# HG changeset patch
# User iracooke
# Date 1403711359 14400
# Node ID 6cdbfdffb38ea8ec5317ee7cf7b743b2a68a8055
# Parent 186fdc4b33108171603aeffcc3e033951250d879
Uploaded
diff -r 186fdc4b3310 -r 6cdbfdffb38e #env.sh#
--- a/#env.sh# Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,3 +0,0 @@
-
-export PATH=/path/to/2134123412341/tint_proteomics_scripts/:$PATH
-
diff -r 186fdc4b3310 -r 6cdbfdffb38e COPYING
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/COPYING Wed Jun 25 11:49:19 2014 -0400
@@ -0,0 +1,121 @@
+Creative Commons Legal Code
+
+CC0 1.0 Universal
+
+ CREATIVE COMMONS CORPORATION IS NOT A LAW FIRM AND DOES NOT PROVIDE
+ LEGAL SERVICES. DISTRIBUTION OF THIS DOCUMENT DOES NOT CREATE AN
+ ATTORNEY-CLIENT RELATIONSHIP. CREATIVE COMMONS PROVIDES THIS
+ INFORMATION ON AN "AS-IS" BASIS. CREATIVE COMMONS MAKES NO WARRANTIES
+ REGARDING THE USE OF THIS DOCUMENT OR THE INFORMATION OR WORKS
+ PROVIDED HEREUNDER, AND DISCLAIMS LIABILITY FOR DAMAGES RESULTING FROM
+ THE USE OF THIS DOCUMENT OR THE INFORMATION OR WORKS PROVIDED
+ HEREUNDER.
+
+Statement of Purpose
+
+The laws of most jurisdictions throughout the world automatically confer
+exclusive Copyright and Related Rights (defined below) upon the creator
+and subsequent owner(s) (each and all, an "owner") of an original work of
+authorship and/or a database (each, a "Work").
+
+Certain owners wish to permanently relinquish those rights to a Work for
+the purpose of contributing to a commons of creative, cultural and
+scientific works ("Commons") that the public can reliably and without fear
+of later claims of infringement build upon, modify, incorporate in other
+works, reuse and redistribute as freely as possible in any form whatsoever
+and for any purposes, including without limitation commercial purposes.
+These owners may contribute to the Commons to promote the ideal of a free
+culture and the further production of creative, cultural and scientific
+works, or to gain reputation or greater distribution for their Work in
+part through the use and efforts of others.
+
+For these and/or other purposes and motivations, and without any
+expectation of additional consideration or compensation, the person
+associating CC0 with a Work (the "Affirmer"), to the extent that he or she
+is an owner of Copyright and Related Rights in the Work, voluntarily
+elects to apply CC0 to the Work and publicly distribute the Work under its
+terms, with knowledge of his or her Copyright and Related Rights in the
+Work and the meaning and intended legal effect of CC0 on those rights.
+
+1. Copyright and Related Rights. A Work made available under CC0 may be
+protected by copyright and related or neighboring rights ("Copyright and
+Related Rights"). Copyright and Related Rights include, but are not
+limited to, the following:
+
+ i. the right to reproduce, adapt, distribute, perform, display,
+ communicate, and translate a Work;
+ ii. moral rights retained by the original author(s) and/or performer(s);
+iii. publicity and privacy rights pertaining to a person's image or
+ likeness depicted in a Work;
+ iv. rights protecting against unfair competition in regards to a Work,
+ subject to the limitations in paragraph 4(a), below;
+ v. rights protecting the extraction, dissemination, use and reuse of data
+ in a Work;
+ vi. database rights (such as those arising under Directive 96/9/EC of the
+ European Parliament and of the Council of 11 March 1996 on the legal
+ protection of databases, and under any national implementation
+ thereof, including any amended or successor version of such
+ directive); and
+vii. other similar, equivalent or corresponding rights throughout the
+ world based on applicable law or treaty, and any national
+ implementations thereof.
+
+2. Waiver. To the greatest extent permitted by, but not in contravention
+of, applicable law, Affirmer hereby overtly, fully, permanently,
+irrevocably and unconditionally waives, abandons, and surrenders all of
+Affirmer's Copyright and Related Rights and associated claims and causes
+of action, whether now known or unknown (including existing as well as
+future claims and causes of action), in the Work (i) in all territories
+worldwide, (ii) for the maximum duration provided by applicable law or
+treaty (including future time extensions), (iii) in any current or future
+medium and for any number of copies, and (iv) for any purpose whatsoever,
+including without limitation commercial, advertising or promotional
+purposes (the "Waiver"). Affirmer makes the Waiver for the benefit of each
+member of the public at large and to the detriment of Affirmer's heirs and
+successors, fully intending that such Waiver shall not be subject to
+revocation, rescission, cancellation, termination, or any other legal or
+equitable action to disrupt the quiet enjoyment of the Work by the public
+as contemplated by Affirmer's express Statement of Purpose.
+
+3. Public License Fallback. Should any part of the Waiver for any reason
+be judged legally invalid or ineffective under applicable law, then the
+Waiver shall be preserved to the maximum extent permitted taking into
+account Affirmer's express Statement of Purpose. In addition, to the
+extent the Waiver is so judged Affirmer hereby grants to each affected
+person a royalty-free, non transferable, non sublicensable, non exclusive,
+irrevocable and unconditional license to exercise Affirmer's Copyright and
+Related Rights in the Work (i) in all territories worldwide, (ii) for the
+maximum duration provided by applicable law or treaty (including future
+time extensions), (iii) in any current or future medium and for any number
+of copies, and (iv) for any purpose whatsoever, including without
+limitation commercial, advertising or promotional purposes (the
+"License"). The License shall be deemed effective as of the date CC0 was
+applied by Affirmer to the Work. Should any part of the License for any
+reason be judged legally invalid or ineffective under applicable law, such
+partial invalidity or ineffectiveness shall not invalidate the remainder
+of the License, and in such case Affirmer hereby affirms that he or she
+will not (i) exercise any of his or her remaining Copyright and Related
+Rights in the Work or (ii) assert any associated claims and causes of
+action with respect to the Work, in either case contrary to Affirmer's
+express Statement of Purpose.
+
+4. Limitations and Disclaimers.
+
+ a. No trademark or patent rights held by Affirmer are waived, abandoned,
+ surrendered, licensed or otherwise affected by this document.
+ b. Affirmer offers the Work as-is and makes no representations or
+ warranties of any kind concerning the Work, express, implied,
+ statutory or otherwise, including without limitation warranties of
+ title, merchantability, fitness for a particular purpose, non
+ infringement, or the absence of latent or other defects, accuracy, or
+ the present or absence of errors, whether or not discoverable, all to
+ the greatest extent permissible under applicable law.
+ c. Affirmer disclaims responsibility for clearing rights of other persons
+ that may apply to the Work or any use thereof, including without
+ limitation any person's Copyright and Related Rights in the Work.
+ Further, Affirmer disclaims responsibility for obtaining any necessary
+ consents, permissions or other rights required for any use of the
+ Work.
+ d. Affirmer understands and acknowledges that Creative Commons is not a
+ party to this document and has no duty or obligation with respect to
+ this CC0 or use of the Work.
diff -r 186fdc4b3310 -r 6cdbfdffb38e LICENSE
--- a/LICENSE Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,11 +0,0 @@
---2012-09-19 08:46:18-- http://www.apache.org/licenses/LICENSE-2.0.txt
-Resolving www.apache.org... 140.211.11.131, 192.87.106.229, 2001:610:1:80bc:192:87:106:229
-Connecting to www.apache.org|140.211.11.131|:80... connected.
-HTTP request sent, awaiting response... 200 OK
-Length: 11358 (11K) [text/plain]
-Saving to: “LICENSE-2.0.txt”
-
- 0K .......... . 100% 200K=0.06s
-
-2012-09-19 08:46:18 (200 KB/s) - “LICENSE-2.0.txt” saved [11358/11358]
-
diff -r 186fdc4b3310 -r 6cdbfdffb38e README.md
--- a/README.md Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,40 +0,0 @@
-Tool wrapper for SearchGUI + PeptideShaker. This tool takes any number
-of mgf files and performs X! Tandem and OMSSA searches on these via
-SearchGUI and merges the results using PeptideShaker.
-
-For Galaxy-P we are installing this tool via CloudBioLinux
-(https://github.com/jmchilton/cloudbiolinux/blob/proteomics/cloudbio/custom/bio_proteomics.py). While
-this fabric script may not be exactly appropriate for your environment
-it may serve as a template for how to install this software. In
-particular these tools require CLI wrappers to be placed for
-PeptideShaker and SearchGUI that can be installed as demostrated in
-these fabric functions.
-
-Note: Also SearchGUI requires a version greater than 1.12.2 which
-contained several bugs preventing this from working on the
-command-line and via Linux.
-
-Also, PeptideShaker may require xvfb to simulate an X environment if
-this is installed on a headless server.
-# Obtaining Tools
-
-Repositories for all Galaxy-P tools can be found at
-https:/bitbucket.org/galaxyp/.
-
-# Contact
-
-Please send suggestions for improvements and bug reports to
-jmchilton@gmail.com.
-
-# License
-
-All Galaxy-P tools are licensed under the Apache License Version 2.0
-unless otherwise documented.
-
-# Tool Versioning
-
-Galaxy-P tools will have versions of the form X.Y.Z. Versions
-differing only after the second decimal should be completely
-compatible with each other. Breaking changes should result in an
-increment of the number before and/or after the first decimal. All
-tools of version less than 1.0.0 should be considered beta.
diff -r 186fdc4b3310 -r 6cdbfdffb38e README_GALAXYP.md
--- a/README_GALAXYP.md Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,22 +0,0 @@
-# Obtaining Tools
-
-Repositories for all Galaxy-P tools can be found at
-https:/bitbucket.org/galaxyp/.
-
-# Contact
-
-Please send suggestions for improvements and bug reports to
-jmchilton@gmail.com.
-
-# License
-
-All Galaxy-P tools are licensed under the Apache License Version 2.0
-unless otherwise documented.
-
-# Tool Versioning
-
-Galaxy-P tools will have versions of the form X.Y.Z. Versions
-differing only after the second decimal should be completely
-compatible with each other. Breaking changes should result in an
-increment of the number before and/or after the first decimal. All
-tools of version less than 1.0.0 should be considered beta.
diff -r 186fdc4b3310 -r 6cdbfdffb38e README_REPO.md
--- a/README_REPO.md Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,18 +0,0 @@
-Tool wrapper for SearchGUI + PeptideShaker. This tool takes any number
-of mgf files and performs X! Tandem and OMSSA searches on these via
-SearchGUI and merges the results using PeptideShaker.
-
-For Galaxy-P we are installing this tool via CloudBioLinux
-(https://github.com/jmchilton/cloudbiolinux/blob/proteomics/cloudbio/custom/bio_proteomics.py). While
-this fabric script may not be exactly appropriate for your environment
-it may serve as a template for how to install this software. In
-particular these tools require CLI wrappers to be placed for
-PeptideShaker and SearchGUI that can be installed as demostrated in
-these fabric functions.
-
-Note: Also SearchGUI requires a version greater than 1.12.2 which
-contained several bugs preventing this from working on the
-command-line and via Linux.
-
-Also, PeptideShaker may require xvfb to simulate an X environment if
-this is installed on a headless server.
diff -r 186fdc4b3310 -r 6cdbfdffb38e build_mods_loc.py
--- a/build_mods_loc.py Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,12 +0,0 @@
-#!/usr/bin/env python
-
-import xml.etree.ElementTree as ET
-from os.path import exists
-
-with open("searchgui_mods.loc", "w") as output:
- for mods_path in ["searchGUI_mods.xml", "searchGUI_usermods.xml"]:
- tree = ET.parse(mods_path)
- modifications_el = tree.getroot()
- for mod in modifications_el.findall("{http://www.ncbi.nlm.nih.gov}MSModSpec"):
- name_el = mod.find("{http://www.ncbi.nlm.nih.gov}MSModSpec_name")
- output.write("%s\n" % name_el.text.lower())
diff -r 186fdc4b3310 -r 6cdbfdffb38e datatypes_conf.xml
--- a/datatypes_conf.xml Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,9 +0,0 @@
-
-
-
-
-
-
-
-
-
diff -r 186fdc4b3310 -r 6cdbfdffb38e dbtoolkit-4.2/LICENSE-2.0.txt
--- a/dbtoolkit-4.2/LICENSE-2.0.txt Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,202 +0,0 @@
-
- Apache License
- Version 2.0, January 2004
- http://www.apache.org/licenses/
-
- TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION
-
- 1. Definitions.
-
- "License" shall mean the terms and conditions for use, reproduction,
- and distribution as defined by Sections 1 through 9 of this document.
-
- "Licensor" shall mean the copyright owner or entity authorized by
- the copyright owner that is granting the License.
-
- "Legal Entity" shall mean the union of the acting entity and all
- other entities that control, are controlled by, or are under common
- control with that entity. For the purposes of this definition,
- "control" means (i) the power, direct or indirect, to cause the
- direction or management of such entity, whether by contract or
- otherwise, or (ii) ownership of fifty percent (50%) or more of the
- outstanding shares, or (iii) beneficial ownership of such entity.
-
- "You" (or "Your") shall mean an individual or Legal Entity
- exercising permissions granted by this License.
-
- "Source" form shall mean the preferred form for making modifications,
- including but not limited to software source code, documentation
- source, and configuration files.
-
- "Object" form shall mean any form resulting from mechanical
- transformation or translation of a Source form, including but
- not limited to compiled object code, generated documentation,
- and conversions to other media types.
-
- "Work" shall mean the work of authorship, whether in Source or
- Object form, made available under the License, as indicated by a
- copyright notice that is included in or attached to the work
- (an example is provided in the Appendix below).
-
- "Derivative Works" shall mean any work, whether in Source or Object
- form, that is based on (or derived from) the Work and for which the
- editorial revisions, annotations, elaborations, or other modifications
- represent, as a whole, an original work of authorship. For the purposes
- of this License, Derivative Works shall not include works that remain
- separable from, or merely link (or bind by name) to the interfaces of,
- the Work and Derivative Works thereof.
-
- "Contribution" shall mean any work of authorship, including
- the original version of the Work and any modifications or additions
- to that Work or Derivative Works thereof, that is intentionally
- submitted to Licensor for inclusion in the Work by the copyright owner
- or by an individual or Legal Entity authorized to submit on behalf of
- the copyright owner. For the purposes of this definition, "submitted"
- means any form of electronic, verbal, or written communication sent
- to the Licensor or its representatives, including but not limited to
- communication on electronic mailing lists, source code control systems,
- and issue tracking systems that are managed by, or on behalf of, the
- Licensor for the purpose of discussing and improving the Work, but
- excluding communication that is conspicuously marked or otherwise
- designated in writing by the copyright owner as "Not a Contribution."
-
- "Contributor" shall mean Licensor and any individual or Legal Entity
- on behalf of whom a Contribution has been received by Licensor and
- subsequently incorporated within the Work.
-
- 2. Grant of Copyright License. Subject to the terms and conditions of
- this License, each Contributor hereby grants to You a perpetual,
- worldwide, non-exclusive, no-charge, royalty-free, irrevocable
- copyright license to reproduce, prepare Derivative Works of,
- publicly display, publicly perform, sublicense, and distribute the
- Work and such Derivative Works in Source or Object form.
-
- 3. Grant of Patent License. Subject to the terms and conditions of
- this License, each Contributor hereby grants to You a perpetual,
- worldwide, non-exclusive, no-charge, royalty-free, irrevocable
- (except as stated in this section) patent license to make, have made,
- use, offer to sell, sell, import, and otherwise transfer the Work,
- where such license applies only to those patent claims licensable
- by such Contributor that are necessarily infringed by their
- Contribution(s) alone or by combination of their Contribution(s)
- with the Work to which such Contribution(s) was submitted. If You
- institute patent litigation against any entity (including a
- cross-claim or counterclaim in a lawsuit) alleging that the Work
- or a Contribution incorporated within the Work constitutes direct
- or contributory patent infringement, then any patent licenses
- granted to You under this License for that Work shall terminate
- as of the date such litigation is filed.
-
- 4. Redistribution. You may reproduce and distribute copies of the
- Work or Derivative Works thereof in any medium, with or without
- modifications, and in Source or Object form, provided that You
- meet the following conditions:
-
- (a) You must give any other recipients of the Work or
- Derivative Works a copy of this License; and
-
- (b) You must cause any modified files to carry prominent notices
- stating that You changed the files; and
-
- (c) You must retain, in the Source form of any Derivative Works
- that You distribute, all copyright, patent, trademark, and
- attribution notices from the Source form of the Work,
- excluding those notices that do not pertain to any part of
- the Derivative Works; and
-
- (d) If the Work includes a "NOTICE" text file as part of its
- distribution, then any Derivative Works that You distribute must
- include a readable copy of the attribution notices contained
- within such NOTICE file, excluding those notices that do not
- pertain to any part of the Derivative Works, in at least one
- of the following places: within a NOTICE text file distributed
- as part of the Derivative Works; within the Source form or
- documentation, if provided along with the Derivative Works; or,
- within a display generated by the Derivative Works, if and
- wherever such third-party notices normally appear. The contents
- of the NOTICE file are for informational purposes only and
- do not modify the License. You may add Your own attribution
- notices within Derivative Works that You distribute, alongside
- or as an addendum to the NOTICE text from the Work, provided
- that such additional attribution notices cannot be construed
- as modifying the License.
