Mercurial > repos > galaxyp > maxquant

annotate test-data/mqpar/txt/peptides.txt @ 15:97a7f34fcb6a draft

Find changesets by keywords (author, files, the commit message), revision number or hash, or revset expression.
"planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/maxquant commit 641b1d3af3b589a861cde2dc2f8803c9b79df7be"
author galaxyp
date Wed, 11 Aug 2021 09:24:23 +0000
parents
children
Ignore whitespace changes - Everywhere: Within whitespace: At end of lines:
rev   line source
15
97a7f34fcb6a "planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/maxquant commit 641b1d3af3b589a861cde2dc2f8803c9b79df7be"
galaxyp
parents:
diff changeset
1 Sequence N-term cleavage window C-term cleavage window Amino acid before First amino acid Second amino acid Second last amino acid Last amino acid Amino acid after A Count R Count N Count D Count C Count Q Count E Count G Count H Count I Count L Count K Count M Count F Count P Count S Count T Count W Count Y Count V Count U Count O Count Length Missed cleavages Mass Proteins Leading razor protein Start position End position Unique (Groups) Unique (Proteins) Charges PEP Score Intensity Reverse Potential contaminant id Protein group IDs Mod. peptide IDs Evidence IDs MS/MS IDs Best MS/MS Oxidation (M) site IDs Taxonomy IDs MS/MS Count
97a7f34fcb6a "planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/maxquant commit 641b1d3af3b589a861cde2dc2f8803c9b79df7be"
galaxyp
parents:
diff changeset
2 AEFVEVTK LKAWSVARLSQKFPKAEFVEVTKLVTDLTK LSQKFPKAEFVEVTKLVTDLTKVHKECCHG K A E T K L 1 0 0 0 0 0 2 0 0 0 0 1 0 1 0 0 1 0 0 2 0 0 8 0 921.48075 bsa;CON__P02769 bsa 249 256 yes no 2 0.0055393 3.3922 43060 + 0 2 0 0 0 0 0
97a7f34fcb6a "planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/maxquant commit 641b1d3af3b589a861cde2dc2f8803c9b79df7be"
galaxyp
parents:
diff changeset
3 DDPHACYSTVFDK LAKEYEATLEECCAKDDPHACYSTVFDKLK AKDDPHACYSTVFDKLKHLVDEPQNLIKQN K D D D K L 1 0 0 3 1 0 0 0 1 0 0 1 0 1 1 1 1 0 1 1 0 0 13 0 1553.6457 bsa;CON__P02769 bsa 387 399 yes no 2 0.0081868 0 32583 + 1 2 1 1 1 1 1
97a7f34fcb6a "planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/maxquant commit 641b1d3af3b589a861cde2dc2f8803c9b79df7be"
galaxyp
parents:
diff changeset
4 ECCHGDLLECADDR VEVTKLVTDLTKVHKECCHGDLLECADDRA KECCHGDLLECADDRADLAKYICDNQDTIS K E C D R A 1 1 0 3 3 0 2 1 1 0 2 0 0 0 0 0 0 0 0 0 0 0 14 0 1748.6553 bsa;CON__P02769 bsa 267 280 yes no 2;3 0.011617 4.06 487540 + 2 2 2 2;3 2;3;4 2 3
97a7f34fcb6a "planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/maxquant commit 641b1d3af3b589a861cde2dc2f8803c9b79df7be"
galaxyp
parents:
diff changeset
5 FNETTEK NMENPPECYRHAENRFNETTEKSLKIVQRE CYRHAENRFNETTEKSLKIVQRECEHFQNL R F N E K S 0 0 1 0 0 0 2 0 0 0 0 1 0 1 0 0 2 0 0 0 0 0 7 0 867.39741 CON__REFSEQ:XP_585019 CON__REFSEQ:XP_585019 401 407 yes yes 1 0.0030372 0 40791 + 3 7 3 4 5 5 0
