Mercurial > repos > galaxyp > openms_idfileconverter
view test-data/MetaProSIP_1_input.fasta @ 8:92d0f39d9b8f draft
planemo upload for repository https://github.com/galaxyproteomics/tools-galaxyp/tree/master/tools/openms commit 981be1bde91d6d565693cd691553f77465e653bb
| author | galaxyp |
|---|---|
| date | Tue, 20 Mar 2018 15:13:45 -0400 |
| parents | |
| children |
line wrap: on
line source
>contig23640_802236 length=2326 numreads=28 strand:-1 frame:0 orf_location:136:990 GGIPNEENWNFGSSDGSGLPVRGSGQRRDVLGRLCRRNFTSSIGQSVNVRDVEASGFAGG MSRYHFKYGGAVDPTVLGGVKLGTWFVKEGFAGWSGYPDWCKYFGFYTDFSYHRFYTRDN RISGTDFFAAYGGGSAALGDVGFMKTEGMVATWAFMLAARYGFFQDSEVPFGRLQPYVAV GPAIMFSSMKPKIWTQFNEPNVGFPNPDLVYSPGNQSSTDLGLAVDTGIRYMCLKNVSLD ISFKYRYAQPHYNFSGQDGSVMVPAHMSLSPALNLYSFQAGVAYHF