-
- You may add Your own copyright statement to Your modifications and
- may provide additional or different license terms and conditions
- for use, reproduction, or distribution of Your modifications, or
- for any such Derivative Works as a whole, provided Your use,
- reproduction, and distribution of the Work otherwise complies with
- the conditions stated in this License.
-
- 5. Submission of Contributions. Unless You explicitly state otherwise,
- any Contribution intentionally submitted for inclusion in the Work
- by You to the Licensor shall be under the terms and conditions of
- this License, without any additional terms or conditions.
- Notwithstanding the above, nothing herein shall supersede or modify
- the terms of any separate license agreement you may have executed
- with Licensor regarding such Contributions.
-
- 6. Trademarks. This License does not grant permission to use the trade
- names, trademarks, service marks, or product names of the Licensor,
- except as required for reasonable and customary use in describing the
- origin of the Work and reproducing the content of the NOTICE file.
-
- 7. Disclaimer of Warranty. Unless required by applicable law or
- agreed to in writing, Licensor provides the Work (and each
- Contributor provides its Contributions) on an "AS IS" BASIS,
- WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or
- implied, including, without limitation, any warranties or conditions
- of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A
- PARTICULAR PURPOSE. You are solely responsible for determining the
- appropriateness of using or redistributing the Work and assume any
- risks associated with Your exercise of permissions under this License.
-
- 8. Limitation of Liability. In no event and under no legal theory,
- whether in tort (including negligence), contract, or otherwise,
- unless required by applicable law (such as deliberate and grossly
- negligent acts) or agreed to in writing, shall any Contributor be
- liable to You for damages, including any direct, indirect, special,
- incidental, or consequential damages of any character arising as a
- result of this License or out of the use or inability to use the
- Work (including but not limited to damages for loss of goodwill,
- work stoppage, computer failure or malfunction, or any and all
- other commercial damages or losses), even if such Contributor
- has been advised of the possibility of such damages.
-
- 9. Accepting Warranty or Additional Liability. While redistributing
- the Work or Derivative Works thereof, You may choose to offer,
- and charge a fee for, acceptance of support, warranty, indemnity,
- or other liability obligations and/or rights consistent with this
- License. However, in accepting such obligations, You may act only
- on Your own behalf and on Your sole responsibility, not on behalf
- of any other Contributor, and only if You agree to indemnify,
- defend, and hold each Contributor harmless for any liability
- incurred by, or claims asserted against, such Contributor by reason
- of your accepting any such warranty or additional liability.
-
- END OF TERMS AND CONDITIONS
-
- APPENDIX: How to apply the Apache License to your work.
-
- To apply the Apache License to your work, attach the following
- boilerplate notice, with the fields enclosed by brackets "[]"
- replaced with your own identifying information. (Don't include
- the brackets!) The text should be enclosed in the appropriate
- comment syntax for the file format. We also recommend that a
- file or class name and description of purpose be included on the
- same "printed page" as the copyright notice for easier
- identification within third-party archives.
-
- Copyright [yyyy] [name of copyright owner]
-
- Licensed under the Apache License, Version 2.0 (the "License");
- you may not use this file except in compliance with the License.
- You may obtain a copy of the License at
-
- http://www.apache.org/licenses/LICENSE-2.0
-
- Unless required by applicable law or agreed to in writing, software
- distributed under the License is distributed on an "AS IS" BASIS,
- WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- See the License for the specific language governing permissions and
- limitations under the License.
diff -r 186fdc4b3310 -r 6cdbfdffb38e dbtoolkit-4.2/dbtoolkit-4.2.jar
Binary file dbtoolkit-4.2/dbtoolkit-4.2.jar has changed
diff -r 186fdc4b3310 -r 6cdbfdffb38e dbtoolkit-4.2/lib/jargs-1.0.jar
--- a/dbtoolkit-4.2/lib/jargs-1.0.jar Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,48 +0,0 @@
-
-
-
-
-
- http://searchgui.googlecode.com/files/SearchGUI-1.13.1_mac_and_linux.zip
- tar -xf $DIR_NAME/*.tar
- cd $DIR_NAME
- chmod -R $DIR_NAME/*resources
-
- .
- $INSTALL_DIR/
-
- mkdir -p $BIN_DIR
-
- $INSTALL_DIR
-
-
-
-
- This package downloads and installs the SearchGUI scripts develped as part of the Peptideshaker tool.
- (https://github.com/jmchilton/peptide-shaker).
-
-
-
-
-
-
-
- http://peptide-shaker.googlecode.com/files/PeptideShaker-0.20.1.zip
- chmod -R o+w resources
-
- .
- $INSTALL_DIR/
-
- mkdir -p $BIN_DIR
-
- $INSTALL_DIR
-
-
-
-
- This package downloads and installs the peptideshaker tool as a part of the peptideshaker framework.
- (https://github.com/jmchilton/peptide-shaker).
-
-
-
-
diff -r 186fdc4b3310 -r 6cdbfdffb38e dbtoolkit-4.2/lib/jargs-1.0.jar~
Binary file dbtoolkit-4.2/lib/jargs-1.0.jar~ has changed
diff -r 186fdc4b3310 -r 6cdbfdffb38e dbtoolkit-4.2/lib/log4j-1.2.12.jar
Binary file dbtoolkit-4.2/lib/log4j-1.2.12.jar has changed
diff -r 186fdc4b3310 -r 6cdbfdffb38e dbtoolkit-4.2/lib/utilities-3.8.7.jar
Binary file dbtoolkit-4.2/lib/utilities-3.8.7.jar has changed
diff -r 186fdc4b3310 -r 6cdbfdffb38e peptide_shaker.xml
--- a/peptide_shaker.xml Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,228 +0,0 @@
-
-
-
- Peform protein identification combining X! Tandem and OMSSA (using SearchGUI) and PeptideShaker pipeline.
-
-
- #from datetime import datetime
- #set $exp_str = "Galaxy Experiment %s" % datetime.now().strftime("%Y%m%d%H%M%s")
- #set $samp_str = "Sample %s" % datetime.now().strftime("%Y%m%d%H%M%s")
- mkdir spectra;
- mkdir output;
- mkdir output_reports;
- cwd=`pwd`;
- #for $mgf in $peak_lists:
- #set $input_name = $mgf.display_name.replace(".mgf", "") + ".mgf"
- ln -s '$mgf' 'spectra/$input_name';
- #end for
- SearchCLI \
- -spectrum_files \$cwd/spectra \
- -output_folder \$cwd/output \
- -ppm $precursor_ion_tol_units \
- -prec_tol $precursor_ion_tol \
- -frag_tol $fragment_tol \
- -enzyme '$enzyme' \
- #set $fixed_mods_str = $fixed_modifications or ''
- #set $variable_mods_str = $variable_modifications or ''
- #if $fixed_mods_str
- -fixed_mods "$fixed_mods_str" \
- #end if
- #if $variable_mods_str
- -variable_mods "$variable_mods_str" \
- #end if
- -mc $missed_cleavages \
- #if $advanced.specify:
- -xtandem $advanced.xtandem \
- #if $advanced.omssa.run_omssa
- #set $omssa = 1
- #else
- #set $omssa = 0
- #end if
- -omssa $omssa \
- #if $omssa == 1
- -hitlist_length ${advanced.omssa.hitlist_length} \
- -remove_prec ${advanced.omssa.remove_precursor} \
- -scale_prec ${advanced.omssa.scale_precursor} \
- -estimate_charge ${advanced.omssa.estimate_charge} \
- #end if
- #end if
- -db $input_database;
- PeptideShakerCLI \
- -experiment '$exp_str' \
- -sample '$samp_str' \
- -replicate 1 \
- -spectrum_files \$cwd/spectra \
- -identification_files \$cwd/output \
- -search_params \$cwd/output/SearchGUI.parameters \
- -out_txt_1 \$cwd/output_reports \
- #if $processing_options.specify
- -protein_FDR ${processing_options.protein_fdr} \
- -peptide_FDR ${processing_options.peptide_fdr} \
- -psm_FDR ${processing_options.psm_fdr} \
- -psm_FLR ${processing_options.psm_flr} \
- #if str($processing_options.a_score.use) == "1"
- #set $a_score = 1
- #else
- #set $a_score = 0
- #end if
- -a_score $a_score \
- #if str($a_score) == "1"
- -a_score_neutral_losses ${processing_options.a_score.neutral_losses} \
- #end if
- #end if
- #if $filtering_options.specify
- -min_peptide_length ${filtering_options.min_peptide_length} \
- -max_peptide_length ${filtering_options.max_peptide_length} \
- -max_precursor_error ${filtering_options.max_precursor_error} \
- -max_precursor_error_type ${filtering_options.max_precursor_error_type} \
- -max_xtandem_e ${filtering_options.max_xtandem_e} \
- -max_omssa_e ${filtering_options.max_omssa_e} \
- -exclude_unknown_ptms ${filtering_options.exclude_unknown_ptms} \
- #end if
- -out \$cwd/output.cps ;
- mv output_reports/*peptides.txt peptides.txt ;
- mv output_reports/*psms.txt psms.txt ;
- mv output_reports/*proteins.txt proteins.txt
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
- peptide_shaker
- searchgui
-
-
-**What it does**
-
-Runs multiple search engines (X! Tandem and OMSSA) on any number of MGF peak lists using the SearchGUI application and combines the results.
-
-------
-
-**Citation**
-
-For the underlying tool, please cite `TODO`
-
-If you use this tool in Galaxy, please cite Chilton J, et al. https://bitbucket.org/galaxyp/galaxyp-toolshed-peptideshaker
-
-
diff -r 186fdc4b3310 -r 6cdbfdffb38e peptideshaker.py
--- a/peptideshaker.py Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,8 +0,0 @@
-from galaxy.datatypes.binary import Binary
-
-
-class Cps(Binary):
- """Class describing a PeptideShaker CPS files"""
- file_ext = "cps"
-
-Binary.register_unsniffable_binary_ext('cps')
diff -r 186fdc4b3310 -r 6cdbfdffb38e repository_dependencies.xml
--- a/repository_dependencies.xml Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
-
-
-
-
-
-
diff -r 186fdc4b3310 -r 6cdbfdffb38e reverse.py
--- a/reverse.py Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,50 +0,0 @@
-from os.path import dirname, join, abspath
-import sys
-from optparse import OptionParser
-from ConfigParser import SafeConfigParser
-import subprocess
-
-DEBUG = False
-
-
-def main():
- (options, args) = _parse_args()
- format_args = (options.input, options.output)
- _run_shell("cat '%s' > '%s'" % format_args)
- _run_dbtoolkit("com.compomics.dbtoolkit.toolkit.ReverseFASTADB", "'%s' | head --lines -4 >> '%s'" % \
- format_args)
-
-
-def _run_shell(command):
- if DEBUG:
- print "Running shell command %s" % command
- _exec(command)
-
-
-def _run_dbtoolkit(java_class, args):
- command_prefix = "java -cp %s" % _dbtoolkit_jar_path()
- _exec("%s %s %s" % (command_prefix, java_class, args))
-
-
-def _dbtoolkit_jar_path():
- py_path = __file__
- jar_path = join(dirname(py_path), "dbtoolkit-4.2", "dbtoolkit-4.2.jar")
- return jar_path
-
-def _exec(command):
- proc = subprocess.Popen(args=command, shell=True)
- return_code = proc.wait()
- if return_code != 0:
- print "Error executing command [%s], return code is %d" % (command, return_code)
- sys.exit(return_code)
-
-
-def _parse_args():
- parser = OptionParser()
- parser.add_option("-i", "--input")
- parser.add_option("-o", "--output")
- return parser.parse_args()
-
-
-if __name__ == "__main__":
- main()
diff -r 186fdc4b3310 -r 6cdbfdffb38e reverse.xml
--- a/reverse.xml Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,32 +0,0 @@
-
- Creates a target-decoy database for use with Peptide Shaker
-
-
-
-
- reverse.py --input='$input' --output='$output'
-
-
-
-
-
-
-
-
-
-
-**What it does**
-
-Given an input database, this tool will produce a target-decoy
-database in the format required by PeptideShaker using dbtoolkit.
-
-------
-
-**Citation**
-
-For the underlying tool, please cite `Martens et al. DBToolkit: processing protein databases for peptide-centric proteomics. Bioinformatics (2005) vol. 21 (17) pp. 3584-5`.
-
-If you use this tool in Galaxy, please cite Chilton J, et al. https://bitbucket.org/galaxyp/galaxyp-toolshed-peptideshaker .