97a7f34fcb6a "planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/maxquant commit 641b1d3af3b589a861cde2dc2f8803c9b79df7be"
galaxyp
parents:
diff changeset
6 GCTTTNSPSTPCQNCSR ______________________________ TTTNSPSTPCQNCSRITNVSTISSNNGCHP K G C S R I 0 1 2 0 3 1 0 1 0 0 0 0 0 0 2 3 4 0 0 0 0 0 17 0 1926.7618 CON__Q6IFU6 CON__Q6IFU6 5 21 yes yes 2 0.016056 0 0 + 4 6 4 5 6 6 1
97a7f34fcb6a "planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/maxquant commit 641b1d3af3b589a861cde2dc2f8803c9b79df7be"
galaxyp
parents:
diff changeset
7 GETGPAGPSGAPGPAGSR GPPGPVGPAGKSGDRGETGPAGPSGAPGPA GPAGPSGAPGPAGSRGPPGPQGPRGDKGET R G E S R G 3 1 0 0 0 0 1 6 0 0 0 0 0 0 4 2 1 0 0 0 0 0 18 0 1521.7172 CON__P04258 CON__P04258 1065 1082 yes yes 3 0.014811 0 0 + 5 3 5 6 7 7 1
97a7f34fcb6a "planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/maxquant commit 641b1d3af3b589a861cde2dc2f8803c9b79df7be"
galaxyp
parents:
diff changeset
8 LGQYTSPVAK RKKRNVNFQKAIHEKLGQYTSPVAKRCCQD AIHEKLGQYTSPVAKRCCQDGLTRLPMART K L G A K R 1 0 0 0 0 1 0 1 0 0 1 1 0 0 1 1 1 0 1 1 0 0 10 0 1062.571 CON__P01030;CON__ENSEMBL:ENSBTAP00000007350 CON__P01030 689 698 yes no 2 0.0086806 9.2141 0 + 6 0 6 7 8 8 1
97a7f34fcb6a "planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/maxquant commit 641b1d3af3b589a861cde2dc2f8803c9b79df7be"
galaxyp
parents:
diff changeset
9 TSDANINWNNLK KNTPEKGYLAVAVVKTSDANINWNNLKDKK VVKTSDANINWNNLKDKKSCHTAVDRTAGW K T S L K D 1 0 4 1 0 0 0 0 0 1 1 1 0 0 0 1 1 1 0 0 0 0 12 0 1388.6684 CON__Q29443;CON__Q0IIK2 CON__Q29443 438 449 yes no 2;3 0.0052683 2.8669 137950 + 7 5 7 8;9 9;10;11 9 3
97a7f34fcb6a "planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/maxquant commit 641b1d3af3b589a861cde2dc2f8803c9b79df7be"
galaxyp
parents:
diff changeset
10 VLYDAEISQIHQSVTDTNVILSMDNSR QSKVDLLNQEIEFLKVLYDAEISQIHQSVT SVTDTNVILSMDNSRNLDLDSIIAEVKAQY K V L S R N 1 1 2 3 0 2 1 0 1 3 2 0 1 0 0 4 2 0 1 3 0 0 27 0 3047.487 CON__P35908v2;CON__P35908 CON__P35908v2 315 341 yes no 6 0.00066484 0 27010 + 8 4 8 10 12 12 0
97a7f34fcb6a "planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/maxquant commit 641b1d3af3b589a861cde2dc2f8803c9b79df7be"
galaxyp
parents:
diff changeset
11 YCGVPGEYWLGNDR KQGFGNIATNAEGKKYCGVPGEYWLGNDRI KYCGVPGEYWLGNDRISQLTNMGPTKLLIE K Y C D R I 0 1 1 1 1 0 1 3 0 0 1 0 0 0 1 0 0 1 2 1 0 0 14 0 1684.7304 CON__P02676 CON__P02676 319 332 yes yes 2;3 0.011617 3.6449 114430 + 9 1 9 11;12 13;14 13 2
97a7f34fcb6a "planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/maxquant commit 641b1d3af3b589a861cde2dc2f8803c9b79df7be"
galaxyp
parents:
diff changeset
12 YICDNQDTISSK GDLLECADDRADLAKYICDNQDTISSKLKE LAKYICDNQDTISSKLKECCDKPLLEKSHC K Y I S K L 0 0 1 2 1 1 0 0 0 2 0 1 0 0 0 2 1 0 1 0 0 0 12 0 1442.6348 bsa;CON__P02769 bsa 286 297 yes no 2 4.413E-09 24.343 0 + 10 2 10 13 15 15 1