549 thaNOG.ENOG411CB38.meta_raw
-550 thaNOG.ENOG411CBVQ.meta_raw
-551 thaNOG.ENOG411CBNN.meta_raw
-552 thaNOG.ENOG411CC22.meta_raw
-553 thaNOG.ENOG411CBGM.meta_raw
-554 thaNOG.ENOG411CBUZ.meta_raw
-555 thaNOG.ENOG411CBR5.meta_raw
-556 thaNOG.ENOG411CC3Q.meta_raw
-557 thaNOG.ENOG411CBRF.meta_raw
-558 thaNOG.ENOG411CB63.meta_raw
-559 thaNOG.ENOG411CBUS.meta_raw
-560 thaNOG.ENOG411CC8K.meta_raw
-561 thaNOG.ENOG411CBKX.meta_raw
-562 thaNOG.ENOG411CBPT.meta_raw
-563 thaNOG.ENOG411CB67.meta_raw
-564 thaNOG.ENOG411CBV5.meta_raw
-565 thaNOG.ENOG411CC98.meta_raw
-566 thaNOG.ENOG411CBM9.meta_raw
-567 thaNOG.ENOG411CC6E.meta_raw
-568 thaNOG.ENOG411CBWZ.meta_raw
-569 thaNOG.ENOG411CBTX.meta_raw
-570 thaNOG.ENOG411CC67.meta_raw
-571 thaNOG.ENOG411CB94.meta_raw
-572 thaNOG.ENOG411CB7I.meta_raw
-573 thaNOG.ENOG411CB3D.meta_raw
-574 thaNOG.ENOG411CCB0.meta_raw
-575 thaNOG.ENOG411CB76.meta_raw
-576 thaNOG.ENOG411CBHM.meta_raw
-577 thaNOG.ENOG411CB7N.meta_raw
-578 thaNOG.ENOG411CC86.meta_raw
-579 thaNOG.ENOG411CBKB.meta_raw
-580 thaNOG.ENOG411CB2W.meta_raw
-581 thaNOG.ENOG411CBEI.meta_raw
-582 thaNOG.ENOG411CC74.meta_raw
-583 thaNOG.ENOG411CB5F.meta_raw
-584 thaNOG.ENOG411CC10.meta_raw
-585 thaNOG.ENOG411CB32.meta_raw
-586 thaNOG.ENOG411CBC1.meta_raw
-587 thaNOG.ENOG411CBY8.meta_raw
-588 thaNOG.ENOG411CB9V.meta_raw
-589 thaNOG.ENOG411CBB5.meta_raw
-590 thaNOG.ENOG411CC2R.meta_raw
-591 thaNOG.ENOG411CC59.meta_raw
-592 thaNOG.ENOG411CB5P.meta_raw
-593 thaNOG.ENOG411CC0A.meta_raw
-594 thaNOG.ENOG411CBGR.meta_raw
-595 thaNOG.ENOG411CBU8.meta_raw
-596 thaNOG.ENOG411CBQR.meta_raw
-597 thaNOG.ENOG411CB2Y.meta_raw
-598 thaNOG.ENOG411CBZR.meta_raw
-599 thaNOG.ENOG411CB7C.meta_raw
-600 thaNOG.ENOG411CBGB.meta_raw
-601 thaNOG.ENOG411CBY3.meta_raw
-602 thaNOG.ENOG411CBWN.meta_raw
-603 thaNOG.ENOG411CB9G.meta_raw
-604 thaNOG.ENOG411CBWT.meta_raw
-605 thaNOG.ENOG411CB4M.meta_raw
-606 thaNOG.ENOG411CBQK.meta_raw
-607 thaNOG.ENOG411CBQF.meta_raw
-608 thaNOG.ENOG411CBPD.meta_raw
-609 thaNOG.ENOG411CC0V.meta_raw
-610 thaNOG.ENOG411CBPU.meta_raw
-611 thaNOG.ENOG411CB2I.meta_raw
-612 thaNOG.ENOG411CBVT.meta_raw
-613 thaNOG.ENOG411CB64.meta_raw
-614 thaNOG.ENOG411CCAX.meta_raw
-615 thaNOG.ENOG411CCA6.meta_raw
-616 thaNOG.ENOG411CBZD.meta_raw
-617 thaNOG.ENOG411CBNE.meta_raw
-618 thaNOG.ENOG411CC25.meta_raw
-619 thaNOG.ENOG411CBSA.meta_raw
-620 thaNOG.ENOG411CC9Q.meta_raw
-621 thaNOG.ENOG411CBQU.meta_raw
-622 thaNOG.ENOG411CBU0.meta_raw
-623 thaNOG.ENOG411CBZF.meta_raw
-624 thaNOG.ENOG411CBR9.meta_raw
-625 thaNOG.ENOG411CC62.meta_raw
-626 thaNOG.ENOG411CBJ4.meta_raw
-627 thaNOG.ENOG411CC94.meta_raw
-628 thaNOG.ENOG411CB9I.meta_raw
-629 thaNOG.ENOG411CB4V.meta_raw
-630 thaNOG.ENOG411CBWK.meta_raw
-631 thaNOG.ENOG411CB7X.meta_raw
-632 thaNOG.ENOG411CC7H.meta_raw
-633 thaNOG.ENOG411CC95.meta_raw
-634 thaNOG.ENOG411CC9H.meta_raw
-635 thaNOG.ENOG411CCAV.meta_raw
-636 thaNOG.ENOG411CC7Y.meta_raw
-637 thaNOG.ENOG411CB2Q.meta_raw
-638 thaNOG.ENOG411CBUD.meta_raw
-639 thaNOG.ENOG411CBSB.meta_raw
-640 thaNOG.ENOG411CBIW.meta_raw
-641 thaNOG.ENOG411CC1V.meta_raw
-642 thaNOG.ENOG411CC7E.meta_raw
-643 thaNOG.ENOG411CB2K.meta_raw
-644 thaNOG.ENOG411CB5M.meta_raw
-645 thaNOG.ENOG411CB4U.meta_raw
-646 thaNOG.ENOG411CBI8.meta_raw
-647 thaNOG.ENOG411CBH5.meta_raw
-648 thaNOG.ENOG411CBGP.meta_raw
-649 thaNOG.ENOG411CBB0.meta_raw
-650 thaNOG.ENOG411CC71.meta_raw
-651 thaNOG.ENOG411CB8U.meta_raw
-652 thaNOG.ENOG411CBGC.meta_raw
-653 thaNOG.ENOG411CBH6.meta_raw
-654 thaNOG.ENOG411CBJY.meta_raw
-655 thaNOG.ENOG411CB7B.meta_raw
-656 thaNOG.ENOG411CC27.meta_raw
-657 thaNOG.ENOG411CBJU.meta_raw
-658 thaNOG.ENOG411CC4I.meta_raw
-659 thaNOG.ENOG411CBWC.meta_raw
-660 thaNOG.ENOG411CBPE.meta_raw
-661 thaNOG.ENOG411CBE2.meta_raw
-662 thaNOG.ENOG411CBBM.meta_raw
-663 thaNOG.ENOG411CBDB.meta_raw
-664 thaNOG.ENOG411CB5W.meta_raw
-665 thaNOG.ENOG411CC0T.meta_raw
-666 thaNOG.ENOG411CBFH.meta_raw
-667 thaNOG.ENOG411CB58.meta_raw
-668 thaNOG.ENOG411CBF6.meta_raw
-669 thaNOG.ENOG411CBUN.meta_raw
-670 thaNOG.ENOG411CBD0.meta_raw
-671 thaNOG.ENOG411CBG8.meta_raw
-672 thaNOG.ENOG411CBAU.meta_raw
-673 thaNOG.ENOG411CBTD.meta_raw
-674 thaNOG.ENOG411CBI2.meta_raw
-675 thaNOG.ENOG411CC5X.meta_raw
-676 thaNOG.ENOG411CBHZ.meta_raw
-677 thaNOG.ENOG411CBME.meta_raw
-678 thaNOG.ENOG411CB3X.meta_raw
-679 thaNOG.ENOG411CC13.meta_raw
-680 thaNOG.ENOG411CBUB.meta_raw
-681 thaNOG.ENOG411CCAY.meta_raw
-682 thaNOG.ENOG411CBNC.meta_raw
-683 thaNOG.ENOG411CBDI.meta_raw
-684 thaNOG.ENOG411CBIV.meta_raw
-685 thaNOG.ENOG411CBBC.meta_raw
-686 thaNOG.ENOG411CB5R.meta_raw
-687 thaNOG.ENOG411CBMG.meta_raw
-688 thaNOG.ENOG411CBG9.meta_raw
-689 thaNOG.ENOG411CB6J.meta_raw