-
-
-
diff -r 186fdc4b3310 -r 6cdbfdffb38e searchGUI_mods.xml
--- a/searchGUI_mods.xml Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,3021 +0,0 @@
-
-
-
-
- 0
-
-
- 0
-
- methylation of K
- 14.015650
- 14.0266
- 0
-
- K
-
- 34
- Methyl
-
-
-
- 1
-
-
- 0
-
- oxidation of M
- 15.994915
- 15.9994
- 0
-
- M
-
- 35
- Oxidation
-
-
-
- 2
-
-
- 0
-
- carboxymethyl C
- 58.005479
- 58.0361
- 0
-
- C
-
- 6
- Carboxymethyl
-
-
-
- 3
-
-
- 0
-
- carbamidomethyl C
- 57.021464
- 57.0513
- 0
-
- C
-
- 4
- Carbamidomethyl
-
-
-
- 4
-
-
- 0
-
- deamidation of N and Q
- 0.984016
- 0.9848
- 0
-
- N
- Q
-
- 7
- Deamidated
-
-
-
- 5
-
-
- 0
-
- propionamide C
- 71.037114
- 71.0779
- 0
-
- C
-
- 24
- Propionamide
-
-
-
- 6
-
-
- 0
-
- phosphorylation of S
- 79.966331
- 79.9799
- 0
-
- S
-
- 21
- Phospho
-
-
-
- 7
-
-
- 0
-
- phosphorylation of T
- 79.966331
- 79.9799
- 0
-
- T
-
- 21
- Phospho
-
-
-
- 8
-
-
- 0
-
- phosphorylation of Y
- 79.966331
- 79.9799
- 0
-
- Y
-
- 21
- Phospho
-
-
-
- 9
-
-
- 2
-
- M cleavage from protein n-term
- -131.040485
- -131.1961
- 0
-
- M
-
- 765
- Met-loss
-
-
-
- 10
-
-
- 1
-
- acetylation of protein n-term
- 42.010565
- 42.0367
- 0
- 1
- Acetyl
-
-
-
- 11
-
-
- 1
-
- methylation of protein n-term
- 14.015650
- 14.0266
- 0
- 34
- Methyl
-
-
-
- 12
-
-
- 1
-
- tri-methylation of protein n-term
- 42.046950
- 42.0797
- 0
- 37
- Trimethyl
-
-
-
- 13
-
-
- 0
-
- beta methythiolation of D
- 45.987721
- 46.0916
- 0
-
- D
-
- 39
- Methylthio
-
-
-
- 14
-
-
- 0
-
- methylation of Q
- 14.015650
- 14.0266
- 0
-
- Q
-
- 34
- Methyl
-
-
-
- 15
-
-
- 0
-
- tri-methylation of K
- 42.046950
- 42.0797
- 0
-
- K
-
- 37
- Trimethyl
-
-
-
- 16
-
-
- 0
-
- methylation of D
- 14.015650
- 14.0266
- 0
-
- D
-
- 34
- Methyl
-
-
-
- 17
-
-
- 0
-
- methylation of E
- 14.015650
- 14.0266
- 0
-
- E
-
- 34
- Methyl
-
-
-
- 18
-
-
- 7
-
- methylation of peptide c-term
- 14.015650
- 14.0266
- 0
- 34
- Methyl
-
-
-
- 19
-
-
- 0
-
- tri-deuteromethylation of D
- 17.034480
- 17.0451
- 0
-
- D
-
- 298
- Methyl:2H(3)
-
-
-
- 20
-
-
- 0
-
- tri-deuteromethylation of E
- 17.034480
- 17.0451
- 0
-
- E
-
- 298
- Methyl:2H(3)
-
-
-
- 21
-
-
- 7
-
- tri-deuteromethylation of peptide c-term
- 17.034480
- 17.0451
- 0
- 298
- Methyl:2H(3)
-
-
-
- 22
-
-
- 1
-
- n-formyl met addition
- 159.035399
- 159.2062
- 0
- 107
- FormylMet
-
-
-
- 23
-
-
- 0
-
- 2-amino-3-oxo-butanoic acid T
- -2.015650
- -2.0159
- 0
-
- T
-
- 401
- Didehydro
-
-
-
- 24
-
-
- 0
-
- acetylation of K
- 42.010565
- 42.0367
- 0
-
- K
-
- 1
- Acetyl
-
-
-
- 25
-
-
- 7
-
- amidation of peptide c-term
- -0.984016
- -0.9848
- 0
- 2
- Amidated
-
-
-
- 26
-
-
- 0
-
- beta-methylthiolation of D (duplicate of 13)
- 45.987721
- 46.0916
- 0
-
- D
-
- 39
- Methylthio
-
-
-
- 27
-
-
- 0
-
- carboxyamidomethylation of K
- 57.021464
- 57.0513
- 0
-
- K
-
- 4
- Carbamidomethyl
-
-
-
- 28
-
-
- 0
-
- carboxyamidomethylation of H
- 57.021464
- 57.0513
- 0
-
- H
-
- 4
- Carbamidomethyl
-
-
-
- 29
-
-
- 0
-
- carboxyamidomethylation of D
- 57.021464
- 57.0513
- 0
-
- D
-
- 4
- Carbamidomethyl
-
-
-
- 30
-
-
- 0
-
- carboxyamidomethylation of E
- 57.021464
- 57.0513
- 0
-
- E
-
- 4
- Carbamidomethyl
-
-
-
- 31
-
-
- 0
-
- carbamylation of K
- 43.005814
- 43.0247
- 0
-
- K
-
- 5
- Carbamyl
-
-
-
- 32
-
-
- 5
-
- carbamylation of n-term peptide
- 43.005814
- 43.0247
- 0
-
- X
-
- 5
- Carbamyl
-
-
-
- 33
-
-
- 0
-
- citrullination of R
- 0.984016
- 0.9848
- 0
-
- R
-
- 7
- Deamidated
-
-
-
- 34
-
-
- 0
-
- oxidation of C to cysteic acid
- 47.984744
- 47.9982
- 0
-
- C
-
- 345
- Trioxidation
-
-
-
- 35
-
-
- 0
-
- di-iodination of Y
- 251.793296
- 251.7931
- 0
-
- Y
-
- 130
- Diiodo
-
-
-
- 36
-
-
- 0
-
- di-methylation of K
- 28.031300
- 28.0532
- 0
-
- K
-
- 36
- Dimethyl
-
-
-
- 37
-
-
- 0
-
- di-methylation of R
- 28.031300
- 28.0532
- 0
-
- R
-
- 36
- Dimethyl
-
-
-
- 38
-
-
- 5
-
- di-methylation of peptide n-term
- 28.031300
- 28.0532
- 0
- 36
- Dimethyl
-
-
-
- 39
-
-
- 0
-
- oxidation of F to dihydroxyphenylalanine
- 31.989829
- 31.9988
- 0
-
- F
-
- 425
- Dioxidation
-
-
-
- 40
-
-
- 0
-
- gammathiopropionylation of K
- 87.998285
- 88.1283
- 0
-
- K
-
- 126
- Thioacyl
-
-
-
- 41
-
-
- 5
-
- gammathiopropionylation of peptide n-term
- 87.998285
- 88.1283
- 0
- 126
- Thioacyl
-
-
-
- 42
-
-
- 0
-
- farnesylation of C
- 204.187801
- 204.3511
- 0
-
- C
-
- 44
- Farnesyl
-
-
-
- 43
-
-
- 0
-
- formylation of K
- 27.994915
- 28.0101
- 0
-
- K
-
- 122
- Formyl
-
-
-
- 44
-
-
- 5
-
- formylation of peptide n-term
- 27.994915
- 28.0101
- 0
- 122
- Formyl
-
-
-
- 45
-
-
- 0
-
- oxidation of W to formylkynurenin
- 31.989829
- 31.9988
- 0
-
- W
-
- 425
- Dioxidation
-
-
-
- 46
-
-
- 0
-
- fluorophenylalanine
- 17.990578
- 17.9905
- 0
-
- F
-
- 127
- Fluoro
-
-
-
- 47
-
-
- 0
-
- beta-carboxylation of D
- 43.989829
- 44.0095
- 0
-
- D
-
- 299
- Carboxy
-
-
-
- 48
-
-
- 0
-
- gamma-carboxylation of E
- 43.989829
- 44.0095
- 0
-
- E
-
- 299
- Carboxy
-
-
-
- 49
-
-
- 0
-
- geranyl-geranyl
- 272.250401
- 272.4681
- 0
-
- C
-
- 48
- GeranylGeranyl
-
-
-
- 50
-
-
- 2
-
- glucuronylation of protein n-term
- 176.032088
- 176.1241
- 0
-
- G
-
- 54
- Glucuronyl
-
-
-
- 51
-
-
- 0
-
- glutathione disulfide
- 305.068156
- 305.3076
- 0
-
- C
-
- 55
- Glutathione
-
-
-
- 52
-
-
- 0
-
- ubiquitinylation residue
- 114.042927
- 114.1026
- 0
-
- K
-
- 121
- GlyGly
-
-
-
- 53
-
-
- 0
-
- guanidination of K
- 42.021798
- 42.0400
- 0
-
- K
-
- 52
- Guanidinyl
-
-
-
- 54
-
-
- 0
-
- oxidation of H to N
- -23.015984
- -23.0366
- 0
-
- H
-
- 348
- His->Asn
-
-
-
- 55
-
-
- 0
-
- oxidation of H to D
- -22.031969
- -22.0519
- 0
-
- D
-
- 349
- His->Asp
-
-
-
- 56
-
-
- 8
-
- homoserine
- -29.992806
- -30.0922
- 0
-
- M
-
- 10
- Met->Hse
-
-
-
- 57
-
-
- 8
-
- homoserine lactone
- -48.003371
- -48.1075
- 0
-
- M
-
- 11
- Met->Hsl
-
-
-
- 58
-
-
- 0
-
- oxidation of W to hydroxykynurenin
- 19.989829
- 19.9881
- 0
-
- W
-
- 350
- Trp->Hydroxykynurenin
-
-
-
- 59
-
-
- 0
-
- hydroxylation of D
- 15.994915
- 15.9994
- 0
-
- D
-
- 35
- Oxidation
-
-
-
- 60
-
-
- 0
-
- hydroxylation of K
- 15.994915
- 15.9994
- 0
-
- K
-
- 35
- Oxidation
-
-
-
- 61
-
-
- 0
-
- hydroxylation of N
- 15.994915
- 15.9994
- 0
-
- N
-
- 35
- Oxidation
-
-
-
- 62
-
-
- 0
-
- hydroxylation of P
- 15.994915
- 15.9994
- 0
-
- P
-
- 35
- Oxidation
-
-
-
- 63
-
-
- 0
-
- hydroxylation of F
- 15.994915
- 15.9994
- 0
-
- F
-
- 35
- Oxidation
-
-
-
- 64
-
-
- 0
-
- hydroxylation of Y
- 15.994915
- 15.9994
- 0
-
- Y
-
- 35
- Oxidation
-
-
-
- 65
-
-
- 0
-
- iodination of Y
- 125.896648
- 125.8965
- 0
-
- Y
-
- 129
- Iodo
-
-
-
- 66
-
-
- 0
-
- oxidation of W to kynurenin
- 3.994915
- 3.9887
- 0
-
- W
-
- 351
- Trp->Kynurenin
-
-
-
- 67
-
-
- 0
-
- lipoyl K
- 188.032956
- 188.3103
- 0
-
- K
-
- 42
- Lipoyl
-
-
-
- 68
-
-
- 7
-
- methyl ester of peptide c-term (duplicate of 18)
- 14.015650
- 14.0266
- 0
- 34
- Methyl
-
-
-
- 69
-
-
- 0
-
- methyl ester of D
- 14.015650
- 14.0266
- 0
-
- D
-
- 34
- Methyl
-
-
-
- 70
-
-
- 0
-
- methyl ester of E (duplicate of 17)
- 14.015650
- 14.0266
- 0
-
- E
-
- 34
- Methyl
-
-
-
- 71
-
-
- 0
-
- methyl ester of S
- 14.015650
- 14.0266
- 0
-
- S
-
- 34
- Methyl
-
-
-
- 72
-
-
- 0
-
- methyl ester of Y
- 14.015650
- 14.0266
- 0
-
- Y
-
- 34
- Methyl
-
-
-
- 73
-
-
- 0
-
- methyl C
- 14.015650
- 14.0266
- 0
-
- C
-
- 34
- Methyl
-
-
-
- 74
-
-
- 0
-
- methyl H
- 14.015650
- 14.0266
- 0
-
- H
-
- 34
- Methyl
-
-
-
- 75
-
-
- 0
-
- methyl N
- 14.015650
- 14.0266
- 0
-
- N
-
- 34
- Methyl
-
-
-
- 76
-
-
- 5
-
- methylation of peptide n-term
- 14.015650
- 14.0266
- 0
- 34
- Methyl
-
-
-
- 77
-
-
- 0
-
- methyl R
- 14.015650
- 14.0266
- 0
-
- R
-
- 34
- Methyl
-
-
-
- 78
-
-
- 2
-
- myristoleylation of G
- 208.182715
- 208.3398
- 0
-
- G
-
- 134
- Myristoleyl
-
-
-
- 79
-
-
- 2
-
- myristoyl-4H of G
- 206.167065
- 206.3239
- 0
-
- G
-
- 135
- Myristoyl+Delta:H(-4)
-
-
-
- 80
-
-
- 6
-
- myristoylation of peptide n-term G
- 210.198366
- 210.3556
- 0
-
- G
-
- 45
- Myristoyl
-
-
-
- 81
-
-
- 0
-
- myristoylation of K
- 210.198366
- 210.3556
- 0
-
- K
-
- 45
- Myristoyl
-
-
-
- 82
-
-
- 1
-
- formylation of protein n-term
- 27.994915
- 28.0101
- 0
- 122
- Formyl
-
-
-
- 83
-
-
- 0
-
- NEM C
- 125.047679
- 125.1253
- 0
-
- C
-
- 108
- Nethylmaleimide
-
-
-
- 84
-
-
- 0
-
- NIPCAM
- 99.068414
- 99.1311
- 0
-
- C
-
- 17
- NIPCAM
-
-
-
- 85
-
-
- 0
-
- oxidation of W to nitro
- 44.985078
- 44.9976
- 0
-
- W
-
- 354
- Nitro
-
-
-
- 86
-
-
- 0
-
- oxidation of Y to nitro
- 44.985078
- 44.9976
- 0
-
- Y
-
- 354
- Nitro
-
-
-
- 87
-
-
- 5
-
- O18 on peptide n-term
- 2.004246
- 1.9998
- 0
- 258
- Label:18O(1)
-
-
-
- 88
-
-
- 5
-
- di-O18 on peptide n-term
- 4.00849
- 3.9995
- 0
- 193
- Label:18O(2)
-
-
-
- 89
-
-
- 0
-
- oxidation of H
- 15.994915
- 15.9994
- 0
-
- H
-
- 35
- Oxidation
-
-
-
- 90
-
-
- 0
-
- oxidation of W
- 15.994915
- 15.9994
- 0
-
- W
-
- 35
- Oxidation
-
-
-
- 91
-
-
- 0
-
- phosphopantetheine S
- 340.085794
- 340.3330
- 0
-
- S
-
- 49
- Phosphopantetheine
-
-
-
- 92
-
-
- 0
-
- palmitoylation of C
- 238.229666
- 238.4088
- 0
-
- C
-
- 47
- Palmitoyl
-
-
-
- 93
-
-
- 0
-
- palmitoylation of K
- 238.229666
- 238.4088
- 0
-
- K
-
- 47
- Palmitoyl
-
-
-
- 94
-
-
- 0
-
- palmitoylation of S
- 238.229666
- 238.4088
- 0
-
- S
-
- 47
- Palmitoyl
-
-
-
- 95
-
-
- 0
-
- palmitoylation of T
- 238.229666
- 238.4088
- 0
-
- T
-
- 47
- Palmitoyl
-
-
-
- 96
-
-
- 0
-
- phosphorylation of S with prompt loss
- -18.010565
- -18.0153
- 0
-
- S
-
- 23
- Dehydrated
-
-
-
- 97
-
-
- 0
-
- phosphorylation of T with prompt loss
- -18.010565
- -18.0153
- 0
-
- T
-
- 23
- Dehydrated
-
-
-
- 98
-
-
- 0
-
- phosphorylation with prompt loss on Y
- -18.010565
- -18.0153
- 0
-
- Y
-
- 23
- Dehydrated
-
-
-
- 99
-
-
- 0
-
- phosphorylation with neutral loss on C
- 79.966331
- 79.9799
- 0
-
- C
-
-
-
- 97.976896
- 97.9952
- 0
-
-
- 21
- Phospho
-
-
-
- 100
-
-
- 0
-
- phosphorylation with neutral loss on D
- 79.966331
- 79.9799
- 0
-
- D
-
-
-
- 97.976896
- 97.9952
- 0
-
-
- 21
- Phospho
-
-
-
- 101
-
-
- 0
-
- phosphorylation with neutral loss on H
- 79.966331
- 79.9799
- 0
-
- H
-
-
-
- 97.976896
- 97.9952
- 0
-
-
- 21
- Phospho
-
-
-
- 102
-
-
- 0
-
- propionyl light K
- 56.026215
- 56.0633
- 0
-
- K
-
- 58
- Propionyl
-
-
-
- 103
-
-
- 5
-
- propionyl light on peptide n-term
- 56.026215
- 56.0633
- 0
- 58
- Propionyl
-
-
-
- 104
-
-
- 0
-
- propionyl heavy K
- 59.036279
- 59.0412
- 0
-
- K
-
- 59
- Propionyl:13C(3)
-
-
-
- 105
-
-
- 5
-
- propionyl heavy peptide n-term
- 59.036279
- 59.0412
- 0
- 59
- Propionyl:13C(3)
-
-
-
- 106
-
-
- 0
-
- pyridyl K
- 119.037114
- 119.1207
- 0
-
- K
-
- 25
- Pyridylacetyl
-
-
-
- 107
-
-
- 5
-
- pyridyl peptide n-term
- 119.037114
- 119.1207
- 0
- 25
- Pyridylacetyl
-
-
-
- 108
-
-
- 6
-
- pyro-cmC
- -17.026549
- -17.0305
- 0
-
- C
-
- 385
- Ammonia-loss
-
-
-
- 109
-
-
- 6
-
- pyro-glu from n-term E
- -18.010565
- -18.0153
- 0
-
- E
-
- 27
- Glu->pyro-Glu
-
-
-
- 110
-
-
- 6
-
- pyro-glu from n-term Q
- -17.026549
- -17.0305
- 0
-
- Q
-
- 385
- Ammonia-loss
-
-
-
- 111
-
-
- 0
-
- oxidation of P to pyroglutamic acid
- 13.979265
- 13.9835
- 0
-
- P
-
- 359
- Pro->pyro-Glu
-
-
-
- 112
-
-
- 0
-
- s-pyridylethylation of C
- 105.057849
- 105.1372
- 0
-
- C
-
- 31
- Pyridylethyl
-
-
-
- 113
-
-
- 0
-
- SeMet
- 47.944449
- 46.8950
- 0
-
- M
-
- 162
- Delta:S(-1)Se(1)
-
-
-
- 114
-
-
- 0
-
- sulfation of Y
- 79.956815
- 80.0632
- 0
-
- Y
-
- 40
- Sulfo
-
-
-
- 115
-
-
- 0
-
- sulphone of M
- 31.989829
- 31.9988
- 0
-
- M
-
- 425
- Dioxidation
-
-
-
- 116
-
-
- 0
-
- tri-iodination of Y
- 377.689944
- 377.6896
- 0
-
- Y
-
- 131
- Triiodo
-
-
-
- 117
-
-
- 0
-
- tri-methylation of R
- 42.046950
- 42.0797
- 0
-
- R
-
- 37
- Trimethyl
-
-
-
- 118
-
-
- 6
-
- n-acyl diglyceride cysteine
- 788.725777
- 789.3049
- 0
-
- C
-
- 51
- Tripalmitate
-
-
-
- 129
-
-
- 0
-
- ICAT light
- 227.126991
- 227.2603
- 0
-
- C
-
- 105
