Mercurial > repos > galaxyp > openms_idconflictresolver
comparison test-data/MetaProSIP_1_input.fasta @ 8:42dffcf33fe4 draft
planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/openms commit 981be1bde91d6d565693cd691553f77465e653bb
| author | galaxyp |
|---|---|
| date | Tue, 20 Mar 2018 14:47:35 -0400 |
| parents | |
| children |
comparison
equal
deleted
inserted
replaced
| 7:0a412af10d96 | 8:42dffcf33fe4 |
|---|---|
| 1 >contig23640_802236 length=2326 numreads=28 strand:-1 frame:0 orf_location:136:990 | |
| 2 GGIPNEENWNFGSSDGSGLPVRGSGQRRDVLGRLCRRNFTSSIGQSVNVRDVEASGFAGG | |
| 3 MSRYHFKYGGAVDPTVLGGVKLGTWFVKEGFAGWSGYPDWCKYFGFYTDFSYHRFYTRDN | |
| 4 RISGTDFFAAYGGGSAALGDVGFMKTEGMVATWAFMLAARYGFFQDSEVPFGRLQPYVAV | |
| 5 GPAIMFSSMKPKIWTQFNEPNVGFPNPDLVYSPGNQSSTDLGLAVDTGIRYMCLKNVSLD | |
| 6 ISFKYRYAQPHYNFSGQDGSVMVPAHMSLSPALNLYSFQAGVAYHF |