-690 thaNOG.ENOG411CBK0.meta_raw
-691 thaNOG.ENOG411CBT7.meta_raw
-692 thaNOG.ENOG411CBIM.meta_raw
-693 thaNOG.ENOG411CBS0.meta_raw
-694 thaNOG.ENOG411CBA4.meta_raw
-695 thaNOG.ENOG411CBE6.meta_raw
-696 thaNOG.ENOG411CBFM.meta_raw
-697 thaNOG.ENOG411CC0G.meta_raw
-698 thaNOG.ENOG411CBNT.meta_raw
-699 thaNOG.ENOG411CC7V.meta_raw
-700 thaNOG.ENOG411CC4Z.meta_raw
-701 thaNOG.ENOG411CC5H.meta_raw
-702 thaNOG.ENOG411CC3A.meta_raw
-703 thaNOG.ENOG411CBII.meta_raw
-704 thaNOG.ENOG411CBM3.meta_raw
-705 thaNOG.ENOG411CBV4.meta_raw
-706 thaNOG.ENOG411CC20.meta_raw
-707 thaNOG.ENOG411CBX3.meta_raw
-708 thaNOG.ENOG411CB3U.meta_raw
-709 thaNOG.ENOG411CBND.meta_raw
-710 thaNOG.ENOG411CC8R.meta_raw
-711 thaNOG.ENOG411CB2D.meta_raw
-712 thaNOG.ENOG411CC70.meta_raw
-713 thaNOG.ENOG411CC2V.meta_raw
-714 thaNOG.ENOG411CBZ8.meta_raw
-715 thaNOG.ENOG411CB79.meta_raw
-716 thaNOG.ENOG411CB3W.meta_raw
-717 thaNOG.ENOG411CBW0.meta_raw
-718 thaNOG.ENOG411CBB4.meta_raw
-719 thaNOG.ENOG411CBF3.meta_raw
-720 thaNOG.ENOG411CC6B.meta_raw
-721 thaNOG.ENOG411CBKY.meta_raw
-722 thaNOG.ENOG411CBWR.meta_raw
-723 thaNOG.ENOG411CC7P.meta_raw
-724 thaNOG.ENOG411CBPH.meta_raw
-725 thaNOG.ENOG411CBP6.meta_raw
-726 thaNOG.ENOG411CBJ2.meta_raw
-727 thaNOG.ENOG411CBE7.meta_raw
-728 thaNOG.ENOG411CBDQ.meta_raw
-729 thaNOG.ENOG411CC0U.meta_raw
-730 thaNOG.ENOG411CBHQ.meta_raw
-731 thaNOG.ENOG411CB65.meta_raw
-732 thaNOG.ENOG411CBTP.meta_raw
-733 thaNOG.ENOG411CB53.meta_raw
-734 thaNOG.ENOG411CB83.meta_raw
-735 thaNOG.ENOG411CC19.meta_raw
-736 thaNOG.ENOG411CBPN.meta_raw
-737 thaNOG.ENOG411CBX4.meta_raw
-738 thaNOG.ENOG411CBC7.meta_raw
-739 thaNOG.ENOG411CC75.meta_raw
-740 thaNOG.ENOG411CBE0.meta_raw
-741 thaNOG.ENOG411CCB7.meta_raw
-742 thaNOG.ENOG411CBK2.meta_raw
-743 thaNOG.ENOG411CBQB.meta_raw
-744 thaNOG.ENOG411CBGF.meta_raw
-745 thaNOG.ENOG411CB4X.meta_raw
-746 thaNOG.ENOG411CBC8.meta_raw
-747 thaNOG.ENOG411CC56.meta_raw
-748 thaNOG.ENOG411CBQX.meta_raw
-749 thaNOG.ENOG411CBBF.meta_raw
-750 thaNOG.ENOG411CB5Z.meta_raw
-751 thaNOG.ENOG411CBR6.meta_raw
-752 thaNOG.ENOG411CBZS.meta_raw
-753 thaNOG.ENOG411CBHD.meta_raw
-754 thaNOG.ENOG411CBGG.meta_raw
-755 thaNOG.ENOG411CBT4.meta_raw
-756 thaNOG.ENOG411CB2S.meta_raw
-757 thaNOG.ENOG411CBS3.meta_raw
-758 thaNOG.ENOG411CC6W.meta_raw
-759 thaNOG.ENOG411CBSK.meta_raw
-760 thaNOG.ENOG411CCAB.meta_raw
-761 thaNOG.ENOG411CBUP.meta_raw
-762 thaNOG.ENOG411CB7G.meta_raw
-763 thaNOG.ENOG411CC2Y.meta_raw
-764 thaNOG.ENOG411CBJZ.meta_raw
-765 thaNOG.ENOG411CBBA.meta_raw
-766 thaNOG.ENOG411CC42.meta_raw
-767 thaNOG.ENOG411CBYV.meta_raw
-768 thaNOG.ENOG411CBCI.meta_raw
-769 thaNOG.ENOG411CB50.meta_raw
-770 thaNOG.ENOG411CC8Y.meta_raw
-771 thaNOG.ENOG411CBG6.meta_raw
-772 thaNOG.ENOG411CBSR.meta_raw
-773 thaNOG.ENOG411CBBT.meta_raw
-774 thaNOG.ENOG411CBAH.meta_raw
-775 thaNOG.ENOG411CBIT.meta_raw
-776 thaNOG.ENOG411CBXI.meta_raw
-777 thaNOG.ENOG411CC1B.meta_raw
-778 thaNOG.ENOG411CB2G.meta_raw
-779 thaNOG.ENOG411CC18.meta_raw
-780 thaNOG.ENOG411CBEY.meta_raw
-781 thaNOG.ENOG411CBMR.meta_raw
-782 thaNOG.ENOG411CBR4.meta_raw
-783 thaNOG.ENOG411CCA5.meta_raw
-784 thaNOG.ENOG411CBRT.meta_raw
-785 thaNOG.ENOG411CC5G.meta_raw
-786 thaNOG.ENOG411CC2X.meta_raw
-787 thaNOG.ENOG411CBXG.meta_raw
-788 thaNOG.ENOG411CBSG.meta_raw
-789 thaNOG.ENOG411CC7B.meta_raw
-790 thaNOG.ENOG411CBI5.meta_raw
-791 thaNOG.ENOG411CBRA.meta_raw
-792 thaNOG.ENOG411CBYJ.meta_raw
-793 thaNOG.ENOG411CBUH.meta_raw
-794 thaNOG.ENOG411CBBQ.meta_raw
-795 thaNOG.ENOG411CBH1.meta_raw
-796 thaNOG.ENOG411CC8S.meta_raw
-797 thaNOG.ENOG411CBVE.meta_raw
-798 thaNOG.ENOG411CCAZ.meta_raw
-799 thaNOG.ENOG411CB61.meta_raw
-800 thaNOG.ENOG411CB91.meta_raw
-801 thaNOG.ENOG411CBY5.meta_raw
-802 thaNOG.ENOG411CCA1.meta_raw
-803 thaNOG.ENOG411CBX5.meta_raw
-804 thaNOG.ENOG411CC09.meta_raw
-805 thaNOG.ENOG411CB93.meta_raw
-806 thaNOG.ENOG411CBYD.meta_raw
-807 thaNOG.ENOG411CCAI.meta_raw
-808 thaNOG.ENOG411CBD4.meta_raw
-809 thaNOG.ENOG411CBHW.meta_raw
-810 thaNOG.ENOG411CBGH.meta_raw
-811 thaNOG.ENOG411CBTM.meta_raw
-812 thaNOG.ENOG411CBHV.meta_raw
-813 thaNOG.ENOG411CBSH.meta_raw
-814 thaNOG.ENOG411CBDY.meta_raw
-815 thaNOG.ENOG411CB5J.meta_raw
-816 thaNOG.ENOG411CC1F.meta_raw
-817 thaNOG.ENOG411CBCS.meta_raw
-818 thaNOG.ENOG411CC7Z.meta_raw
-819 thaNOG.ENOG411CBVN.meta_raw
-820 thaNOG.ENOG411CBY6.meta_raw
-821 thaNOG.ENOG411CC0H.meta_raw
-822 thaNOG.ENOG411CBRR.meta_raw
-823 thaNOG.ENOG411CBKV.meta_raw
-824 thaNOG.ENOG411CB5V.meta_raw
-825 thaNOG.ENOG411CCB1.meta_raw
-826 thaNOG.ENOG411CC4U.meta_raw
-827 thaNOG.ENOG411CCB3.meta_raw
-828 thaNOG.ENOG411CC6A.meta_raw
-829 thaNOG.ENOG411CBM2.meta_raw