- ICAT-C
-
-
-
- 130
-
-
- 0
-
- ICAT heavy
- 236.157185
- 236.1942
- 0
-
- C
-
- 106
- ICAT-C:13C(9)
-
-
-
- 131
-
-
- 0
-
- CAMthiopropanoyl K
- 145.019749
- 145.1796
- 0
-
- K
-
- 293
- CAMthiopropanoyl
-
-
-
- 132
-
-
- 0
-
- phosphorylation with neutral loss on S
- 79.966331
- 79.9799
- 0
-
- S
-
-
-
- 97.976896
- 97.9952
- 0
-
-
- 21
- Phospho
-
-
-
- 133
-
-
- 0
-
- phosphorylation with neutral loss on T
- 79.966331
- 79.9799
- 0
-
- T
-
-
-
- 97.976896
- 97.9952
- 0
-
-
- 21
- Phospho
-
-
-
- 134
-
-
- 0
-
- phosphorylation of S with ETD loss
- 79.966331
- 79.9799
- 0
-
- S
-
-
-
- 2.016
- 2.016
- 0
-
-
-
-
-
- 135
-
-
- 0
-
- phosphorylation of T with ETD loss
- 79.966331
- 79.9799
- 0
-
- T
-
-
-
- 2.016
- 2.016
- 0
-
-
-
-
-
- 136
-
-
- 0
-
- heavy arginine-13C6
- 6.020129
- 5.9559
- 0
-
- R
-
- 188
- Label:13C(6)
-
-
-
- 137
-
-
- 0
-
- heavy arginine-13C6-15N4
- 10.008269
- 9.9296
- 0
-
- R
-
- 267
- Label:13C(6)15N(4)
-
-
-
- 138
-
-
- 0
-
- heavy lysine-13C6
- 6.020129
- 5.9559
- 0
-
- K
-
- 188
- Label:13C(6)
-
-
-
- 139
-
-
- 6
-
- PNGasF in O18 water
- 2.988261
- 2.9845
- 0
-
- N
-
- 366
- Deamidated:18O(1)
-
-
-
- 140
-
-
- 0
-
- beta elimination of S
- -18.010565
- -18.0153
- 0
-
- S
-
- 23
- Dehydrated
-
-
-
- 141
-
-
- 0
-
- beta elimination of T
- -18.010565
- -18.0153
- 0
-
- T
-
- 23
- Dehydrated
-
-
-
- 162
-
-
- 0
-
- oxidation of C to sulfinic acid
- 31.989829
- 31.9988
- 0
-
- C
-
- 425
- Dioxidation
-
-
-
- 163
-
-
- 0
-
- arginine to ornithine
- -42.021798
- -42.0400
- 0
-
- R
-
- 372
- Arg->Orn
-
-
-
- 164
-
-
- 0
-
- dehydro of S and T
- -18.010565
- -18.0153
- 0
-
- S
- T
-
- 23
- Dehydrated
-
-
-
- 165
-
-
- 0
-
- carboxykynurenin of W
- 47.98474389
- 47.9979141
- 0
-
- W
-
-
-
-
- 166
-
-
- 0
-
- sumoylation of K
- 484.2282
- 0
- 0
-
- K
-
- 846
-
-
-
- 167
-
-
- 5
-
- iTRAQ114 on nterm
- 144.105918
- 144.1680
- 0
- 532
- iTRAQ4plex114
-
-
-
- 168
-
-
- 0
-
- iTRAQ114 on K
- 144.105918
- 144.1680
- 0
-
- K
-
- 532
- iTRAQ4plex114
-
-
-
- 169
-
-
- 0
-
- iTRAQ114 on Y
- 144.105918
- 144.1680
- 0
-
- Y
-
- 532
- iTRAQ4plex114
-
-
-
- 170
-
-
- 5
-
- iTRAQ115 on nterm
- 144.099599
- 144.1688
- 0
- 533
- iTRAQ4plex115
-
-
-
- 171
-
-
- 0
-
- iTRAQ115 on K
- 144.099599
- 144.1688
- 0
-
- K
-
- 533
- iTRAQ4plex115
-
-
-
- 172
-
-
- 0
-
- iTRAQ115 on Y
- 144.099599
- 144.1688
- 0
-
- Y
-
- 533
- iTRAQ4plex115
-
-
-
- 173
-
-
- 5
-
- iTRAQ116 on nterm
- 144.102063
- 144.1544
- 0
- 214
- iTRAQ4plex
-
-
-
- 174
-
-
- 0
-
- iTRAQ116 on K
- 144.102063
- 144.1544
- 0
-
- K
-
- 214
- iTRAQ4plex
-
-
-
- 175
-
-
- 0
-
- iTRAQ116 on Y
- 144.102063
- 144.1544
- 0
-
- Y
-
- 214
- iTRAQ4plex
-
-
-
- 176
-
-
- 5
-
- iTRAQ117 on nterm
- 144.102063
- 144.1544
- 0
- 214
- iTRAQ4plex
-
-
-
- 177
-
-
- 0
-
- iTRAQ117 on K
- 144.102063
- 144.1544
- 0
-
- K
-
- 214
- iTRAQ4plex
-
-
-
- 178
-
-
- 0
-
- iTRAQ117 on Y
- 144.102063
- 144.1544
- 0
-
- Y
-
- 214
- iTRAQ4plex
-
-
-
- 179
-
-
- 0
-
- MMTS on C
- 45.987721
- 46.0916
- 0
-
- C
-
- 39
- Methylthio
-
-
-
- 180
-
-
- 0
-
- heavy lysine - 2H4
- 4.025107
- 4.0246
- 0
-
- K
-
- 481
- Label:2H(4)
-
-
-
- 181
-
-
- 0
-
- heavy lysine - 13C6 15N2
- 8.014199
- 7.9427
- 0
-
- K
-
- 259
- Label:13C(6)15N(2)
-
-
-
- 182
-
-
- 0
-
- Asparagine HexNAc
- 203.079373
- 203.1925
- 0
-
- N
-
- 43
- HexNAc
-
-
-
- 183
-
-
- 0
-
- Asparagine dHexHexNAc
- 349.137281
- 349.3337
- 0
-
- N
-
- 142
- HexNAc(1)dHex(1)
-
-
-
- 184
-
-
- 0
-
- Serine HexNAc
- 203.079373
- 203.1925
- 0
-
- S
-
- 43
- HexNAc
-
-
-
- 185
-
-
- 0
-
- Threonine HexNAc
- 203.079373
- 203.1925
- 0
-
- T
-
- 43
- HexNAc
-
-
-
- 186
-
-
- 0
-
- palmitoleyl of S
- 236.214016
- 236.3929
- 0
-
- S
-
- 431
- Palmitoleyl
-
-
-
- 187
-
-
- 0
-
- palmitoleyl of C
- 236.214016
- 236.3929
- 0
-
- C
-
- 431
- Palmitoleyl
-
-
-
- 188
-
-
- 0
-
- palmitoleyl of T
- 236.214016
- 236.3929
- 0
-
- T
-
- 431
- Palmitoleyl
-
-
-
- 189
-
-
- 0
-
- CHD2-di-methylation of K
- 32.056407
- 32.0778
- 0
-
- K
-
- 199
- Dimethyl:2H(4)
-
-
-
- 190
-
-
- 5
-
- CHD2-di-methylation of peptide n-term
- 32.056407
- 32.0778
- 0
- 199
- Dimethyl:2H(4)
-
-
-
- 191
-
-
- 0
-
- Maleimide-PEO2-Biotin of C
- 525.225719
- 525.6183
- 0
-
- C
-
- 522
- Maleimide-PEO2-Biotin
-
-
-
- 192
-
-
- 0
-
- phosphorylation of H
- 79.966331
- 79.9799
- 0
-
- H
-
- 21
- Phospho
-
-
-
- 193
-
-
- 0
-
- oxidation of C
- 15.994915
- 15.9994
- 0
-
- C
-
- 35
- Oxidation
-
-
-
- 194
-
-
- 0
-
- oxidation of Y (duplicate of 64)
- 15.994915
- 15.9994
- 0
-
- Y
-
- 35
- Oxidation
-
-
-
- 195
-
-
- 0
-
- Uniblue A on K
- 484.039891
- 484.5016
- 0
-
- K
-
-
-
-
- 196
-
-
- 0
-
- deamidation of N
- 0.984016
- 0.9848
- 0
-
- N
-
- 7
- Deamidated
-
-
-
- 197
-
-
- 0
-
- trideuteration of L (SILAC)
- 3.018830
- 3.0185
- 0
-
- L
-
- 262
- Label:2H(3)
-
-
-
- 198
-
-
- 0
-
- TMT duplex on K
- 225.155833
- 225.2921
- 0
-
- K
-
- 738
-
-
-
- 199
-
-
- 5
-
- TMT duplex on n-term peptide
- 225.155833
- 225.2921
- 0
-
- X
-
- 738
-
-
-
- 198
-
-
- 0
-
- TMT 6-plex on K
- 229.162932
- 229.2634
- 0
-
- K
-
- 738
-
-
-
- 199
-
-
- 5
-
- TMT 6-plex on n-term peptide
- 229.162932
- 229.2634
- 0
-
- X
-
- 738
-
-
-
- 200
-
-
- 5
-
- iTRAQ8plex:13C(7)15N(1) on nterm
- 304.205360
- 304.3074
- 0
- 730
-
-
-
- 201
-
-
- 0
-
- iTRAQ8plex:13C(7)15N(1) on K
- 304.205360
- 304.3074
- 0
-
- K
-
- 730
-
-
-
- 202
-
-
- 0
-
- iTRAQ8plex:13C(7)15N(1) on Y
- 304.205360
- 304.3074
- 0
-
- Y
-
- 730
-
-
-
- 203
-
-
- 5
-
- iTRAQ8plex:13C(6)15N(2) on nterm
- 304.199040
- 304.3081
- 0
- 731
-
-
-
- 204
-
-
- 0
-
- iTRAQ8plex:13C(6)15N(2) on K
- 304.199040
- 304.3081
- 0
-
- K
-
- 731
-
-
-
- 205
-
-
- 0
-
- iTRAQ8plex:13C(6)15N(2) on Y
- 304.199040
- 304.3081
- 0
-
- Y
-
- 731
-
-
-
- 206
-
-
- 0
-
- selenocysteine
- 47.944449
- 46.8950
- 0
-
- C
-
- 162
-
-
-
- 207
-
-
- 0
-
- carboxymethylated selenocysteine
- 105.949928
- 104.9311
- 0
-
- C
-
-
-
diff -r 186fdc4b3310 -r 6cdbfdffb38e searchGUI_usermods.xml
--- a/searchGUI_usermods.xml Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,455 +0,0 @@
-
-
-
-
-
- 119
-
-
- 5
-
- dimethyl 2d n-terminus
- 32.0564
- 0
- 0
-
-
-
- 120
-
-
- 0
-
- dimethyl 2d k
- 32.0564
- 0
- 0
-
- K
-
-
-
-
- 121
-
-
- 0
-
- gtp desthiobiotinc12
- 196.121178
- 0
- 0
-
- K
-
-
-
-
- 122
-
-
- 0
-
- gtp desthiobiotinc13
- 202.141307
- 0
- 0
-
- K
-
-
-
-
- 123
-
-
- 0
-
- User modification 5
- 0
- 0
- 0
-
- X
-
-
-
-
- 124
-
-
- 0
-
- User modification 6
- 0
- 0
- 0
-
- X
-
-
-
-
- 125
-
-
- 0
-
- User modification 7
- 0
- 0
- 0
-
- X
-
-
-
-
- 126
-
-
- 0
-
- User modification 8
- 0
- 0
- 0
-
- X
-
-
-
-
- 127
-
-
- 0
-
- User modification 9
- 0
- 0
- 0
-
- X
-
-
-
-
- 128
-
-
- 0
-
- User modification 10
- 0
- 0
- 0
-
- X
-
-
-
-
- 142
-
-
- 0
-
- User modification 11
- 0
- 0
- 0
-
- X
-
-
-
-
- 143
-
-
- 0
-
- User modification 12
- 0
- 0
- 0
-
- X
-
-
-
-
- 144
-
-
- 0
-
- User modification 13
- 0
- 0
- 0
-
- X
-
-
-
-
- 145
-
-
- 0
-
- User modification 14
- 0
- 0
- 0
-
- X
-
-
-
-
- 146
-
-
- 0
-
- User modification 15
- 0
- 0
- 0
-
- X
-
-
-
-
- 147
-
-
- 0
-
- User modification 16
- 0
- 0
- 0
-
- X
-
-
-
-
- 148
-
-
- 0
-
- User modification 17
- 0
- 0
- 0
-
- X
-
-
-
-
- 149
-
-
- 0
-
- User modification 18
- 0
- 0
- 0
-
- X
-
-
-
-
- 150
-
-
- 0
-
- User modification 19
- 0
- 0
- 0
-
- X
-
-
-
-
- 151
-
-
- 0
-
- User modification 20
- 0
- 0
- 0
-
- X
-
-
-
-
- 152
-
-
- 0
-
- User modification 21
- 0
- 0
- 0
-
- X
-
-
-
-
- 153
-
-
- 0
-
- User modification 22
- 0
- 0
- 0
-
- X
-
-
-
-
- 154
-
-
- 0
-
- User modification 23
- 0
- 0
- 0
-
- X
-
-
-
-
- 155
-
-
- 0
-
- User modification 24
- 0
- 0
- 0
-
- X
-
-
-
-
- 156
-
-
- 0
-
- User modification 25
- 0
- 0
- 0
-
- X
-
-
-
-
- 157
-
-
- 0
-
- User modification 26
- 0
- 0
- 0
-
- X
-
-
-
-
- 158
-
-
- 0
-
- User modification 27
- 0
- 0
- 0
-
- X
-
-
-
-
- 159
-
-
- 0
-
- User modification 28
- 0
- 0
- 0
-
- X
-
-
-
-
- 160
-
-
- 0
-
- User modification 29
- 0
- 0
- 0
-
- X
-
-
-
-
- 161
-
-
- 0
-
- User modification 30
- 0
- 0
- 0
-
- X
-
-
-
\ No newline at end of file
diff -r 186fdc4b3310 -r 6cdbfdffb38e searchgui_mods.loc
--- a/searchgui_mods.loc Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,210 +0,0 @@
-methylation of k
-oxidation of m
-carboxymethyl c
-carbamidomethyl c
-deamidation of n and q
-propionamide c
-phosphorylation of s
-phosphorylation of t
-phosphorylation of y
-m cleavage from protein n-term
-acetylation of protein n-term
-methylation of protein n-term
-tri-methylation of protein n-term
-beta methythiolation of d
-methylation of q
-tri-methylation of k
-methylation of d
-methylation of e
-methylation of peptide c-term
-tri-deuteromethylation of d
-tri-deuteromethylation of e
-tri-deuteromethylation of peptide c-term
-n-formyl met addition
-2-amino-3-oxo-butanoic acid t
-acetylation of k
-amidation of peptide c-term
-beta-methylthiolation of d (duplicate of 13)
-carboxyamidomethylation of k
-carboxyamidomethylation of h
-carboxyamidomethylation of d
-carboxyamidomethylation of e
-carbamylation of k
-carbamylation of n-term peptide
-citrullination of r
-oxidation of c to cysteic acid
-di-iodination of y
-di-methylation of k
-di-methylation of r
-di-methylation of peptide n-term
-oxidation of f to dihydroxyphenylalanine
-gammathiopropionylation of k
-gammathiopropionylation of peptide n-term
-farnesylation of c
-formylation of k
-formylation of peptide n-term
-oxidation of w to formylkynurenin
-fluorophenylalanine
-beta-carboxylation of d
-gamma-carboxylation of e
-geranyl-geranyl
-glucuronylation of protein n-term
-glutathione disulfide
-ubiquitinylation residue
-guanidination of k
-oxidation of h to n
-oxidation of h to d
-homoserine
-homoserine lactone
-oxidation of w to hydroxykynurenin
-hydroxylation of d
-hydroxylation of k
-hydroxylation of n
-hydroxylation of p
-hydroxylation of f
-hydroxylation of y
-iodination of y
-oxidation of w to kynurenin
-lipoyl k
-methyl ester of peptide c-term (duplicate of 18)
-methyl ester of d
-methyl ester of e (duplicate of 17)
-methyl ester of s
-methyl ester of y
-methyl c
-methyl h
-methyl n
-methylation of peptide n-term
-methyl r
-myristoleylation of g
-myristoyl-4h of g
-myristoylation of peptide n-term g
-myristoylation of k
-formylation of protein n-term
-nem c
-nipcam
-oxidation of w to nitro
-oxidation of y to nitro
-o18 on peptide n-term
-di-o18 on peptide n-term
-oxidation of h
-oxidation of w
-phosphopantetheine s
-palmitoylation of c
-palmitoylation of k
-palmitoylation of s
-palmitoylation of t
-phosphorylation of s with prompt loss
-phosphorylation of t with prompt loss
-phosphorylation with prompt loss on y
-phosphorylation with neutral loss on c
-phosphorylation with neutral loss on d
-phosphorylation with neutral loss on h
-propionyl light k
-propionyl light on peptide n-term
-propionyl heavy k
-propionyl heavy peptide n-term
-pyridyl k
-pyridyl peptide n-term
-pyro-cmc
-pyro-glu from n-term e
-pyro-glu from n-term q
-oxidation of p to pyroglutamic acid
-s-pyridylethylation of c
-semet
-sulfation of y
-sulphone of m
-tri-iodination of y
-tri-methylation of r
-n-acyl diglyceride cysteine
-icat light
-icat heavy
-camthiopropanoyl k
-phosphorylation with neutral loss on s
-phosphorylation with neutral loss on t
-phosphorylation of s with etd loss
-phosphorylation of t with etd loss
-heavy arginine-13c6
-heavy arginine-13c6-15n4
-heavy lysine-13c6
-pngasf in o18 water
-beta elimination of s
-beta elimination of t
-oxidation of c to sulfinic acid
-arginine to ornithine
-dehydro of s and t
-carboxykynurenin of w
-sumoylation of k
-itraq114 on nterm
-itraq114 on k
-itraq114 on y
-itraq115 on nterm
-itraq115 on k
-itraq115 on y
-itraq116 on nterm
-itraq116 on k
-itraq116 on y
-itraq117 on nterm
-itraq117 on k
-itraq117 on y
-mmts on c
-heavy lysine - 2h4
-heavy lysine - 13c6 15n2
-asparagine hexnac
-asparagine dhexhexnac
-serine hexnac
-threonine hexnac
-palmitoleyl of s
-palmitoleyl of c
-palmitoleyl of t
-chd2-di-methylation of k