-830 thaNOG.ENOG411CBUA.meta_raw
-831 thaNOG.ENOG411CBPP.meta_raw
-832 thaNOG.ENOG411CB96.meta_raw
-833 thaNOG.ENOG411CBS9.meta_raw
-834 thaNOG.ENOG411CB5X.meta_raw
-835 thaNOG.ENOG411CBSY.meta_raw
-836 thaNOG.ENOG411CC9E.meta_raw
-837 thaNOG.ENOG411CB6E.meta_raw
-838 thaNOG.ENOG411CC5Z.meta_raw
-839 thaNOG.ENOG411CBUR.meta_raw
-840 thaNOG.ENOG411CBDR.meta_raw
-841 thaNOG.ENOG411CBA8.meta_raw
-842 thaNOG.ENOG411CBGA.meta_raw
-843 thaNOG.ENOG411CBDF.meta_raw
-844 thaNOG.ENOG411CBSX.meta_raw
-845 thaNOG.ENOG411CBW8.meta_raw
-846 thaNOG.ENOG411CC5Y.meta_raw
-847 thaNOG.ENOG411CB6A.meta_raw
-848 thaNOG.ENOG411CBY2.meta_raw
-849 thaNOG.ENOG411CB4C.meta_raw
-850 thaNOG.ENOG411CBQ9.meta_raw
-851 thaNOG.ENOG411CBD8.meta_raw
-852 thaNOG.ENOG411CB4B.meta_raw
-853 thaNOG.ENOG411CBPC.meta_raw
-854 thaNOG.ENOG411CB31.meta_raw
-855 thaNOG.ENOG411CB6V.meta_raw
-856 thaNOG.ENOG411CBVS.meta_raw
-857 thaNOG.ENOG411CBUG.meta_raw
-858 thaNOG.ENOG411CC66.meta_raw
-859 thaNOG.ENOG411CC68.meta_raw
-860 thaNOG.ENOG411CC7C.meta_raw
-861 thaNOG.ENOG411CC14.meta_raw
-862 thaNOG.ENOG411CBXA.meta_raw
-863 thaNOG.ENOG411CC8N.meta_raw
-864 thaNOG.ENOG411CC6F.meta_raw
-865 thaNOG.ENOG411CBYX.meta_raw
-866 thaNOG.ENOG411CCA0.meta_raw
-867 thaNOG.ENOG411CB6D.meta_raw
-868 thaNOG.ENOG411CC85.meta_raw
-869 thaNOG.ENOG411CBAG.meta_raw
-870 thaNOG.ENOG411CBQ8.meta_raw
-871 thaNOG.ENOG411CC4E.meta_raw
-872 thaNOG.ENOG411CCB9.meta_raw
-873 thaNOG.ENOG411CC0K.meta_raw
-874 thaNOG.ENOG411CBZT.meta_raw
-875 thaNOG.ENOG411CBUU.meta_raw
-876 thaNOG.ENOG411CCAA.meta_raw
-877 thaNOG.ENOG411CC2W.meta_raw
-878 thaNOG.ENOG411CBU6.meta_raw
-879 thaNOG.ENOG411CB45.meta_raw
-880 thaNOG.ENOG411CBFA.meta_raw
-881 thaNOG.ENOG411CBQP.meta_raw
-882 thaNOG.ENOG411CB3A.meta_raw
-883 thaNOG.ENOG411CBWI.meta_raw
-884 thaNOG.ENOG411CBRJ.meta_raw
-885 thaNOG.ENOG411CBD9.meta_raw
-886 thaNOG.ENOG411CBNS.meta_raw
-887 thaNOG.ENOG411CBPV.meta_raw
-888 thaNOG.ENOG411CC31.meta_raw
-889 thaNOG.ENOG411CBAW.meta_raw
-890 thaNOG.ENOG411CBKZ.meta_raw
-891 thaNOG.ENOG411CB8N.meta_raw
-892 thaNOG.ENOG411CBRW.meta_raw
-893 thaNOG.ENOG411CBK3.meta_raw
-894 thaNOG.ENOG411CC7N.meta_raw
-895 thaNOG.ENOG411CBR0.meta_raw
-896 thaNOG.ENOG411CBV9.meta_raw
-897 thaNOG.ENOG411CBJA.meta_raw
-898 thaNOG.ENOG411CC0N.meta_raw
-899 thaNOG.ENOG411CBFT.meta_raw
-900 thaNOG.ENOG411CBC3.meta_raw
-901 thaNOG.ENOG411CB3F.meta_raw
-902 thaNOG.ENOG411CB6B.meta_raw
-903 thaNOG.ENOG411CBBX.meta_raw
-904 thaNOG.ENOG411CC7Q.meta_raw
-905 thaNOG.ENOG411CCAK.meta_raw
-906 thaNOG.ENOG411CB7K.meta_raw
-907 thaNOG.ENOG411CB4S.meta_raw
-908 thaNOG.ENOG411CBZA.meta_raw
-909 thaNOG.ENOG411CB9M.meta_raw
-910 thaNOG.ENOG411CBG5.meta_raw
-911 thaNOG.ENOG411CB62.meta_raw
-912 thaNOG.ENOG411CBSQ.meta_raw
-913 thaNOG.ENOG411CBGI.meta_raw
-914 thaNOG.ENOG411CC4A.meta_raw
-915 thaNOG.ENOG411CC79.meta_raw
-916 thaNOG.ENOG411CB7S.meta_raw
-917 thaNOG.ENOG411CBF9.meta_raw
-918 thaNOG.ENOG411CB3T.meta_raw
-919 thaNOG.ENOG411CBF7.meta_raw
-920 thaNOG.ENOG411CBBV.meta_raw
-921 thaNOG.ENOG411CB85.meta_raw
-922 thaNOG.ENOG411CC9X.meta_raw
-923 thaNOG.ENOG411CC32.meta_raw
-924 thaNOG.ENOG411CC49.meta_raw
-925 thaNOG.ENOG411CCA7.meta_raw
-926 thaNOG.ENOG411CBT5.meta_raw
-927 thaNOG.ENOG411CC8D.meta_raw
-928 thaNOG.ENOG411CBVA.meta_raw
-929 thaNOG.ENOG411CBCJ.meta_raw
-930 thaNOG.ENOG411CC3G.meta_raw
-931 thaNOG.ENOG411CB9N.meta_raw
-932 thaNOG.ENOG411CC80.meta_raw
-933 thaNOG.ENOG411CC5C.meta_raw
-934 thaNOG.ENOG411CB5G.meta_raw
-935 thaNOG.ENOG411CB3E.meta_raw
-936 thaNOG.ENOG411CBP9.meta_raw
-937 thaNOG.ENOG411CBWP.meta_raw
-938 thaNOG.ENOG411CB8Z.meta_raw
-939 thaNOG.ENOG411CC1X.meta_raw
-940 thaNOG.ENOG411CC12.meta_raw
-941 thaNOG.ENOG411CBS6.meta_raw
-942 thaNOG.ENOG411CBCW.meta_raw
-943 thaNOG.ENOG411CBTE.meta_raw
-944 thaNOG.ENOG411CBJK.meta_raw
-945 thaNOG.ENOG411CBRU.meta_raw
-946 thaNOG.ENOG411CB3Q.meta_raw
-947 thaNOG.ENOG411CC1Y.meta_raw
-948 thaNOG.ENOG411CB52.meta_raw
-949 thaNOG.ENOG411CC6V.meta_raw
-950 thaNOG.ENOG411CB2Z.meta_raw
-951 thaNOG.ENOG411CBFE.meta_raw
-952 thaNOG.ENOG411CB72.meta_raw
-953 thaNOG.ENOG411CBCN.meta_raw
-954 thaNOG.ENOG411CB48.meta_raw
-955 thaNOG.ENOG411CB6Z.meta_raw
-956 thaNOG.ENOG411CBQM.meta_raw
-957 thaNOG.ENOG411CB7H.meta_raw
-958 thaNOG.ENOG411CBFW.meta_raw
-959 thaNOG.ENOG411CBWJ.meta_raw
-960 thaNOG.ENOG411CBCG.meta_raw
-961 thaNOG.ENOG411CBAF.meta_raw
-962 thaNOG.ENOG411CB57.meta_raw
-963 thaNOG.ENOG411CC61.meta_raw
-964 thaNOG.ENOG411CBF4.meta_raw
-965 thaNOG.ENOG411CBBE.meta_raw
-966 thaNOG.ENOG411CC2S.meta_raw
-967 thaNOG.ENOG411CBT0.meta_raw
-968 thaNOG.ENOG411CBDD.meta_raw
-969 thaNOG.ENOG411CBHG.meta_raw
-970 thaNOG.ENOG411CBTR.meta_raw
-971 thaNOG.ENOG411CBM0.meta_raw
-972 thaNOG.ENOG411CBYK.meta_raw
-973 thaNOG.ENOG411CB3K.meta_raw
-974 thaNOG.ENOG411CBYS.meta_raw
-975 thaNOG.ENOG411CBMF.meta_raw
-976 thaNOG.ENOG411CBZM.meta_raw
-977 thaNOG.ENOG411CBR2.meta_raw
-978 thaNOG.ENOG411CBEF.meta_raw
-979 thaNOG.ENOG411CBZ7.meta_raw
-980 thaNOG.ENOG411CBV0.meta_raw
-981 thaNOG.ENOG411CC3E.meta_raw
-982 thaNOG.ENOG411CC90.meta_raw
-983 thaNOG.ENOG411CC84.meta_raw
-984 thaNOG.ENOG411CB9B.meta_raw
-985 thaNOG.ENOG411CBCQ.meta_raw
-986 thaNOG.ENOG411CBIY.meta_raw
-987 thaNOG.ENOG411CBCK.meta_raw
-988 thaNOG.ENOG411CBEA.meta_raw
-989 thaNOG.ENOG411CBQC.meta_raw
-990 thaNOG.ENOG411CC6N.meta_raw
-991 thaNOG.ENOG411CB33.meta_raw
-992 thaNOG.ENOG411CC1R.meta_raw
-993 thaNOG.ENOG411CBN9.meta_raw
-994 thaNOG.ENOG411CBPI.meta_raw
-995 thaNOG.ENOG411CBEN.meta_raw
-996 thaNOG.ENOG411CBRK.meta_raw
-997 thaNOG.ENOG411CBFY.meta_raw
-998 thaNOG.ENOG411CBVP.meta_raw
-999 thaNOG.ENOG411CC0I.meta_raw
-1000 thaNOG.ENOG411CC7M.meta_raw
-1001 thaNOG.ENOG411CBGN.meta_raw
-1002 thaNOG.ENOG411CB59.meta_raw
-1003 thaNOG.ENOG411CC2P.meta_raw
-1004 thaNOG.ENOG411CC6D.meta_raw
-1005 thaNOG.ENOG411CC1U.meta_raw
-1006 thaNOG.ENOG411CC6R.meta_raw
-1007 thaNOG.ENOG411CBDN.meta_raw
-1008 thaNOG.ENOG411CBHY.meta_raw
-1009 thaNOG.ENOG411CBU2.meta_raw
-1010 thaNOG.ENOG411CC5P.meta_raw
-1011 thaNOG.ENOG411CB5A.meta_raw
-1012 thaNOG.ENOG411CBU7.meta_raw
-1013 thaNOG.ENOG411CC41.meta_raw
-1014 thaNOG.ENOG411CBA3.meta_raw
-1015 thaNOG.ENOG411CC8M.meta_raw
-1016 thaNOG.ENOG411CBXM.meta_raw
-1017 thaNOG.ENOG411CC9M.meta_raw
-1018 thaNOG.ENOG411CB8K.meta_raw
-1019 thaNOG.ENOG411CB39.meta_raw
-1020 thaNOG.ENOG411CB8R.meta_raw
-1021 thaNOG.ENOG411CBU9.meta_raw
-1022 thaNOG.ENOG411CBCF.meta_raw
-1023 thaNOG.ENOG411CBTZ.meta_raw
-1024 thaNOG.ENOG411CBYZ.meta_raw
-1025 thaNOG.ENOG411CBGE.meta_raw
-1026 thaNOG.ENOG411CC1C.meta_raw
-1027 thaNOG.ENOG411CB7E.meta_raw
-1028 thaNOG.ENOG411CBDP.meta_raw
-1029 thaNOG.ENOG411CBB6.meta_raw
-1030 thaNOG.ENOG411CC93.meta_raw
-1031 thaNOG.ENOG411CBFQ.meta_raw
-1032 thaNOG.ENOG411CC9T.meta_raw
-1033 thaNOG.ENOG411CCAF.meta_raw
-1034 thaNOG.ENOG411CC3M.meta_raw
-1035 thaNOG.ENOG411CB9F.meta_raw
-1036 thaNOG.ENOG411CBI9.meta_raw
-1037 thaNOG.ENOG411CB7M.meta_raw
-1038 thaNOG.ENOG411CBAT.meta_raw
-1039 thaNOG.ENOG411CBZC.meta_raw
-1040 thaNOG.ENOG411CC0J.meta_raw
-1041 thaNOG.ENOG411CB3J.meta_raw
-1042 thaNOG.ENOG411CBAP.meta_raw
-1043 thaNOG.ENOG411CC6K.meta_raw
-1044 thaNOG.ENOG411CC36.meta_raw
-1045 thaNOG.ENOG411CCAP.meta_raw
-1046 thaNOG.ENOG411CBI4.meta_raw
-1047 thaNOG.ENOG411CC7S.meta_raw
-1048 thaNOG.ENOG411CB3Y.meta_raw
-1049 thaNOG.ENOG411CBE4.meta_raw
-1050 thaNOG.ENOG411CBWH.meta_raw
-1051 thaNOG.ENOG411CC2G.meta_raw
-1052 thaNOG.ENOG411CBWB.meta_raw
-1053 thaNOG.ENOG411CCAH.meta_raw
-1054 thaNOG.ENOG411CB5E.meta_raw
-1055 thaNOG.ENOG411CC9R.meta_raw
-1056 thaNOG.ENOG411CBCE.meta_raw
-1057 thaNOG.ENOG411CBT8.meta_raw
-1058 thaNOG.ENOG411CBZ9.meta_raw
-1059 thaNOG.ENOG411CC33.meta_raw
-1060 thaNOG.ENOG411CBN1.meta_raw
-1061 thaNOG.ENOG411CB6Y.meta_raw
-1062 thaNOG.ENOG411CC3K.meta_raw
-1063 thaNOG.ENOG411CB5I.meta_raw
-1064 thaNOG.ENOG411CC58.meta_raw
-1065 thaNOG.ENOG411CBF1.meta_raw
-1066 thaNOG.ENOG411CB3Z.meta_raw
-1067 thaNOG.ENOG411CC8Z.meta_raw
-1068 thaNOG.ENOG411CB80.meta_raw
-1069 thaNOG.ENOG411CB66.meta_raw
-1070 thaNOG.ENOG411CBD2.meta_raw
-1071 thaNOG.ENOG411CB2M.meta_raw
-1072 thaNOG.ENOG411CC7A.meta_raw
-1073 thaNOG.ENOG411CC38.meta_raw
-1074 thaNOG.ENOG411CBYB.meta_raw
-1075 thaNOG.ENOG411CB69.meta_raw
-1076 thaNOG.ENOG411CC1S.meta_raw
-1077 thaNOG.ENOG411CBIU.meta_raw
-1078 thaNOG.ENOG411CC6M.meta_raw
-1079 thaNOG.ENOG411CB9K.meta_raw
-1080 thaNOG.ENOG411CC4W.meta_raw
-1081 thaNOG.ENOG411CBHP.meta_raw
-1082 thaNOG.ENOG411CC6Q.meta_raw
-1083 thaNOG.ENOG411CB92.meta_raw
-1084 thaNOG.ENOG411CBFJ.meta_raw
-1085 thaNOG.ENOG411CBPW.meta_raw
-1086 thaNOG.ENOG411CBTF.meta_raw
-1087 thaNOG.ENOG411CBQI.meta_raw
-1088 thaNOG.ENOG411CBMQ.meta_raw
-1089 thaNOG.ENOG411CBMC.meta_raw
-1090 thaNOG.ENOG411CBW2.meta_raw
-1091 thaNOG.ENOG411CBAC.meta_raw
-1092 thaNOG.ENOG411CBKI.meta_raw
-1093 thaNOG.ENOG411CBAS.meta_raw
-1094 thaNOG.ENOG411CC39.meta_raw
-1095 thaNOG.ENOG411CC9B.meta_raw
-1096 thaNOG.ENOG411CBKM.meta_raw
-1097 thaNOG.ENOG411CBXP.meta_raw
-1098 thaNOG.ENOG411CBCX.meta_raw
-1099 thaNOG.ENOG411CBX0.meta_raw
-1100 thaNOG.ENOG411CBQ0.meta_raw
-1101 thaNOG.ENOG411CBKR.meta_raw
-1102 thaNOG.ENOG411CC2C.meta_raw
-1103 thaNOG.ENOG411CBYN.meta_raw
-1104 thaNOG.ENOG411CC54.meta_raw
-1105 thaNOG.ENOG411CB2C.meta_raw
-1106 thaNOG.ENOG411CC37.meta_raw
-1107 thaNOG.ENOG411CBJI.meta_raw