-chd2-di-methylation of peptide n-term
-maleimide-peo2-biotin of c
-phosphorylation of h
-oxidation of c
-oxidation of y (duplicate of 64)
-uniblue a on k
-deamidation of n
-trideuteration of l (silac)
-tmt duplex on k
-tmt duplex on n-term peptide
-tmt 6-plex on k
-tmt 6-plex on n-term peptide
-itraq8plex:13c(7)15n(1) on nterm
-itraq8plex:13c(7)15n(1) on k
-itraq8plex:13c(7)15n(1) on y
-itraq8plex:13c(6)15n(2) on nterm
-itraq8plex:13c(6)15n(2) on k
-itraq8plex:13c(6)15n(2) on y
-selenocysteine
-carboxymethylated selenocysteine
-dimethyl 2d n-terminus
-dimethyl 2d k
-gtp desthiobiotinc12
-gtp desthiobiotinc13
-user modification 5
-user modification 6
-user modification 7
-user modification 8
-user modification 9
-user modification 10
-user modification 11
-user modification 12
-user modification 13
-user modification 14
-user modification 15
-user modification 16
-user modification 17
-user modification 18
-user modification 19
-user modification 20
-user modification 21
-user modification 22
-user modification 23
-user modification 24
-user modification 25
-user modification 26
-user modification 27
-user modification 28
-user modification 29
-user modification 30
diff -r 186fdc4b3310 -r 6cdbfdffb38e searchgui_mods.loc.sample
--- a/searchgui_mods.loc.sample Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,210 +0,0 @@
-methylation of k
-oxidation of m
-carboxymethyl c
-carbamidomethyl c
-deamidation of n and q
-propionamide c
-phosphorylation of s
-phosphorylation of t
-phosphorylation of y
-m cleavage from protein n-term
-acetylation of protein n-term
-methylation of protein n-term
-tri-methylation of protein n-term
-beta methythiolation of d
-methylation of q
-tri-methylation of k
-methylation of d
-methylation of e
-methylation of peptide c-term
-tri-deuteromethylation of d
-tri-deuteromethylation of e
-tri-deuteromethylation of peptide c-term
-n-formyl met addition
-2-amino-3-oxo-butanoic acid t
-acetylation of k
-amidation of peptide c-term
-beta-methylthiolation of d (duplicate of 13)
-carboxyamidomethylation of k
-carboxyamidomethylation of h
-carboxyamidomethylation of d
-carboxyamidomethylation of e
-carbamylation of k
-carbamylation of n-term peptide
-citrullination of r
-oxidation of c to cysteic acid
-di-iodination of y
-di-methylation of k
-di-methylation of r
-di-methylation of peptide n-term
-oxidation of f to dihydroxyphenylalanine
-gammathiopropionylation of k
-gammathiopropionylation of peptide n-term
-farnesylation of c
-formylation of k
-formylation of peptide n-term
-oxidation of w to formylkynurenin
-fluorophenylalanine
-beta-carboxylation of d
-gamma-carboxylation of e
-geranyl-geranyl
-glucuronylation of protein n-term
-glutathione disulfide
-ubiquitinylation residue
-guanidination of k
-oxidation of h to n
-oxidation of h to d
-homoserine
-homoserine lactone
-oxidation of w to hydroxykynurenin
-hydroxylation of d
-hydroxylation of k
-hydroxylation of n
-hydroxylation of p
-hydroxylation of f
-hydroxylation of y
-iodination of y
-oxidation of w to kynurenin
-lipoyl k
-methyl ester of peptide c-term (duplicate of 18)
-methyl ester of d
-methyl ester of e (duplicate of 17)
-methyl ester of s
-methyl ester of y
-methyl c
-methyl h
-methyl n
-methylation of peptide n-term
-methyl r
-myristoleylation of g
-myristoyl-4h of g
-myristoylation of peptide n-term g
-myristoylation of k
-formylation of protein n-term
-nem c
-nipcam
-oxidation of w to nitro
-oxidation of y to nitro
-o18 on peptide n-term
-di-o18 on peptide n-term
-oxidation of h
-oxidation of w
-phosphopantetheine s
-palmitoylation of c
-palmitoylation of k
-palmitoylation of s
-palmitoylation of t
-phosphorylation of s with prompt loss
-phosphorylation of t with prompt loss
-phosphorylation with prompt loss on y
-phosphorylation with neutral loss on c
-phosphorylation with neutral loss on d
-phosphorylation with neutral loss on h
-propionyl light k
-propionyl light on peptide n-term
-propionyl heavy k
-propionyl heavy peptide n-term
-pyridyl k
-pyridyl peptide n-term
-pyro-cmc
-pyro-glu from n-term e
-pyro-glu from n-term q
-oxidation of p to pyroglutamic acid
-s-pyridylethylation of c
-semet
-sulfation of y
-sulphone of m
-tri-iodination of y
-tri-methylation of r
-n-acyl diglyceride cysteine
-icat light
-icat heavy
-camthiopropanoyl k
-phosphorylation with neutral loss on s
-phosphorylation with neutral loss on t
-phosphorylation of s with etd loss
-phosphorylation of t with etd loss
-heavy arginine-13c6
-heavy arginine-13c6-15n4
-heavy lysine-13c6
-pngasf in o18 water
-beta elimination of s
-beta elimination of t
-oxidation of c to sulfinic acid
-arginine to ornithine
-dehydro of s and t
-carboxykynurenin of w
-sumoylation of k
-itraq114 on nterm
-itraq114 on k
-itraq114 on y
-itraq115 on nterm
-itraq115 on k
-itraq115 on y
-itraq116 on nterm
-itraq116 on k
-itraq116 on y
-itraq117 on nterm
-itraq117 on k
-itraq117 on y
-mmts on c
-heavy lysine - 2h4
-heavy lysine - 13c6 15n2
-asparagine hexnac
-asparagine dhexhexnac
-serine hexnac
-threonine hexnac
-palmitoleyl of s
-palmitoleyl of c
-palmitoleyl of t
-chd2-di-methylation of k
-chd2-di-methylation of peptide n-term
-maleimide-peo2-biotin of c
-phosphorylation of h
-oxidation of c
-oxidation of y (duplicate of 64)
-uniblue a on k
-deamidation of n
-trideuteration of l (silac)
-tmt duplex on k
-tmt duplex on n-term peptide
-tmt 6-plex on k
-tmt 6-plex on n-term peptide
-itraq8plex:13c(7)15n(1) on nterm
-itraq8plex:13c(7)15n(1) on k
-itraq8plex:13c(7)15n(1) on y
-itraq8plex:13c(6)15n(2) on nterm
-itraq8plex:13c(6)15n(2) on k
-itraq8plex:13c(6)15n(2) on y
-selenocysteine
-carboxymethylated selenocysteine
-dimethyl 2d n-terminus
-dimethyl 2d k
-gtp desthiobiotinc12
-gtp desthiobiotinc13
-user modification 5
-user modification 6
-user modification 7
-user modification 8
-user modification 9
-user modification 10
-user modification 11
-user modification 12
-user modification 13
-user modification 14
-user modification 15
-user modification 16
-user modification 17
-user modification 18
-user modification 19
-user modification 20
-user modification 21
-user modification 22
-user modification 23
-user modification 24
-user modification 25
-user modification 26
-user modification 27
-user modification 28
-user modification 29
-user modification 30
diff -r 186fdc4b3310 -r 6cdbfdffb38e test-data/._tinyoutput.cps
Binary file test-data/._tinyoutput.cps has changed
diff -r 186fdc4b3310 -r 6cdbfdffb38e test-data/tinydb.fasta
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/tinydb.fasta Wed Jun 25 11:49:19 2014 -0400
@@ -0,0 +1,24 @@
+>cds.comp107265_c0_seq1|m.36816 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 30.94 EValue:9.0e-68
+LKSSFESSFSIKSRDVTFGNSMNITMVPPELEFFKDNRHKEKSEMQDLNTRLESYLSVGKDDSDANLKLMQELEEIKNGIKTETNNIKATFEAELGQLKNLLDDIDHDKNQVIVIGDNNDEMYKDLEQRIKNYNDMEMIHLSKIRQLDNLLSNYGLKMNQLQKKIGFLCEEKDRDIESINKLRADIDVAKNDLSNEILLRTDAQNRCQSLEEDIEFTKEVHQRELSNMIALADYDPVSQSMDWWNDEFARCIKEIQDEYEDRLNNIQYDMDSHYNSKIQDVETTILQSSAKSEMLDQCSMLENSNAEIEDQTSELEKKNAMLKEQNDLLNRGIREIQSQFETLITEKQSEMLEIRKHFEQSLADLQAIVDDNLSLQMEIMSYKKLLECEELRVGIYPESNANENQGDQGQRQNEQITEPITETIPKRKKPERKISYQRSSKGPLTISECKSDGSYILIENMDQYDGQNLGGWRLVQNVDGMEEYDYTFSRYYLGPGESVKIWAENAGPKGVNDLVWDDLKCLGIGEKVITSLMNQKGKEKSSYTQKAIYKV
+>cds.comp307584_c0_seq2|m.40556 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 39.47 EValue:1.0e-14
+DDNYDSLQYSFPKSDHQRKTTYQRSAKGPITITRVQPDGSYIEIENTNIAVNEDISGWKMVQCTDDKIYEYIFDDHVLNGGTCVKIWANGLSGKEENDLVWIDRTCLTTGSVVTTTLMDYNGNEKATFTQ
+>cds.comp376950_c0_seq1|m.42080 RecName: Full=60 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 41.38 EValue:1.0e-32
+KELEDINEDNLGRLRRQDEDVSNYEAQNASLRRKCDNLQADKDRDRNNVEKLKGEVTSLRNDLMMETVSRIDSQNKCQTLREELEFLKDIHSQELKELSPTLGKDPFAKSKEWWSSEFSNCIREIQEEYDNRLDSIKTDMDNYYTLKVQEIQTGAAR
+>cds.comp41779_c0_seq1|m.9429 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 30.62 EValue:7.0e-67
+METTKERKEKSTVVTKRQSMGATAHVQPKFIQVNRRSHVVGAGLGGGSMGSMNQSMSLHGGRASLGMAAGVAGGIATKDMGTMKVKREGEKKDMQNLNDRFAGYIAKVRSLQAENEQLRLKLSKKRREFDVEPLKEAYQAEIDEAKNLLLDANKENGELKISITTYEEEIEDLHATARINEDRIDELQDKVNKLIDENSHREAECSMLHKKLDELEKQVAHWRAKYNEVNTQLQATRADLKDETQQRIFLQQKVGNLEEELEFLRSVTDAEIKEYKAMLSKEDDTGTNVSAAWNNEMSNCMKELREEYDQRLADISDEMSARYESQLSQIRQSAHAEPVAAVHTKSEKSTGMVSVQKDMRIKELESQLERMKMEIITITNQLQRSNEDLENEKDLRTTEVNKLHVEMESMIEELQMLMDAKLSLELEIAAYRKLLEGEENRISTGYITENIGGFRSEAGDNLANILEFGSGGGGGGGGGGSGSGSGSGLAGDSASTSTLTGRLTIQRSSKSVISIGEVESEGQYVTLENTSSGRSKTSVNMKGWKLDRLISATSISPEHKIDFLFKDPVVLEGEQSIKIWAKNYQKMAKKGDIIATVDEWGPVNRNSVFSLYDEKDALKANLSTKVVT
+>cds.comp41779_c0_seq2|m.9432 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 30.75 EValue:3.0e-67
+METTKERKEKSTVVTKRQSMGATAHVQPKFIQVNRRSHVVGAGLGGGSMGSMNQSMSLHGGRASLGMAAGVAGGIATKDMGTMKVKREGEKKDMQNLNDRFAGYIAKVRSLQAENEQLRLKLSKKRREFDVEPLKEAYQAEIDEAKNLLLDANKENGELKISITTYEEEIEDLHATARINEDRIDELQDKVNKLIDENSHREAECSMLHKKLDELEKQVAHWRAKYNEVNTQLQATRADLKDETQQRIFLQQKVGNLEEELEFLRSVTDAEIKEYKAMLSKEDDTGTNVSAAWNNEMSNCMKELREEYDQRLADISDEMSARYESQLSQIRQSAHAEPVAAVHTKSEKSTGMVSVQKDMRIKELESQLERMKMEIITITNQLQRSNEDLENEKDLRTTEVNKLHVEMESMIEELQMLMDAKLSLELEIAAYRKLLEGEENRISTGYITENIGGFRSEAGDNLANILEFGSGGGGGGGGGGSGSGSGSGLAGDSGRLTIQRSSKSVISIGEVESEGQYVTLENTSSGRSKTSVNMKGWKLDRLISATSISPEHKIDFLFKDPVVLEGEQSIKIWAKNYQKMAKKGDIIATVDEWGPVNRNSVFSLYDEKDALKANLSTKVVT
+>cds.comp41779_c0_seq3|m.9435 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 31.94 EValue:4.0e-10
+SGLAGDSDTMRASTSTLTGRLTIQRSSKSVISIGEVESEGQYVTLENTSSGRSKTSVNMKGWKLDRLISATSISPEHKIDFLFKDPVVLEGEQSIKIWAKNYQKMAKKGDIIATVDEWGPVNRNSVFSLYDEKDALKANLSTKVVT
+>cds.comp41890_c0_seq1|m.9546 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 38.58 EValue:4.0e-20
+YQSPTPALVKGELQEHSTYRKNNKGPVAISETDRDGSFILLENTSNSHTVDLSGWKIMQNSDNIDISEYEIENLVLKPGGFAKVWANGMGDPNSGDLVWHNKSRLGVGAKVNTVLLNTRGDEKATYNLETTYNL
+>cds.comp52727_c0_seq1|m.18670 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 34.52 EValue:1.0e-91
+MEKQGVETRQTVTTSRQSVNYKPFTQSKNIVINRVSLSPGTAMSTMQRSRSSMSSGLGLGGHLQAGVLGNISHKGVASMKLKREGEKKELQDLNERLANFIEQARFLEAENKALRDALNKSKKDFDPEPLKQMYQIEINEAKKLLDDANNDNGNLKVRINTLEDELEDLRAQLRHSNDVNDQLQNNIDTLNDDIARRIADNEMLKRKVQELEKQLADWKAKYAHVDTQLQGLRIDLQEETCQRLAESTRAQALEEELNFLRSVTDAEIKEYKAMLMKEDNVPQMREYWNNELSKCMREIRDEYDNQLNLLSADLESKYQVQLNEIRLGATKGNAESAQASEENRRLRSQITDKDSHMMDLQSQIDKLKSQVHLLTSELDSTTAELDNEKTLRVSEVQKLNTELEGVIKELQLLMDAKLSLELEIAAYRKLLEVEENRLSIGSMTQMVGGYRGQTEDALANILERSGASFEASSSMGESGTTSITTGRVTMQRSSKGVISIAEVDNTGRYVTLDNTSTTRMKRLQNLKGWKIKREFIRTNSLQELSFEYIINRDTSLDAQQNIRVWAKNFEKDPEIKPDDIISSVADWGQVNRNSIITLYDENGVEKATLTIKVVF
+>cds.comp52727_c0_seq2|m.18672 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 35.0 EValue:3.0e-92
+MEKQGVETRQTVTTSRQSVNYKPFTQSKNIVINRVSLSPGTAMSTMQRSRSSMSSGLGLGGHLQAGVLGNISHKGVASMKLKREGEKKELQDLNERLANFIEQARFLEAENKALRDALNKSKKDFDPEPLKQMYQIEINEAKKLLDDANNDNGNLKVRINTLEDELEDLRAQLRHSNDVNDQLQNNIDTLNDDIARRIADNEMLKRKVQELEKQLADWKAKYAHVDTQLQGLRIDLQEETCQRLAESTRAQALEEELNFLRSVTDAEIKEYKAMLMKEDNVPQMREYWNNELSKCMREIRDEYDNQLNLLSADLESKYQVQLNEIRLGATKGNAESAQASEENRRLRSQITDKDSHMMDLQSQIDKLKSQVHLLTSELDSTTAELDNEKTLRVSEVQKLNTELEGVIKELQLLMDAKLSLELEIAAYRKLLEVEENRLSIGSMTQMVGGYRGQTEDALANILERSGASFEASSSMGESGRVTMQRSSKGVISIAEVDNTGRYVTLDNTSTTRMKRLQNLKGWKIKREFIRTNSLQELSFEYIINRDTSLDAQQNIRVWAKNFEKDPEIKPDDIISSVADWGQVNRNSIITLYDENGVEKATLTIKVVF
+>cds.comp55448_c0_seq1|m.24261 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 96.04 EValue:0.0
+MRRIKKKITLDVRVTELIDQLERQQKELEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDELEKLRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLRSNMNEVRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRVGMKQIVEQVVGARPNEAEVLSSILTRSEGGYEATGDSQISMKMMRGELAAKTTYQRTSKGPVSIKEADSQGQFIALETKKEENITGWKIVRKVDDNMVYSYEIPNVVLKTGTVIKIWSKSHQAQARGDDIVSRENDTWGTGSNVVTILQNEKGEEKANYTQNTVYQ
+>cds.comp55448_c0_seq1|m.24262 RecName: Full=60 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 91.49 EValue:5.0e-87
+MSGGFSYSAKIHPRTGYVSRTSQSPYRSSMGSNAAFTRSYEFNYGATAMPGAYANISSTGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKNYLGRESN
+>cds.comp8310_c0_seq2|m.1138 RecName: Full=70 kDa neurofilament protein; 1051067 GO:0005882 GO:0005198 Identity: 22.01 EValue:2.0e-16
+FKDTCIRDKTDMKGLNERLSEFIEVARYNAILAKKLEKTIKRFHSQEIPEDVERIYEATIKKLRKLLVVFENERDNERAKNLKLQTECAKLKESLEDLKAKEIENRDRLISKFKILEDLQSKAIRIEKNIEIVAEENVLKNNKIEKLKKHFENLKSKITSERRNRSTHKESYDEVKEDFGIFKELKNQQLSSVRFPKYKDSIKYLRKQWSNEFSKCIKELQNEYESRVSSVKEELESNYCTKTEEIQNYVLKSNYESDFLKNRNLVAEESMNMLKNKFKEAKKENVLLNHEKEELEIEFNKSKNEYDHLAEEKNNEILNFKEYAEKILIQLTEILEINNHLQFEIEYYKTVITSGETKIDFDFDGLDDECMTSINSELP
diff -r 186fdc4b3310 -r 6cdbfdffb38e test-data/tinyoutput.cps
Binary file test-data/tinyoutput.cps has changed
diff -r 186fdc4b3310 -r 6cdbfdffb38e test-data/tinyspectra.mgf
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/tinyspectra.mgf Wed Jun 25 11:49:19 2014 -0400
@@ -0,0 +1,6153 @@
+BEGIN IONS
+TITLE= Cmpd 636, +MSn(730.3981), 66.9 min
+PEPMASS=730.39814 92569
+CHARGE=2+
+156.06738 122
+175.10440 1049
+186.08322 120
+187.12501 241
+188.06515 494 1+
+193.09503 180
+197.12522 208
+199.17309 1374 1+
+204.08687 454 1+
+213.14347 128
+215.11998 747 1+
+227.17167 1524 1+
+229.12416 156
+233.09327 3574 1+
+236.99586 113
+243.14264 571 1+
+244.07481 236
+245.12901 240
+246.12647 275
+256.20038 432 1+
+258.12496 133
+260.19976 423
+261.09190 17853 1+
+270.16206 114
+274.12614 207
+283.15366 136
+284.18559 406 1+
+286.14626 237
+287.10013 105
+301.15759 131
+303.17924 2962 1+
+310.21264 944 1+
+315.13250 122
+316.16696 108
+326.16601 145
+328.21268 874 1+
+335.13393 406 1+
+338.20704 186
+339.16449 110
+342.17857 106
+344.13585 148
+346.17426 809 1+
+356.21762 685 1+
+358.15839 265
+359.26213 106
+362.14671 528 1+
+366.16564 103
+370.14930 136
+374.17893 18824 1+
+380.20460 141
+384.22488 193
+387.21562 161
+388.26191 188
+411.26204 166
+415.22868 119
+416.26432 2092 1+
+421.21633 119
+423.29102 378 1+
+425.19591 120
+429.24479 213
+430.23711 292
+431.20421 187
+436.18404 103
+436.75217 164
+437.24576 210
+439.24189 686 1+
+441.27348 282
+442.22757 266
+443.24151 187
+447.25851 136
+448.23776 110
+451.24187 133
+454.21183 186
+455.28038 426 1+
+457.22899 1666 1+
+459.26367 3533 1+
+470.24566 153
+471.25916 214
+472.22369 149
+475.22776 2402 1+
+476.74146 108
+478.76406 148
+479.26444 182
+481.79718 109
+482.23965 265
+484.28349 122
+485.26864 194
+487.26385 8530 1+
+487.76699 2322 2+
+492.79121 214
+493.27987 223
+496.25943 155
+498.26458 113
+499.26123 188
+500.25926 116
+502.31880 144
+503.29803 113
+505.25694 134
+507.23129 148
+509.26114 112
+512.29082 270
+516.25599 158
+517.20915 133
+517.28047 196
+518.26358 209
+519.25298 141
+524.32901 134
+525.28341 246
+525.73648 129
+526.28178 183
+527.27825 442 1+
+530.27675 144
+531.28549 121
+533.28116 104
+534.11078 105
+534.80853 658 2+
+536.27223 192
+537.26164 134
+538.59905 107
+539.27286 106
+540.27423 189
+541.25963 119
+542.30271 822 1+
+543.81900 3982 2+
+544.31230 3061 1+
+546.73644 112
+550.76990 117
+551.22357 107
+552.32208 662 1+
+555.31596 235
+556.27474 176
+558.29453 154
+559.29947 142
+560.30729 1143 1+
+567.24429 116
+569.25892 228
+570.29732 7469 1+
+575.31645 290
+580.32039 169
+584.32568 221
+585.29844 155
+588.30437 6069 1+
+591.34398 1900 2+
+593.19489 103
+594.32473 103
+598.30327 171
+600.36464 3642 2+
+602.30487 970 1+
+608.28169 160
+609.27493 133
+614.83731 112
+615.27771 193
+617.30438 138
+618.32896 149
+619.33485 160
+620.31542 115
+620.81406 230
+622.32210 208
+623.32017 135
+624.28638 129
+626.34792 207
+628.34041 189
+629.25299 114
+630.37407 171
+632.31114 124
+634.29651 120
+636.28359 105
+637.35608 222
+638.34750 245
+639.34410 173
+641.33612 839 1+
+646.33654 117
+647.19559 1433 1+
+649.19722 1100 1+
+651.31229 136
+653.31813 227
+654.33373 187
+655.38010 176
+656.35127 649 1+
+658.36493 6652 1+
+664.87410 264
+665.36702 578 1+
+668.36277 108
+669.88900 118
+671.36838 605 1+
+673.38354 533 1+
+674.31604 138
+680.33315 119
+682.86635 152
+683.37863 4557 1+
+689.35741 806 1+
+693.34598 140
+695.38537 116
+696.37550 112
+697.39934 146
+698.39359 132
+699.36352 115
+701.38282 1437 1+
+706.39934 164
+707.37693 151
+707.86433 178
+710.37380 213
+712.37982 250
+712.89070 251
+713.37280 260
+713.88658 123
+715.37058 153
+716.18442 4201 1+
+716.77672 108
+718.18321 2451 1+
+718.88287 2231 2+
+720.98962 121
+721.39031 3707 2+
+724.88574 175
+725.39311 174
+725.86419 119
+726.38179 168
+726.88029 279
+727.39635 1151 2+
+729.38218 580
+729.89636 3472 1+
+730.39870 7202 2+
+733.22310 218
+733.30736 209
+733.86699 2221 2+
+734.87807 2000 2+
+737.41263 157
+738.38323 548 1+
+741.39676 215
+742.38824 893 1+
+748.42865 106
+757.40883 110
+759.41390 16956 1+
+766.39835 135
+768.40610 123
+773.41497 135
+775.43074 138
+779.38031 110
+784.42558 899 1+
+787.90750 114
+788.43303 156
+802.43422 958 1+
+818.92372 110
+819.43952 106
+830.50628 147
+838.45103 121
+855.49252 207
+866.39951 113
+872.50085 6571 1+
+880.44367 148
+886.46997 133
+891.44688 208
+899.47954 151
+912.47926 133
+914.49331 112
+916.46838 134
+924.48363 139
+926.42073 111
+955.52131 165
+956.52827 785 1+
+973.55087 13950 1+
+978.51217 225
+979.51564 116
+980.49756 186
+1008.48933 103
+1044.54839 219
+1068.60979 255 1+
+1086.63071 4224 1+
+1187.60270 135
+1199.72200 1064 1+
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 67, +MSn(562.2947), 26.3 min
+PEPMASS=562.29468 458049
+CHARGE=2+
+173.10446 888
+175.10614 7500 1+
+179.03885 2115 1+
+181.05013 1444
+185.10363 748
+188.09581 546
+189.08230 1123
+191.10888 1205
+193.08988 20362 1+
+197.12012 1004
+198.08421 1715
+199.08156 3683 1+
+201.11270 1482
+202.08307 5961 1+
+204.12828 1144
+207.10914 5879 1+
+212.09747 547
+214.14801 786
+215.13458 1085
+216.09374 15154 1+
+219.10360 3767 1+
+221.09583 10438 1+
+225.12049 686
+227.09977 1455
+229.09603 679
+230.09470 604
+234.13140 812
+235.10913 3141 1+
+240.12624 583
+242.14853 1597
+243.13141 1136
+243.63267 1229 2+
+246.14582 824
+247.10615 2963 1+
+249.12485 2272 1+
+251.09894 784
+258.11066 836
+260.12524 538
+262.12141 584
+263.11268 636
+265.12053 103781 1+
+271.17377 1450
+272.15453 573
+274.12336 539
+275.11834 708
+276.09317 1249
+277.14342 854
+280.13885 636
+284.15463 954
+287.13794 562
+288.18831 7132 2+
+289.19895 1160
+290.11827 4566 1+
+292.12562 712
+293.11785 69474 1+
+300.14093 627
+304.16113 1144
+306.14825 620
+308.12685 9469 1+
+308.69190 3688 2+
+311.16807 1795
+312.16397 1139
+314.10629 664
+318.14640 1024
+321.66995 1635
+327.13385 5132 1+
+329.18522 5655 1+
+330.67072 637
+332.18505 1032
+333.18476 663
+335.13067 608
+336.15792 840
+339.67673 1005 2+
+344.15007 889
+345.15213 4010 1+
+351.18768 4419 1+
+355.13808 828
+356.17043 621
+357.18025 719
+358.16658 563
+361.17543 1147
+362.15427 4190 1+
+363.72203 3811
+364.20914 3218 2+
+371.19073 760
+372.72285 2668 2+
+375.19700 3108 2+
+376.19553 564
+379.17827 2873 2+
+380.15890 12301 1+
+384.21017 5097 2+
+388.19333 571
+389.70908 625
+390.20740 592
+391.19383 935
+392.16591 729
+395.20382 1623
+397.17996 3655 2+
+398.21650 6989 2+
+404.20531 1679
+405.20451 648
+406.20004 871
+407.23483 3907
+407.72953 7744 2+
+409.19414 3554 1+
+412.21632 855
+413.21323 2691 2+
+415.20292 594
+416.24330 17092 2+
+418.22634 576
+419.20423 1028
+421.20851 587
+422.21092 764
+423.20934 713
+427.20492 813
+428.16738 688
+429.70811 698
+430.23256 912
+431.73361 1035
+432.22171 968
+433.22466 1062
+434.22575 625
+437.19018 1766
+437.70624 844
+438.20626 708
+438.72150 4563 2+
+440.22185 3932 1+
+444.21463 1090
+445.20585 995
+446.18388 773
+447.22090 850
+447.72488 15238 2+
+451.22638 610
+452.25000 1142
+453.24346 537
+453.74918 661
+454.23077 5371 2+
+456.23340 746
+456.72936 1991 2+
+458.22230 3870 1+
+461.16717 1481
+462.21058 1210
+462.75299 32114 2+
+467.23212 705
+468.23541 868
+469.23311 912
+471.75085 2992 2+
+473.18561 1671
+474.18911 847
+475.25224 1171
+476.24847 7765 2+
+477.24608 1292
+480.22910 1603
+480.76227 2464 2+
+482.23306 595
+484.20956 682
+485.27210 936
+485.75948 6878 2+
+486.25807 6262 1+
+490.20675 12478 1+
+495.23849 541
+496.24307 922
+498.23260 594
+500.23943 811
+500.74355 799
+501.24660 1342
+501.75096 767
+502.23819 884
+502.75774 1142
+503.29629 97816 1+
+506.77634 937
+508.21508 7010 1+
+510.25588 4848 1+
+513.25831 729
+514.27402 607
+515.27095 609
+516.28189 537
+517.25442 1057
+518.25007 538
+519.24078 613
+520.24934 791
+521.25847 869
+522.26590 547
+525.25538 703
+526.26034 1210
+527.29422 8151 1+
+533.26970 1046
+534.26291 800
+535.27080 1196
+535.77587 1190
+536.26276 1367
+536.76878 648
+537.25293 646
+538.25073 1260
+539.28017 612
+539.77084 658
+540.26114 696
+541.27313 648
+543.27369 589
+544.28397 3621
+544.77706 12851 2+
+547.31924 1572
+548.30436 1053
+548.77028 1441
+549.26783 974
+551.27120 606
+553.28974 18838 2+
+556.24380 1017
+557.27702 1007
+557.77103 8323 2+
+559.28097 1288
+559.78464 926
+560.29805 5478 1+
+561.29757 15114 1+
+561.81158 1177
+562.29457 15730 2+
+564.83168 892
+565.33570 23486 1+
+565.82267 7693 2+
+569.28499 554
+573.26338 1027
+575.36935 2237 1+
+577.29711 19918 1+
+585.28764 707
+586.26526 885
+593.29456 4026 1+
+597.28990 684
+598.35983 1347
+599.34599 3235 1+
+603.27890 4807 1+
+609.33013 725
+609.83310 554
+616.37652 80669 1+
+621.30217 7218 1+
+626.35600 739
+630.34615 639
+631.28837 656
+634.31334 979
+638.82604 771
+639.30650 830
+640.32500 648
+641.37035 821
+642.32980 1346
+643.32755 574
+647.30833 1395
+648.30970 855
+657.35993 790
+658.31601 805
+659.31744 547
+660.32673 1395
+661.32915 982
+663.32964 646
+664.29941 618
+678.34617 30703 1+
+688.32596 637
+690.31904 640
+691.32139 4076 1+
+698.38384 5422 1+
+723.87438 588
+724.36414 728
+726.40991 944
+727.41101 8337 1+
+744.43842 30248 1+
+749.38673 1066 1+
+752.39235 798
+757.34926 1237 1+
+769.38486 632
+776.45851 4801 1+
+780.37732 723
+781.36751 595
+784.43240 550
+793.35265 293 1+
+795.42573 1882 1+
+807.40774 1432
+813.46325 3193
+814.45178 9778 1+
+825.41918 13786 1+
+831.47933 145010 1+
+876.43573 1256 1+
+880.45054 717
+894.44249 2606 1+
+906.45477 635
+912.45145 16141 1+
+924.49870 3138 1+
+934.46152 1295
+935.45377 568
+942.49443 7444 1+
+951.48967 455 1+
+960.51726 19263 1+
+970.51168 1274 1+
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 357, +MSn(687.8723), 46.6 min
+PEPMASS=687.87224 60013
+CHARGE=2+
+159.07712 143
+173.11274 328 1+
+175.08239 118
+186.07972 534 1+
+188.13001 187
+189.05530 214
+197.09078 133
+201.11035 396
+203.10057 87
+204.08084 813 1+
+212.10341 163
+214.11364 453 1+
+216.09422 361 1+
+219.13688 276
+221.09569 97
+223.13444 124
+226.15032 242
+227.14922 321 1+
+229.12698 152
+230.13134 466 1+
+234.12847 513 1+
+237.12577 143
+242.15397 115
+244.14098 325 1+
+248.15828 1590 1+
+252.12291 100
+254.14965 2674 1+
+257.12863 243
+258.13708 885 1+
+260.11136 961 1+
+262.12249 257
+265.10907 128
+268.13765 90
+269.14000 127
+271.16588 160
+272.15509 485 1+
+274.12776 170
+278.14834 117
+283.16864 148
+284.17008 352 1+
+286.14005 764 1+
+290.10832 146
+292.15305 670 1+
+299.18164 314 1+
+301.18704 494
+302.14660 965 1+
+304.19314 118
+310.17475 508
+311.17809 710 1+
+313.18489 598 1+
+316.18398 90
+319.20018 2167 1+
+325.19827 154
+326.15791 121
+327.19143 356 1+
+329.17898 5064 1+
+332.14134 119
+334.17531 168
+337.20095 119
+339.17861 109
+341.16356 84
+342.18333 125
+343.18222 685 1+
+347.14665 375 1+
+350.18543 94
+351.20109 188
+354.15974 193
+355.20020 723 1+
+356.16702 110
+358.18315 142
+359.15776 87
+361.19018 174
+362.19594 92
+365.18275 92
+366.20984 1050 1+
+371.18549 924 1+
+373.18488 1189 1+
+381.18868 149
+382.20672 500 1+
+384.22447 4352 1+
+389.19110 810 1+
+396.20689 150
+397.19316 151
+398.20703 86
+399.20408 300
+400.20486 1348 1+
+405.05866 86
+407.19164 147
+411.19830 139
+412.23136 96
+413.20505 197
+413.72608 629 2+
+415.20808 936 1+
+418.18360 623 1+
+418.73432 85
+421.27891 109
+423.24460 118
+424.21825 181
+425.19357 929 2+
+426.22584 718 1+
+428.16497 98
+429.20700 139
+430.21241 148
+432.23977 1912 1+
+432.70426 113
+435.16542 116