-1108 thaNOG.ENOG411CBW5.meta_raw
-1109 thaNOG.ENOG411CBVH.meta_raw
-1110 thaNOG.ENOG411CBM8.meta_raw
-1111 thaNOG.ENOG411CBEP.meta_raw
-1112 thaNOG.ENOG411CBED.meta_raw
-1113 thaNOG.ENOG411CB7F.meta_raw
-1114 thaNOG.ENOG411CCAN.meta_raw
-1115 thaNOG.ENOG411CBR7.meta_raw
-1116 thaNOG.ENOG411CBWV.meta_raw
-1117 thaNOG.ENOG411CC7K.meta_raw
-1118 thaNOG.ENOG411CBER.meta_raw
-1119 thaNOG.ENOG411CC3V.meta_raw
-1120 thaNOG.ENOG411CC6I.meta_raw
-1121 thaNOG.ENOG411CBQ6.meta_raw
-1122 thaNOG.ENOG411CBYT.meta_raw
-1123 thaNOG.ENOG411CC9C.meta_raw
-1124 thaNOG.ENOG411CBWM.meta_raw
-1125 thaNOG.ENOG411CBZG.meta_raw
-1126 thaNOG.ENOG411CBDM.meta_raw
-1127 thaNOG.ENOG411CBKG.meta_raw
-1128 thaNOG.ENOG411CBCP.meta_raw
-1129 thaNOG.ENOG411CB4P.meta_raw
-1130 thaNOG.ENOG411CC7J.meta_raw
-1131 thaNOG.ENOG411CBEB.meta_raw
-1132 thaNOG.ENOG411CC7G.meta_raw
-1133 thaNOG.ENOG411CC4K.meta_raw
-1134 thaNOG.ENOG411CBZI.meta_raw
-1135 thaNOG.ENOG411CBJB.meta_raw
-1136 thaNOG.ENOG411CBW3.meta_raw
-1137 thaNOG.ENOG411CBKE.meta_raw
-1138 thaNOG.ENOG411CBQW.meta_raw
-1139 thaNOG.ENOG411CB43.meta_raw
-1140 thaNOG.ENOG411CCAQ.meta_raw
-1141 thaNOG.ENOG411CB2A.meta_raw
-1142 thaNOG.ENOG411CBWU.meta_raw
-1143 thaNOG.ENOG411CB36.meta_raw
-1144 thaNOG.ENOG411CBRM.meta_raw
-1145 thaNOG.ENOG411CB70.meta_raw
-1146 thaNOG.ENOG411CB90.meta_raw
-1147 thaNOG.ENOG411CB41.meta_raw
-1148 thaNOG.ENOG411CC7I.meta_raw
-1149 thaNOG.ENOG411CBFV.meta_raw
-1150 thaNOG.ENOG411CBA7.meta_raw
-1151 thaNOG.ENOG411CB8W.meta_raw
-1152 thaNOG.ENOG411CC2T.meta_raw
-1153 thaNOG.ENOG411CC5I.meta_raw
-1154 thaNOG.ENOG411CBA1.meta_raw
-1155 thaNOG.ENOG411CB7P.meta_raw
-1156 thaNOG.ENOG411CC63.meta_raw
-1157 thaNOG.ENOG411CC7W.meta_raw
-1158 thaNOG.ENOG411CCAG.meta_raw
-1159 thaNOG.ENOG411CC0Z.meta_raw
-1160 thaNOG.ENOG411CBMH.meta_raw
-1161 thaNOG.ENOG411CC0W.meta_raw
-1162 thaNOG.ENOG411CBZX.meta_raw
-1163 thaNOG.ENOG411CBBP.meta_raw
-1164 thaNOG.ENOG411CB5H.meta_raw
-1165 thaNOG.ENOG411CC48.meta_raw
-1166 thaNOG.ENOG411CC1H.meta_raw
-1167 thaNOG.ENOG411CC1D.meta_raw
-1168 thaNOG.ENOG411CBYM.meta_raw
-1169 thaNOG.ENOG411CC1W.meta_raw
-1170 thaNOG.ENOG411CBXU.meta_raw
-1171 thaNOG.ENOG411CB2B.meta_raw
-1172 thaNOG.ENOG411CB35.meta_raw
-1173 thaNOG.ENOG411CC2N.meta_raw
-1174 thaNOG.ENOG411CBNJ.meta_raw
-1175 thaNOG.ENOG411CBUY.meta_raw
-1176 thaNOG.ENOG411CC2Z.meta_raw
-1177 thaNOG.ENOG411CBJ3.meta_raw
-1178 thaNOG.ENOG411CBIK.meta_raw
-1179 thaNOG.ENOG411CB3H.meta_raw
-1180 thaNOG.ENOG411CBFG.meta_raw
-1181 thaNOG.ENOG411CBIH.meta_raw
-1182 thaNOG.ENOG411CBYU.meta_raw
-1183 thaNOG.ENOG411CC15.meta_raw
-1184 thaNOG.ENOG411CB6F.meta_raw
-1185 thaNOG.ENOG411CBMZ.meta_raw
-1186 thaNOG.ENOG411CB54.meta_raw
-1187 thaNOG.ENOG411CB8I.meta_raw
-1188 thaNOG.ENOG411CC6H.meta_raw
-1189 thaNOG.ENOG411CBYA.meta_raw
-1190 thaNOG.ENOG411CBYY.meta_raw
-1191 thaNOG.ENOG411CC05.meta_raw
-1192 thaNOG.ENOG411CBX2.meta_raw
-1193 thaNOG.ENOG411CC3J.meta_raw
-1194 thaNOG.ENOG411CC8V.meta_raw
-1195 thaNOG.ENOG411CCAU.meta_raw
-1196 thaNOG.ENOG411CB7Y.meta_raw
-1197 thaNOG.ENOG411CCAR.meta_raw
-1198 thaNOG.ENOG411CB4F.meta_raw
-1199 thaNOG.ENOG411CBNH.meta_raw
-1200 thaNOG.ENOG411CC2I.meta_raw
-1201 thaNOG.ENOG411CBFN.meta_raw
-1202 thaNOG.ENOG411CC4H.meta_raw
-1203 thaNOG.ENOG411CBRY.meta_raw
-1204 thaNOG.ENOG411CBZ2.meta_raw
-1205 thaNOG.ENOG411CBW4.meta_raw
-1206 thaNOG.ENOG411CBQG.meta_raw
-1207 thaNOG.ENOG411CC6J.meta_raw
-1208 thaNOG.ENOG411CBUI.meta_raw
-1209 thaNOG.ENOG411CC9G.meta_raw
-1210 thaNOG.ENOG411CBTW.meta_raw
-1211 thaNOG.ENOG411CBN5.meta_raw
-1212 thaNOG.ENOG411CC1P.meta_raw
-1213 thaNOG.ENOG411CBA2.meta_raw
-1214 thaNOG.ENOG411CBIG.meta_raw
-1215 thaNOG.ENOG411CBF0.meta_raw
-1216 thaNOG.ENOG411CB5K.meta_raw
-1217 thaNOG.ENOG411CBSV.meta_raw
-1218 thaNOG.ENOG411CBZQ.meta_raw
-1219 thaNOG.ENOG411CC9F.meta_raw
-1220 thaNOG.ENOG411CBH3.meta_raw
-1221 thaNOG.ENOG411CC5J.meta_raw
-1222 thaNOG.ENOG411CBSF.meta_raw
-1223 thaNOG.ENOG411CBTJ.meta_raw
-1224 thaNOG.ENOG411CC46.meta_raw
-1225 thaNOG.ENOG411CBFF.meta_raw
-1226 thaNOG.ENOG411CBE5.meta_raw
-1227 thaNOG.ENOG411CBQ5.meta_raw
-1228 thaNOG.ENOG411CBY4.meta_raw
-1229 thaNOG.ENOG411CBU1.meta_raw
-1230 thaNOG.ENOG411CBJP.meta_raw
-1231 thaNOG.ENOG411CB55.meta_raw
-1232 thaNOG.ENOG411CBEK.meta_raw
-1233 thaNOG.ENOG411CBKU.meta_raw
-1234 thaNOG.ENOG411CBPS.meta_raw
-1235 thaNOG.ENOG411CBK1.meta_raw
-1236 thaNOG.ENOG411CBXX.meta_raw
-1237 thaNOG.ENOG411CBB7.meta_raw
-1238 thaNOG.ENOG411CBYF.meta_raw
-1239 thaNOG.ENOG411CBNV.meta_raw
-1240 thaNOG.ENOG411CBMY.meta_raw
-1241 thaNOG.ENOG411CC3N.meta_raw
-1242 thaNOG.ENOG411CBFD.meta_raw
-1243 thaNOG.ENOG411CBEC.meta_raw
-1244 thaNOG.ENOG411CBQN.meta_raw