+437.24338 220
+438.24396 695 1+
+442.21517 5079 1+
+449.22684 128
+452.26279 302
+453.25158 780 1+
+455.25717 1673 1+
+458.25122 607 1+
+458.75977 122
+459.20225 133
+460.22560 3821 1+
+465.22199 126
+467.19249 116
+467.69022 104
+468.22584 236
+469.23849 616 1+
+471.24869 1534 1+
+472.72922 91
+476.25294 132
+477.22816 107
+478.26141 110
+481.23922 89
+482.25547 156
+483.24014 420 1+
+485.25837 518
+486.24040 1937 1+
+487.77904 106
+489.28812 1536 1+
+492.17038 129
+493.24044 157
+494.17521 88
+494.72931 105
+495.23500 179
+496.24497 1697 1+
+498.69601 114
+501.25727 446 1+
+503.26610 1793 1+
+508.25467 96
+509.26839 410 1+
+511.22931 103
+512.22916 114
+513.25101 5355 1+
+516.74613 134
+518.25568 146
+522.33235 85
+523.78777 1255 2+
+526.28276 1713 1+
+528.76842 89
+531.26272 3775 1+
+534.26598 299 1+
+536.29380 88
+537.30548 115
+538.26228 105
+539.28718 160
+540.28525 106
+541.25159 188
+542.25405 199
+543.26926 538 1+
+546.32372 6048 1+
+552.30262 1325 2+
+554.29979 180
+555.29537 491 1+
+556.75583 89
+557.27569 1600 1+
+565.33244 201
+566.27686 739 1+
+569.31315 221
+570.29380 1037 1+
+574.30160 1230 1+
+579.29804 109
+580.26840 88
+582.29318 350 1+
+584.29153 2462 1+
+588.29552 579 1+
+591.28940 119
+592.30999 86
+593.28815 129
+594.34334 91
+596.30007 120
+597.31800 545 1+
+599.34708 244
+599.82855 221
+600.31882 787 1+
+602.30198 3671 1+
+607.25947 92
+608.28874 270
+608.84253 4210 2+
+611.29432 86
+613.30246 174
+614.27396 171
+615.31040 540 1+
+617.36439 10010 1+
+623.27915 153
+625.32506 133
+626.33386 100
+627.34250 629 1+
+630.32262 121
+631.32454 158
+632.29695 128
+633.30423 137
+636.27276 96
+637.36953 110
+640.29654 111
+641.32021 1293 1+
+643.86735 89
+645.37440 91
+648.29977 123
+650.35518 106
+651.32891 85
+652.35458 940 1+
+652.86264 105
+656.31592 131
+657.34403 152
+659.32410 1619 1+
+663.84817 211
+664.35002 100
+665.30702 94
+666.31878 118
+667.29416 120
+668.35173 144
+669.34227 326
+669.86189 1202 2+
+670.36281 1087 1+
+675.36496 117
+678.26899 361
+678.86963 1917 2+
+681.34054 544 1+
+684.80492 113
+685.21637 488 1+
+685.40059 139
+685.84558 146
+686.32663 149
+686.39633 102
+686.82498 144
+687.33233 320
+687.88003 6158 2+
+688.37787 4258 1+
+690.85474 649 1+
+693.35177 127
+693.89424 944 2+
+696.32463 88
+698.36884 619 1+
+708.36862 92
+710.32848 93
+713.37961 281 1+
+715.37507 219
+716.43486 3094 1+
+720.40736 98
+722.38310 111
+723.36363 130
+727.38319 88
+728.35669 128
+729.36284 106
+730.38402 545 1+
+736.34162 169
+737.37261 102
+739.34029 91
+740.38762 1015 1+
+754.38955 95
+755.41186 119
+756.46262 96
+758.39194 1457 1+
+772.42914 97
+773.45385 14483 1+
+779.35786 126
+785.38783 136
+806.39722 153
+807.41952 111
+811.41762 167
+824.39268 88
+826.44488 1375 1+
+829.43557 829 1+
+836.42980 94
+839.40630 89
+841.41635 85
+844.49258 10033 1+
+849.37985 198 1+
+852.41452 156
+853.45212 116
+854.42252 118
+860.41055 117
+866.43590 100
+867.39988 168
+868.42669 103
+868.90958 97
+869.44607 98
+880.43658 238
+882.40883 91
+886.47167 94
+887.48393 103
+898.46998 132
+903.50727 124
+915.52858 8321 1+
+943.43875 88
+979.51170 101
+1046.56827 1394 1+
+1056.57333 97
+1103.59797 2225 1+
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 1197, +MSn(759.6966), 115.6 min
+PEPMASS=759.69661 105750
+CHARGE=3+
+186.10412 112
+200.12978 116
+201.11508 199
+215.12847 573 1+
+217.13204 178
+218.14654 3471 1+
+225.11230 155
+229.12411 161
+230.08661 111
+231.09629 210
+232.10636 155
+234.12088 145
+241.08227 343
+242.13690 1947 1+
+243.13494 997 2+
+251.14776 886 1+
+259.09362 2528 1+
+289.16151 160
+309.99744 123
+315.16776 538 1+
+318.13360 115
+330.12151 122
+332.15995 208
+333.18107 10471 1+
+350.21552 580
+353.17657 967 1+
+354.68081 132
+357.24899 1554 1+
+360.15877 206
+370.19803 168
+371.19182 511
+372.18200 2231 1+
+385.21525 152
+389.22620 227
+390.24212 146
+404.69264 1057 2+
+409.70252 597
+410.20039 878 2+
+413.22020 117
+413.69567 1540 2+
+418.70906 4084 2+
+423.21488 122
+424.05212 110
+424.19180 122
+440.72768 157
+441.22664 670 2+
+443.22132 109
+446.21890 586 1+
+456.22055 927 2+
+458.23166 122
+459.24831 160
+461.20831 676 1+
+464.22185 18608 1+
+464.74963 110
+465.72418 2987 2+
+469.21096 110
+470.21269 4776 2+
+473.26107 117
+475.25001 4621 2+
+479.21897 4692 2+
+481.29167 123
+482.22796 812 1+
+485.26260 893 1+
+491.20823 168
+492.20057 110
+499.29634 155
+499.79554 221
+500.24981 1336 1+
+500.76712 249
+503.22512 563 1+
+506.26448 205
+506.78011 164
+512.25439 134
+515.26526 175
+515.76685 111
+517.28144 110
+521.28257 151
+521.76398 1499 2+
+526.75707 397 1+
+530.77244 233
+531.26694 226
+531.75749 167
+532.25080 174
+534.79631 346
+535.30847 276
+535.76053 12200 2+
+539.77245 2914 2+
+542.26539 148
+543.29634 233
+543.74664 200
+544.31068 109
+547.28849 138
+547.80508 114
+550.29467 178
+553.24588 128
+555.76691 119
+556.24813 123
+557.29591 562 2+
+559.31861 423 1+
+562.24799 169
+563.14696 119
+569.29669 137
+570.30659 1029 1+
+575.79283 130
+576.78453 124
+577.30336 11408 1+
+577.79249 163
+580.81267 244
+581.79033 156
+582.31042 204
+583.34087 114
+586.28784 1458 2+
+588.26712 165
+589.28836 141
+590.25776 415
+591.27412 1194 1+
+591.77799 665 2+
+595.28672 2218 2+
+597.29583 526 1+
+599.27820 372
+599.79027 341
+600.27957 13399 2+
+603.27890 192
+604.29543 5129 2+
+608.25800 688 2+
+610.30049 969 1+
+613.29804 1340 1+
+619.26067 570 1+
+622.30408 183
+622.83703 127
+623.33929 120
+623.82737 146
+624.31328 175
+626.81953 140
+628.31983 119
+629.34750 154
+629.80178 121
+630.78463 117
+631.31006 147
+632.32766 137
+632.87475 195
+633.33833 185
+634.80740 161
+635.32186 224
+637.82473 191
+638.32260 176
+641.85570 230
+642.29647 189
+642.80444 164
+643.30102 124
+644.33123 249
+644.82704 830 2+
+647.25176 156
+647.80114 146
+649.30472 199
+650.33384 120
+650.81514 2595 2+
+653.82526 207
+655.80508 2241 2+
+660.83658 3736 2+
+663.07854 123
+664.30132 181
+664.80298 18684 2+
+671.35358 207
+672.41659 361 1+
+673.30939 110
+674.35229 169
+675.37445 175
+676.35819 164
+677.84090 132
+679.35167 115
+689.33735 114
+689.89197 150
+690.01782 419 3+
+691.29692 133
+692.35847 124
+693.33892 134
+695.35443 241
+697.44642 153
+698.42549 170
+698.86943 1051 2+
+701.37626 234
+703.33084 178
+704.38999 118
+707.35278 765
+707.84300 773 1+
+708.34235 13292 1+
+712.33910 1557 2+
+716.39360 139
+719.29971 137
+720.31536 216
+720.83411 230
+721.34764 8534 2+
+724.34821 180
+726.36321 952 1+
+726.84885 223
+728.33712 687 2+
+729.35919 1720 2+
+732.33765 110
+734.38419 148
+735.35605 141
+736.36326 119
+739.35273 2542 1+
+744.36217 525 1+
+746.41170 689 2+
+748.03728 146
+748.40411 171
+749.04836 128
+749.38305 118
+751.82728 121
+752.40350 193
+753.03687 1212 3+
+755.37990 160
+756.08866 114
+756.42711 231
+757.39729 219
+757.62012 132
+757.83844 134
+758.40343 360
+758.74559 344
+759.10415 358
+759.38788 3939 3+
+761.40140 828 2+
+762.73573 114
+763.40466 229
+764.38571 910 2+
+765.09973 132
+769.40839 112
+770.37855 146
+771.37886 204
+772.35768 142
+773.40417 138
+776.36445 260
+776.88365 1081 2+
+784.49747 472
+785.37680 7884 2+
+794.36832 161
+795.35192 192
+801.39390 131
+808.37801 2038 1+
+813.41920 256
+818.40892 342
+819.39351 1859 1+
+826.38407 3598 1+
+831.41118 158
+836.41084 12679 1+
+836.88591 423 1+
+841.90431 1428 2+
+850.89545 4998 2+
+885.45678 167
+886.48684 115
+890.46588 222
+891.44626 126
+893.45849 213
+893.92278 246
+897.59888 120
+898.46220 773 1+
+907.44493 3353 2+
+911.39748 134
+912.49910 203
+913.00629 158
+914.45001 157
+915.41642 153
+929.44132 225
+930.44109 521 1+
+939.41811 2308 1+
+949.49274 4403 1+
+957.43066 6601 1+
+972.96604 1049 2+
+976.49873 117
+990.48264 144
+1000.57780 141
+1011.57709 181
+1030.50110 178
+1030.97479 174
+1031.50744 186
+1032.03398 115
+1060.52750 122
+1061.48406 231
+1066.01033 127
+1066.47287 140
+1066.99831 110
+1070.51379 2466 1+
+1078.53763 2784 1+
+1112.66418 145
+1189.56617 613 1+
+1199.55187 841 1+
+1207.58359 2222 1+
+1320.67707 138
+1328.59868 923 1+
+1441.64792 114
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 736, +MSn(742.0258), 75.1 min
+PEPMASS=742.02585 165812
+CHARGE=3+
+159.08980 174
+181.08178 124
+186.07989 263
+187.09802 716 1+
+201.10260 212
+203.09432 94
+204.08646 487 1+
+207.10135 106
+211.13642 84
+215.10495 263
+218.14330 612
+228.13904 110
+229.11429 731 1+
+231.11088 774
+232.13167 1667 1+
+246.11784 327 1+
+249.12688 2959 1+
+259.10837 1512 1+
+262.16651 94
+263.11048 174
+272.15881 328
+274.12482 503 1+
+277.11952 2699 1+
+286.15185 158
+290.17803 205
+292.13272 472 1+
+300.16843 119
+303.12083 867 1+
+311.17349 87
+314.17049 107
+316.16066 406
+318.17833 578 1+
+325.19160 490 1+
+327.20373 110
+329.16000 310 1+
+332.10718 104
+333.16463 134
+339.23765 494 1+
+342.15589 87
+343.15875 219 2+
+344.15334 505
+345.22670 536 1+
+346.12874 96
+347.19049 676 1+
+352.67974 299 2+
+355.18185 262 1+
+358.15422 384 1+
+361.20337 86
+362.18483 148
+363.16547 464 1+
+366.15465 128
+368.18478 264 2+
+373.17532 322
+374.14586 2825 1+
+385.22920 110
+387.18739 161
+388.19823 1318 2+
+390.19969 83
+392.15200 2915 1+
+397.19765 267 1+
+402.16826 85
+408.19435 187
+410.19253 103
+415.20375 140
+416.20251 592 2+
+417.21732 230
+422.70608 93
+425.21728 965 2+
+427.19339 508 1+
+430.69821 578 2+
+432.28406 169
+434.20114 333 1+
+436.23697 649 2+
+440.25708 167
+441.72704 163 2+
+443.21855 1876 2+
+445.21311 4227 2+
+446.21484 1751 1+
+452.22932 4728 2+
+455.19503 218 1+
+457.21462 116
+458.23703 975 1+
+459.23443 350 2+
+462.22047 4049 1+
+468.28185 984 1+
+470.73924 150
+471.23561 455 2+
+473.20804 7411 1+
+473.74271 102
+478.26696 214
+479.73515 83
+480.26714 203 1+
+481.75145 859 2+
+485.26492 198 2+
+486.25371 1373 1+
+489.76778 91
+490.24037 257 2+
+491.23499 4040 1+
+491.77179 138
+493.28773 166
+499.26008 319 2+
+502.25187 558 1+
+502.75462 84
+503.20783 88
+506.26577 506 1+
+509.70150 326 2+
+511.26317 274 1+
+513.27177 577 2+
+516.27131 178
+517.22997 426 1+
+520.19345 175
+521.20235 355 1+
+522.74814 117
+523.25304 407 2+
+525.25314 540 1+
+525.75664 131
+527.73076 116
+528.24962 433 1+
+529.77740 92
+530.74093 96
+533.75985 4610 2+
+535.27433 1242 1+
+535.75603 444 9+
+538.72229 111
+539.29367 1227 2+
+541.70083 117
+542.26161 188 1+
+544.27532 849 2+
+545.22527 103
+546.23923 119
+546.79061 530 1+
+547.25253 84
+548.23173 174
+549.27774 541 2+
+553.15504 85
+553.30745 107
+554.27690 292 1+
+556.27330 367 1+
+558.30705 1017 1+
+561.78360 100
+562.80312 1134 2+
+565.78727 386
+566.28092 562 1+
+569.26728 370 2+
+570.78345 2276 2+
+572.63294 341 3+
+574.27745 261
+575.30363 3357 1+
+578.62983 122
+579.28557 1353 1+
+579.79483 2783 2+
+580.29672 1280 4+
+582.77780 453 1+
+583.29600 121
+584.25407 447 1+
+585.92192 3637 3+
+587.79615 386 2+
+589.66585 84
+591.81375 100
+592.25182 957 1+
+594.81054 97
+596.26228 168
+597.31721 673 1+
+599.78228 117
+602.25403 5768 1+
+603.62258 97
+605.96479 137
+606.82366 441 2+
+610.30632 281 1+
+611.64525 357 6+
+612.29681 380 1+
+612.75444 109
+616.35435 228 3+
+617.03766 186 4+
+618.26293 243 1+
+620.27596 5448 1+
+621.76971 106
+622.68409 83
+622.83094 661 2+
+625.29237 88
+625.78190 104
+626.33886 136
+628.27945 191
+629.29739 590 1+
+629.82608 99
+632.28115 549 2+
+632.76617 627 1+
+634.29647 115
+635.32907 95
+636.27585 239 1+
+636.39852 90
+637.18040 144 7+
+638.29481 316 1+
+638.83423 85
+639.79219 722 2+
+640.31638 1161 1+
+640.79691 697 2+
+643.81868 108
+644.64412 90
+644.96661 88
+645.34618 114
+645.97960 94
+646.30466 1685 1+
+647.82074 262
+649.99788 580 3+
+652.32147 2230 2+
+653.67359 97
+654.32480 370 2+
+656.31977 94
+657.30823 112
+658.35195 108
+658.65971 234
+658.97641 1262 3+
+660.81875 1024 1+
+661.32081 2361 2+
+664.31558 387 1+
+666.32068 499 3+
+667.30457 686 3+
+667.74786 87
+668.33703 261
+668.78833 116
+669.37222 177
+669.83755 824 2+
+670.37882 1361 1+
+672.82138 281 1+
+673.61926 93
+674.29118 887 1+
+677.87776 94
+679.29663 124