-1245 thaNOG.ENOG411CBT3.meta_raw
-1246 thaNOG.ENOG411CC35.meta_raw
-1247 thaNOG.ENOG411CB3R.meta_raw
-1248 thaNOG.ENOG411CBP4.meta_raw
-1249 thaNOG.ENOG411CBPA.meta_raw
-1250 thaNOG.ENOG411CBMX.meta_raw
-1251 thaNOG.ENOG411CBS5.meta_raw
-1252 thaNOG.ENOG411CBRD.meta_raw
-1253 thaNOG.ENOG411CC92.meta_raw
-1254 thaNOG.ENOG411CBVD.meta_raw
-1255 thaNOG.ENOG411CB6W.meta_raw
-1256 thaNOG.ENOG411CCB2.meta_raw
-1257 thaNOG.ENOG411CC8J.meta_raw
-1258 thaNOG.ENOG411CC4P.meta_raw
-1259 thaNOG.ENOG411CBI6.meta_raw
-1260 thaNOG.ENOG411CB9E.meta_raw
-1261 thaNOG.ENOG411CBJJ.meta_raw
-1262 thaNOG.ENOG411CB8T.meta_raw
-1263 thaNOG.ENOG411CBHC.meta_raw
-1264 thaNOG.ENOG411CBAX.meta_raw
-1265 thaNOG.ENOG411CBP7.meta_raw
-1266 thaNOG.ENOG411CBIJ.meta_raw
-1267 thaNOG.ENOG411CBCV.meta_raw
-1268 thaNOG.ENOG411CBXF.meta_raw
-1269 thaNOG.ENOG411CC3B.meta_raw
-1270 thaNOG.ENOG411CC0Q.meta_raw
-1271 thaNOG.ENOG411CBTH.meta_raw
-1272 thaNOG.ENOG411CCAC.meta_raw
-1273 thaNOG.ENOG411CC4J.meta_raw
-1274 thaNOG.ENOG411CBYP.meta_raw
-1275 thaNOG.ENOG411CC16.meta_raw
-1276 thaNOG.ENOG411CB81.meta_raw
-1277 thaNOG.ENOG411CBW9.meta_raw
-1278 thaNOG.ENOG411CBAK.meta_raw
-1279 thaNOG.ENOG411CBNZ.meta_raw
-1280 thaNOG.ENOG411CBRV.meta_raw
-1281 thaNOG.ENOG411CBAV.meta_raw
-1282 thaNOG.ENOG411CB42.meta_raw
-1283 thaNOG.ENOG411CB2F.meta_raw
-1284 thaNOG.ENOG411CBBS.meta_raw
-1285 thaNOG.ENOG411CC88.meta_raw
-1286 thaNOG.ENOG411CBV2.meta_raw
-1287 thaNOG.ENOG411CB7U.meta_raw
-1288 thaNOG.ENOG411CB8G.meta_raw
-1289 thaNOG.ENOG411CBMN.meta_raw
-1290 thaNOG.ENOG411CB2H.meta_raw
-1291 thaNOG.ENOG411CBPZ.meta_raw
-1292 thaNOG.ENOG411CBDT.meta_raw
-1293 thaNOG.ENOG411CC8T.meta_raw
-1294 thaNOG.ENOG411CBHR.meta_raw
-1295 thaNOG.ENOG411CB75.meta_raw
-1296 thaNOG.ENOG411CB3S.meta_raw
-1297 thaNOG.ENOG411CBX7.meta_raw
-1298 thaNOG.ENOG411CC34.meta_raw
-1299 thaNOG.ENOG411CC5V.meta_raw
-1300 thaNOG.ENOG411CBNY.meta_raw
-1301 thaNOG.ENOG411CBC4.meta_raw
-1302 thaNOG.ENOG411CBAB.meta_raw
-1303 thaNOG.ENOG411CBR3.meta_raw
-1304 thaNOG.ENOG411CBDC.meta_raw
-1305 thaNOG.ENOG411CB95.meta_raw
-1306 thaNOG.ENOG411CBZP.meta_raw
-1307 thaNOG.ENOG411CBBW.meta_raw
-1308 thaNOG.ENOG411CB3B.meta_raw
-1309 thaNOG.ENOG411CC1E.meta_raw
-1310 thaNOG.ENOG411CBK7.meta_raw
-1311 thaNOG.ENOG411CBT1.meta_raw
-1312 thaNOG.ENOG411CBBD.meta_raw
-1313 thaNOG.ENOG411CC8F.meta_raw
-1314 thaNOG.ENOG411CBVW.meta_raw
-1315 thaNOG.ENOG411CBTQ.meta_raw
-1316 thaNOG.ENOG411CBPJ.meta_raw
-1317 thaNOG.ENOG411CC2D.meta_raw
-1318 thaNOG.ENOG411CB9D.meta_raw
-1319 thaNOG.ENOG411CBF5.meta_raw
-1320 thaNOG.ENOG411CC89.meta_raw
-1321 thaNOG.ENOG411CBVC.meta_raw
-1322 thaNOG.ENOG411CBWD.meta_raw
-1323 thaNOG.ENOG411CB78.meta_raw
-1324 thaNOG.ENOG411CBCB.meta_raw
-1325 thaNOG.ENOG411CB4I.meta_raw
-1326 thaNOG.ENOG411CBE3.meta_raw
-1327 thaNOG.ENOG411CB71.meta_raw
-1328 thaNOG.ENOG411CBDH.meta_raw
-1329 thaNOG.ENOG411CB2P.meta_raw
-1330 thaNOG.ENOG411CB2T.meta_raw
-1331 thaNOG.ENOG411CC9V.meta_raw
-1332 thaNOG.ENOG411CC77.meta_raw
-1333 thaNOG.ENOG411CBJ0.meta_raw
-1334 thaNOG.ENOG411CC23.meta_raw
-1335 thaNOG.ENOG411CBKW.meta_raw
-1336 thaNOG.ENOG411CBWW.meta_raw
-1337 thaNOG.ENOG411CBY1.meta_raw
-1338 thaNOG.ENOG411CBYG.meta_raw
-1339 thaNOG.ENOG411CB4T.meta_raw
-1340 thaNOG.ENOG411CC9A.meta_raw
-1341 thaNOG.ENOG411CCA2.meta_raw
-1342 thaNOG.ENOG411CBN6.meta_raw
-1343 thaNOG.ENOG411CBNQ.meta_raw
-1344 thaNOG.ENOG411CC3P.meta_raw
-1345 thaNOG.ENOG411CBNI.meta_raw
-1346 thaNOG.ENOG411CB6T.meta_raw
-1347 thaNOG.ENOG411CBFB.meta_raw
-1348 thaNOG.ENOG411CB7V.meta_raw
-1349 thaNOG.ENOG411CB68.meta_raw
-1350 thaNOG.ENOG411CBQH.meta_raw
-1351 thaNOG.ENOG411CBWG.meta_raw
-1352 thaNOG.ENOG411CC01.meta_raw
-1353 thaNOG.ENOG411CBNU.meta_raw
-1354 thaNOG.ENOG411CB4E.meta_raw
-1355 thaNOG.ENOG411CBYC.meta_raw
-1356 thaNOG.ENOG411CBA9.meta_raw
-1357 thaNOG.ENOG411CB82.meta_raw
-1358 thaNOG.ENOG411CCAM.meta_raw
-1359 thaNOG.ENOG411CBSE.meta_raw
-1360 thaNOG.ENOG411CBTG.meta_raw
-1361 thaNOG.ENOG411CBIZ.meta_raw
-1362 thaNOG.ENOG411CBNB.meta_raw
-1363 thaNOG.ENOG411CBJ7.meta_raw
-1364 thaNOG.ENOG411CBYW.meta_raw
-1365 thaNOG.ENOG411CC0M.meta_raw
-1366 thaNOG.ENOG411CBNX.meta_raw
-1367 thaNOG.ENOG411CB6K.meta_raw
-1368 thaNOG.ENOG411CBD3.meta_raw
-1369 thaNOG.ENOG411CC4F.meta_raw
-1370 thaNOG.ENOG411CC43.meta_raw
-1371 thaNOG.ENOG411CC8Q.meta_raw
-1372 thaNOG.ENOG411CBUT.meta_raw
-1373 thaNOG.ENOG411CBM7.meta_raw
-1374 thaNOG.ENOG411CBH4.meta_raw
-1375 thaNOG.ENOG411CC5M.meta_raw
-1376 thaNOG.ENOG411CBTT.meta_raw
-1377 thaNOG.ENOG411CB5U.meta_raw
-1378 thaNOG.ENOG411CC9D.meta_raw
-1379 thaNOG.ENOG411CBX8.meta_raw
-1380 thaNOG.ENOG411CBGT.meta_raw
-1381 thaNOG.ENOG411CBQD.meta_raw
-1382 thaNOG.ENOG411CBX6.meta_raw
-1383 thaNOG.ENOG411CBGV.meta_raw
-1384 thaNOG.ENOG411CC97.meta_raw
-1385 thaNOG.ENOG411CBMT.meta_raw
-1386 thaNOG.ENOG411CBFS.meta_raw
-1387 thaNOG.ENOG411CBS7.meta_raw
-1388 thaNOG.ENOG411CBHF.meta_raw
-1389 thaNOG.ENOG411CBS2.meta_raw
-1390 thaNOG.ENOG411CBNR.meta_raw
-1391 thaNOG.ENOG411CC5R.meta_raw
-1392 thaNOG.ENOG411CBAE.meta_raw
-1393 thaNOG.ENOG411CBWX.meta_raw
-1394 thaNOG.ENOG411CC7U.meta_raw
-1395 thaNOG.ENOG411CC3R.meta_raw
-1396 thaNOG.ENOG411CC8P.meta_raw
-1397 thaNOG.ENOG411CC3F.meta_raw
-1398 thaNOG.ENOG411CBBZ.meta_raw
-1399 thaNOG.ENOG411CBM5.meta_raw
-1400 thaNOG.ENOG411CB4R.meta_raw
-1401 thaNOG.ENOG411CBH9.meta_raw
-1402 thaNOG.ENOG411CBU4.meta_raw
-1403 thaNOG.ENOG411CBQ4.meta_raw
-1404 thaNOG.ENOG411CB37.meta_raw
-1405 thaNOG.ENOG411CC1T.meta_raw
-1406 thaNOG.ENOG411CC96.meta_raw
-1407 thaNOG.ENOG411CB8X.meta_raw
-1408 thaNOG.ENOG411CBRX.meta_raw
-1409 thaNOG.ENOG411CBC5.meta_raw
-1410 thaNOG.ENOG411CBQ7.meta_raw
-1411 thaNOG.ENOG411CBVK.meta_raw
-1412 thaNOG.ENOG411CBQJ.meta_raw
-1413 thaNOG.ENOG411CBSI.meta_raw
-1414 thaNOG.ENOG411CBD1.meta_raw
-1415 thaNOG.ENOG411CC24.meta_raw
-1416 thaNOG.ENOG411CCA4.meta_raw
-1417 thaNOG.ENOG411CC72.meta_raw
-1418 thaNOG.ENOG411CBQ2.meta_raw
-1419 thaNOG.ENOG411CB5Q.meta_raw
-1420 thaNOG.ENOG411CBA0.meta_raw
-1421 thaNOG.ENOG411CC6G.meta_raw
-1422 thaNOG.ENOG411CBQ1.meta_raw
-1423 thaNOG.ENOG411CCAE.meta_raw
-1424 thaNOG.ENOG411CCA3.meta_raw
-1425 thaNOG.ENOG411CBNM.meta_raw
-1426 thaNOG.ENOG411CBZ5.meta_raw
-1427 thaNOG.ENOG411CC9J.meta_raw
-1428 thaNOG.ENOG411CBRH.meta_raw
-1429 thaNOG.ENOG411CBFC.meta_raw
-1430 thaNOG.ENOG411CBJV.meta_raw
-1431 thaNOG.ENOG411CBJS.meta_raw
-1432 thaNOG.ENOG411CBZW.meta_raw
-1433 thaNOG.ENOG411CBQQ.meta_raw
-1434 thaNOG.ENOG411CBQA.meta_raw
-1435 thaNOG.ENOG411CBG7.meta_raw
-1436 thaNOG.ENOG411CBGD.meta_raw
-1437 thaNOG.ENOG411CB9Y.meta_raw
-1438 thaNOG.ENOG411CB2R.meta_raw
-1439 thaNOG.ENOG411CB9U.meta_raw
-1440 thaNOG.ENOG411CBWS.meta_raw
-1441 thaNOG.ENOG411CBWQ.meta_raw
-1442 thaNOG.ENOG411CB7Q.meta_raw
-1443 thaNOG.ENOG411CBMM.meta_raw
-1444 thaNOG.ENOG411CBRG.meta_raw
-1445 thaNOG.ENOG411CBG1.meta_raw
-1446 thaNOG.ENOG411CC8W.meta_raw
-1447 thaNOG.ENOG411CBBG.meta_raw
-1448 thaNOG.ENOG411CB8S.meta_raw
-1449 thaNOG.ENOG411CC5F.meta_raw
-1450 thaNOG.ENOG411CBC9.meta_raw
-1451 thaNOG.ENOG411CBHE.meta_raw
-1452 thaNOG.ENOG411CBPR.meta_raw
-1453 thaNOG.ENOG411CB88.meta_raw
-1454 thaNOG.ENOG411CBV1.meta_raw
-1455 thaNOG.ENOG411CC9N.meta_raw
-1456 thaNOG.ENOG411CBK9.meta_raw
-1457 thaNOG.ENOG411CB8F.meta_raw
-1458 thaNOG.ENOG411CBVZ.meta_raw
-1459 thaNOG.ENOG411CC5S.meta_raw
-1460 thaNOG.ENOG411CBXJ.meta_raw
-1461 thaNOG.ENOG411CC0E.meta_raw
-1462 thaNOG.ENOG411CBHU.meta_raw
-1463 thaNOG.ENOG411CBHT.meta_raw
-1464 thaNOG.ENOG411CB87.meta_raw
--- a/test-data/make_comp_file.sh	Mon Nov 11 11:50:36 2019 -0500
+++ b/test-data/make_comp_file.sh	Sat Sep 05 07:21:28 2020 +0000
@@ -4,17 +4,6 @@
 
 emapper.py \
     -i $base_path/test-data/nlim_fragment.fasta \
-    --output HMM_nlim \
-    --output_dir $base_path/test-data \
-    --override \
-    --database $base_path/test-data/cached_locally/hmmdb_levels/ENOG411CB2I/ENOG411CB2I \
-    --data_dir $base_path/test-data/cached_locally \
-    --no_refine\
-    --no_annot \
-    --no_file_comments
-
-emapper.py \
-    -i $base_path/test-data/nlim_fragment.fasta \
     --output DIA_nlim \
     --output_dir $base_path/test-data \
     --override \
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/scoped.emapper.annotations	Sat Sep 05 07:21:28 2020 +0000
@@ -0,0 +1,1 @@
+Nmar_0135	436308.Nmar_0135	3.8e-149	510.8	Thaumarchaeota				ko:K07257					ko00000				Thaumarchaeota	41T2K@651137,COG1083@1,arCOG04817@2157	NA|NA|NA	M	Cytidylyltransferase
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/scoped.emapper.annotations_orthologs	Sat Sep 05 07:21:28 2020 +0000
@@ -0,0 +1,1 @@
+Nmar_0135	1131266.ARWQ01000003_gene1537,436308.Nmar_0135
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/scoped.emapper.seed_orthologs	Sat Sep 05 07:21:28 2020 +0000
@@ -0,0 +1,1 @@
+Nmar_0135	436308.Nmar_0135	3.8e-149	510.8
--- a/tool-data/eggnog_mapper_db.loc.sample	Mon Nov 11 11:50:36 2019 -0500
+++ b/tool-data/eggnog_mapper_db.loc.sample	Sat Sep 05 07:21:28 2020 +0000
@@ -1,25 +1,22 @@
 #This is a sample file distributed with Galaxy that enables tools
-#to use a directory of eggnog_mapper data files. 
+#to use a directory of eggnog_mapper data files.
 #
 # eggnog-mapper requires the following files to be installed in the data directory:
 #  https://github.com/jhcepas/eggnog-mapper/blob/master/data/og2level.tsv.gz
-#  http://eggnogdb.embl.de/download/eggnog_4.5/eggnog-mapper-data/eggnog.db.gz
-#  http://eggnogdb.embl.de/download/eggnog_4.5/eggnog-mapper-data/OG_fasta.tar.gz
-# In addition individual HMM DBs can be installed from:
-#  http://eggnogdb.embl.de/download/eggnog_4.5/eggnog-mapper-data/hmmdb_levels/
+#  http://eggnog5.embl.de/download/emapperdb-5.0.0/eggnog.db.gz
 # A complete diamond database is available from:
-#  http://eggnogdb.embl.de/download/eggnog_4.5/eggnog-mapper-data/eggnog_proteins.dmnd.gz
+#  http://eggnog5.embl.de/download/emapperdb-5.0.0/eggnog_proteins.dmnd.gz
 #
-# The python script download_eggnog_data.py, 
+# The python script download_eggnog_data.py,
 # included with eggnog_mapper, can be used to download the files to the correct directory
 #
 # The near-equivalence of columns "value" and "db" is needed for the tests to work,
 # and for the setting of --data_dir to the parent directory of eggnog.db
-# The complicated eggNOG database structure makes passing custom HMM databases somewhat tricky. 
+# The complicated eggNOG database structure makes passing custom HMM databases somewhat tricky.
 # See test-data/cached_locally/eggnog_mapper.loc for how this was done with the included test databases
-# In all other cases, when the appropriate HMM database (for example, "thaNOG") was downloaded from eggnogdb.embl.de, 
+# In all other cases, when the appropriate HMM database (for example, "thaNOG") was downloaded from eggnogdb.embl.de,
 # value and db should be the same (in the example, both should be "thaNOG")
 #
 #
-#db_version	name	path	
-#4.5.1	eggnog_4.5.1	/path/to/directory/that/contains/eggnog.db
+#db_version	name	path
+#5.0	eggnog_5.0	/path/to/directory/that/contains/eggnog.db
--- a/tool-data/eggnog_mapper_hmm_dbs.loc.sample	Mon Nov 11 11:50:36 2019 -0500
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,28 +0,0 @@
-#This is a sample file distributed with Galaxy that enables tools
-#to use a directory of eggnog_mapper data files. 
-#
-# eggnog-mapper requires the following files to be installed in the data directory:
-#  https://github.com/jhcepas/eggnog-mapper/blob/master/data/og2level.tsv.gz
-#  http://eggnogdb.embl.de/download/eggnog_4.5/eggnog-mapper-data/eggnog.db.gz
-#  http://eggnogdb.embl.de/download/eggnog_4.5/eggnog-mapper-data/OG_fasta.tar.gz
-# In addition individual HMM DBs can be installed from:
-#  http://eggnogdb.embl.de/download/eggnog_4.5/eggnog-mapper-data/hmmdb_levels/
-# A complete diamond database is available from:
-#  http://eggnogdb.embl.de/download/eggnog_4.5/eggnog-mapper-data/eggnog_proteins.dmnd.gz
-#
-# The python script download_eggnog_data.py, 
-# included with eggnog_mapper, can be used to download the files to the correct directory
-#
-# The near-equivalence of columns "value" and "db" is needed for the tests to work,
-# and for the setting of --data_dir to the parent directory of eggnog.db
-# The complicated eggNOG database structure makes passing custom HMM databases somewhat tricky. 
-# See test-data/cached_locally/eggnog_mapper.loc for how this was done with the included test databases
-# In all other cases, when the appropriate HMM database (for example, "thaNOG") was downloaded from eggnogdb.embl.de, 
-# value and db should be the same (in the example, both should be "thaNOG")
-#
-#
-#key	db_version	value	name	path
-#4.5.1_NOG	4.5.1	NOG	Full eggNOG database (NOG)	
-#4.5.1_euk	4.5.1	euk	Eukaryotes (euk)	
-#4.5.1_aproNOG	4.5.1	aproNOG	Proteobacteria_alpha (aproNOG)	
-#4.5.1_aproNOG	4.5.1	ENOG411CB2I	ENOG411CB2I (custom)	/path/to/custom/hmmdb/ENOG411CB2I
--- a/tool_data_table_conf.xml.sample	Mon Nov 11 11:50:36 2019 -0500
+++ b/tool_data_table_conf.xml.sample	Sat Sep 05 07:21:28 2020 +0000
@@ -4,8 +4,4 @@
         <columns>value,name,path</columns>
         <file path="tool-data/eggnog_mapper_db.loc" />
     </table>
-    <table name="eggnog_mapper_hmm_dbs" comment_char="#" allow_duplicate_entries="False">
-        <columns>key,db_version,value,name,path</columns>
-        <file path="tool-data/eggnog_mapper_hmm_dbs.loc" />
-    </table>
 </tables>
--- a/tool_data_table_conf.xml.test	Mon Nov 11 11:50:36 2019 -0500
+++ b/tool_data_table_conf.xml.test	Sat Sep 05 07:21:28 2020 +0000
@@ -4,8 +4,4 @@
         <columns>value,name,path</columns>
         <file path="${__HERE__}/test-data/cached_locally/eggnog_mapper_db.loc" />
     </table>
-    <table name="eggnog_mapper_hmm_dbs" comment_char="#">
-        <columns>key,db_version,value,name,path</columns>
-        <file path="${__HERE__}/test-data/cached_locally/eggnog_mapper_hmm_dbs.loc" />
-    </table>
 </tables>