+679.74129 90
+680.30500 533 3+
+682.33215 327 1+
+683.72592 379 2+
+684.80700 746 4+
+685.31023 855 1+
+686.83583 89
+687.76613 109
+688.28853 1088 2+
+689.73957 89
+690.33445 575 2+
+693.34733 1024 2+
+694.70008 93
+695.29583 97
+695.90047 87
+696.34235 111
+697.84007 1515 2+
+698.33418 1187 1+
+698.99638 547 3+
+702.37400 1412 1+
+702.81833 128
+703.65467 89
+703.81698 347 1+
+704.34231 6470 1+
+705.99865 109
+706.66913 264 1+
+707.68209 535 3+
+709.38924 928 1+
+712.80294 119
+713.35000 134
+713.78609 117
+714.32161 532 2+
+716.34537 1629 2+
+716.35961 1571 1+
+718.84353 161
+720.59615 542 4+
+720.84726 303 1+
+721.37492 440 2+
+723.33317 120
+725.35369 3524 2+
+728.70060 84
+730.02611 907 3+
+732.30657 201
+732.85656 95
+733.36053 544 3+
+734.84659 117
+735.36229 3033 1+
+735.72656 90
+736.02930 4871 3+
+737.90346 3022 2+
+738.62274 483 1+
+740.37407 551
+740.61343 531 4+
+741.37030 642
+742.03654 17503 3+
+742.70758 7140 6+
+743.89564 1859 2+
+744.42153 1504 4+
+744.88234 1840 1+
+745.22913 782 5+
+745.40636 2844 1+
+745.91059 3126 2+
+746.12795 92
+746.71909 247
+747.61193 88
+748.01362 122
+750.37002 94
+751.41918 107
+751.86658 1818 2+
+752.65796 94
+754.39376 539 2+
+758.36831 104
+759.88574 100
+760.30091 84
+760.86983 1362 2+
+767.41389 145
+773.43904 86
+774.39852 132
+774.84982 121
+775.38919 9052 1+
+781.37566 91
+782.35803 348 2+
+784.39807 94
+787.36657 93
+789.32901 190
+790.85978 97
+792.39692 166
+793.90793 1801 2+
+796.28307 212
+797.25145 84
+798.38085 122
+799.38378 426 2+
+801.31821 91
+801.90339 114
+802.42359 147
+802.92255 15579 2+
+805.50131 214 1+
+805.94539 112
+811.39548 87
+811.88225 417 2+
+813.39613 488 1+
+816.38893 270
+816.90875 150
+817.38469 576 1+
+821.41937 104
+822.04668 928 3+
+824.41314 87
+825.38857 817 2+
+829.39659 96
+829.84269 200 1+
+830.43747 861
+831.43164 1632 1+
+839.39575 191 1+
+847.45510 90
+848.45609 117
+849.42729 1993 1+
+858.44577 1495 2+
+860.38915 645 1+
+867.44125 7291 2+
+870.42178 141
+871.46666 571 1+
+871.90234 89
+876.39322 451 2+
+878.37925 2072 2+
+881.93675 118
+882.44680 269 1+
+882.90840 116
+884.48962 98
+885.42983 857 1+
+895.44148 115
+896.39596 98
+897.46150 109
+899.47692 92
+901.48406 325 1+
+903.45136 3218 1+
+908.92563 302 2+
+916.97569 1939 2+
+917.46158 1029 1+
+924.35595 83
+929.46465 93
+935.48109 106
+939.42540 112
+940.44591 84
+941.44235 86
+947.46364 84
+959.48647 467 1+
+962.49563 480 1+
+966.46724 93
+974.49318 3399 2+
+978.51696 173
+979.52985 100
+995.46483 113
+995.93771 105
+996.47135 92
+1020.57668 125
+1025.55424 140
+1028.94160 100
+1030.53525 152
+1031.52956 120
+1045.49881 344 1+
+1049.57477 128
+1066.51242 782 1+
+1069.50191 493 1+
+1077.51095 88
+1079.50871 127
+1124.59896 539 1+
+1137.50842 99
+1140.55963 1021 1+
+1158.61139 571 1+
+1281.52850 166
+1303.63566 271 1+
+1321.64611 140
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 582, +MSn(590.6452), 63.2 min
+PEPMASS=590.64518 208523
+CHARGE=3+
+159.07516 11278 1+
+169.11384 263
+170.04971 442
+173.11246 373
+175.10666 1007
+185.05168 560
+186.10854 272
+187.07915 1725
+188.07977 340
+201.11376 585
+215.10078 2408 1+
+217.07583 1194
+226.15452 423
+227.07621 769
+235.13355 324
+243.14532 20486 2+
+245.07733 6715 1+
+254.15181 406
+263.14226 950 2+
+270.12385 537
+271.65721 16451 2+
+281.11337 730
+283.14504 454
+288.14004 597
+289.16404 5403 1+
+298.12410 1150
+299.68191 1119 2+
+301.15349 645
+311.16224 275
+316.15057 3529 1+
+326.14677 250
+327.20151 608
+327.69674 286
+328.20254 239
+336.20683 904
+341.20051 4859 2+
+343.16505 243
+344.15117 2023 1+
+349.16630 338
+350.20516 4234 2+
+355.14794 249
+355.69345 279
+356.18668 13784 2+
+364.69830 25329 2+
+369.19212 278
+371.20867 302
+372.18863 238
+373.15854 270
+376.73774 578
+377.24643 390
+385.15615 410
+385.74330 379
+386.24277 620
+387.19072 1632
+388.22511 3145 2+
+389.23314 762
+390.73609 7186 2+
+396.22934 312
+398.22118 236
+399.22572 439
+399.74090 2203 2+
+411.20354 266
+411.70917 343
+413.15329 537
+414.23685 2937 1+
+420.21767 1109
+420.71812 576
+429.21978 3407 2+
+431.16214 1317
+432.16236 482
+439.21432 283
+439.70760 265
+444.23050 296
+445.20500 948
+446.21975 357
+448.24901 4341 2+
+457.25695 6224 2+
+461.27312 305
+462.25899 258
+467.26950 488
+468.25985 1296
+468.72544 876
+469.22925 633
+470.26575 799
+471.26597 328
+472.24739 259
+477.73071 1534
+478.23734 1058
+478.72278 319
+479.19611 249
+482.27858 260
+483.26720 368
+484.22414 388
+485.28336 59339 1+
+485.75974 320
+486.74178 4735 2+
+488.20096 1003
+489.21515 396
+497.25673 326
+498.24217 437
+498.77422 410
+499.31921 1473
+500.30209 890
+502.23998 355
+507.77969 877
+508.27629 712
+509.28933 275
+510.25140 302
+512.22526 310
+512.77764 1094
+513.26998 789
+515.25466 333
+516.23520 1358
+517.23719 434
+521.18863 412
+521.77961 7740 2+
+524.28879 573
+525.27725 2374 1+
+527.31860 11710 1+
+527.78134 713
+530.23677 719
+531.23398 316
+534.25659 256
+536.26832 1065
+536.77784 598
+537.26744 349
+538.25612 284
+539.29591 280
+541.62934 396
+541.78347 287
+541.96521 645
+542.30714 118146 1+
+542.78779 385
+551.27404 713
+552.26840 240
+553.31011 368
+554.27683 267
+555.30579 262
+556.28764 833
+556.79047 499
+557.28579 437
+558.27484 247
+565.27569 599
+566.27459 375
+569.29042 263
+570.34996 703
+571.29778 555
+571.73932 251
+572.27664 287
+572.78171 254
+575.78771 241
+576.27969 264
+576.77666 268
+577.79174 383
+578.64190 390
+578.78123 277
+578.97689 785
+579.30225 331
+580.32160 393
+581.29572 262
+582.80428 624
+583.28842 480
+583.70976 301
+584.23638 515
+584.64514 5081 3+
+584.78101 1313
+585.79369 404
+586.31092 667
+586.79024 774
+587.28812 1031
+587.79228 370
+588.28572 450
+589.29488 422
+589.69865 4558 1+
+590.21805 1408
+591.21780 1530
+591.79727 8758 2+
+594.31972 801
+594.78932 546
+595.29609 550
+596.31406 258
+597.30815 571
+598.35655 12047 1+
+600.82043 4995 2+
+605.80973 764
+606.31960 666
+606.81646 314
+607.31347 238
+613.31436 370
+614.30647 281
+614.81970 6689 2+
+620.32101 260
+620.82354 322
+621.32466 294
+622.31566 397
+626.39924 281
+629.32746 648
+629.82906 328
+630.31863 300
+631.27981 708
+632.28783 250
+634.32671 684
+634.81955 611
+635.31253 353
+638.33582 244
+643.33147 8650 2+
+652.36309 312
+654.36727 237
+655.37090 533
+656.34034 459
+657.33843 264
+666.33411 330
+668.35158 252
+671.40273 471
+672.41190 258
+678.36403 373
+681.39374 7233 1+
+692.34579 324
+699.40305 16735 1+
+711.36609 1235 1+
+726.31929 290
+728.38933 31818 1+
+739.40746 236
+754.44640 272
+770.46518 569
+771.43561 240
+775.44294 350 1+
+780.46490 3056 1+
+798.47452 12593 1+
+839.40935 875
+840.43044 582
+857.43229 5216 1+
+895.49075 647 1+
+913.50662 11105 1+
+929.48512 237
+954.44740 454
+955.45023 460
+972.47627 7910 1+
+1014.55894 299
+1024.53406 566
+1025.55066 510
+1042.55194 19121 1+
+1071.52968 275
+1156.58806 700
+1157.60402 539
+1158.56840 261
+1228.63212 755 1+
+1285.65567 692 1+
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 72, +MSn(428.2391), 26.6 min
+PEPMASS=428.23909 998365
+CHARGE=3+
+159.06232 5635 1+
+161.07525 1774
+171.06568 3923 1+
+173.11119 7054 1+
+175.10289 1261
+183.10287 4304 2+
+185.08708 939
+189.07783 5645 1+
+192.60777 1450
+193.10729 3602 2+
+197.14441 1228
+199.17417 133816 1+
+201.11663 11094 1+
+206.12293 826
+213.09252 831
+213.11574 471 4+
+214.11581 4508
+215.09783 7534 1+
+219.08306 1460
+221.11038 789
+222.12209 394 2+
+223.14635 1345
+224.10726 1556
+225.15311 1356
+227.17299 36108 1+
+229.12047 1613
+232.12574 1974
+235.13800 814
+242.12341 11292 2+
+243.12805 1431
+244.12805 1846
+244.64612 1099
+245.13347 596 2+
+246.63161 5719 2+
+248.13870 803
+249.11318 1645
+249.63518 778 2+
+251.14138 1095
+252.63563 3304 2+
+254.14973 6366 1+
+255.63872 20478 2+
+258.14593 1367
+260.13318 22170 1+
+264.66399 782
+266.14644 15009 1+
+269.16198 1990
+270.16118 2109
+272.16274 2219
+273.15970 961
+274.18250 1990
+275.17058 1048
+275.65918 1403
+276.14395 857
+277.66992 1885
+278.16116 5360 2+
+283.15720 878
+284.17008 39580 2+
+285.16536 7744 2+
+286.15361 1325
+287.16378 1332 2+
+288.15985 2511 3+
+289.15806 846
+290.15078 3933 2+
+293.13593 823
+294.14433 881
+295.13948 1469
+296.19241 5743 1+
+298.16971 5951 2+
+299.15574 27134 2+
+301.15498 2336
+302.16008 3457 2+
+303.14385 1245
+304.16888 906
+306.17564 1827 3+
+309.16906 791
+309.66575 990
+310.18230 1283
+311.14099 16286 1+
+314.19585 7031 1+
+315.66574 795
+319.16507 986
+322.67589 1742
+323.17570 1764
+327.19450 1350
+328.18666 2141
+329.15067 33623 1+
+329.71466 1050
+333.69156 1573 2+
+334.69578 1163
+335.18954 1038
+336.16998 1200
+337.19185 1174
+339.21320 807
+340.17153 2118
+341.18466 2560
+342.19072 842
+343.19601 1785
+343.70583 850
+345.20501 2464
+346.16717 1219
+346.69097 902
+347.16872 9370 2+
+348.16884 1608
+353.18480 1284
+355.20773 5283
+355.69804 10534 2+
+357.21169 1441
+358.16966 4492 2+
+359.18435 1451
+364.19075 13061 2+
+367.21304 4024 2+
+368.21715 1066
+371.20117 3787 2+
+372.20706 1497
+373.22464 26532 2+
+375.22001 1605
+377.19593 875
+378.20799 1413
+379.20999 1161
+380.18586 1392
+381.19930 1399
+381.86423 1279
+382.18487 4858 2+
+383.20667 2118
+384.21620 823
+385.20730 9193 1+
+387.54209 7008
+387.87218 13863 3+
+389.21509 9916 1+
+390.54576 1153
+390.71444 1291
+394.20730 1024
+395.20802 4806 2+
+396.22276 2190
+397.22842 2436
+398.20352 2294
+399.21473 19096 2+
+401.20648 921
+401.72280 948
+402.22260 865
+404.20910 808
+405.21391 817
+406.21042 2146
+407.20959 1167
+409.23785 1318
+410.22690 867
+411.24784 1171
+412.23674 1078
+413.22164 19687 1+
+413.55520 3426 1+
+413.89098 1822
+418.72343 5873 2+
+420.74065 1305
+421.24475 6072 2+
+421.57588 1260
+421.90896 921
+422.23882 8328 3+
+422.71060 1109
+423.21344 7472
+424.22181 13629 2+
+425.22421 4441 2+
+426.22980 1695
+427.23642 2055
+427.73085 1579
+428.24071 6120
+428.57039 17898 3+
+428.74129 1312
+429.77089 138330 2+
+431.73614 17680 2+
+433.23011 2256
+434.21067 1144
+436.25599 1339
+440.25616 882
+440.73386 29731 2+
+442.23619 20588
+443.23691 7192 1+
+445.72993 870
+446.23776 1003
+447.22624 819
+448.24147 958
+449.23497 830
+449.73957 96641 2+
+451.20749 13939 2+
+452.20821 4577 2+
+453.22313 1101
+454.26078 1685
+454.74090 1312
+455.23953 1390
+455.73090 972
+456.23451 999
+458.27236 1223
+458.75982 7271 2+
+460.24464 13219 1+
+466.25317 1728
+467.24531 4832 2+
+468.27305 3811
+469.24050 13848 1+
+474.24342 2321
+475.25299 986
+476.25248 14341 2+
+478.23668 1148
+480.25389 1413
+481.25431 1057
+483.23955 3159 1+
+485.25932 32345 2+
+487.27673 1908
+488.25366 1187
+489.25967 6369 1+
+492.25594 12798 1+
+496.26841 1247
+497.26121 1005
+497.75788 1885
+498.26309 4636 1+
+501.26151 1408
+501.75602 1325
+502.26121 2549
+502.75321 969
+503.26212 1011
+504.26398 12640 1+
+508.25504 886
+509.29280 1091
+510.27016 128761 1+
+510.76738 42296 2+
+514.25977 2427
+515.26401 1089
+516.25791 1194
+519.29037 2534
+519.76919 62259 2+
+522.28618 987
+526.27092 1023
+527.31443 2155
+528.30147 2456
+528.77449 170196 2+
+532.27949 5525 1+
+532.79730 865
+533.76579 1202
+536.28029 1631
+537.30140 15007 1+
+545.32013 2034
+546.29051 2224
+547.28567 10409 1+
+553.31138 1032
+555.31504 18492 1+
+561.28731 1271
+562.29409 838
+564.28335 2236
+565.29739 1125
+567.33288 4391 1+
+567.80730 903
+571.32071 1427
+572.31918 813
+573.32029 9749 1+
+576.31053 11036 2+
+578.30199 1945
+579.29427 20915 1+
+585.31570 33756 2+
+588.32861 1287
+589.30624 2313
+590.30081 7173 1+
+595.33214 7646 1+
+597.30421 181715 1+
+603.31288 661 1+
+615.32578 1060
+616.35227 2218
+617.35100 52434 1+
+622.35749 820
+623.31970 1521
+624.33566 1158
+629.33253 1383
+630.33052 1184
+632.35367 881
+639.34457 1103
+640.36049 835
+642.34670 938
+647.33548 1941
+648.33760 1727
+650.36853 1353
+651.31987 2152
+652.32280 969
+660.35647 1068
+666.37585 3998 1+
+668.39018 2204
+669.35281 1715
+685.39003 1602
+686.38600 1350
+689.33891 963
+690.36065 1267
+692.37602 2639
+693.33017 2585 1+
+710.38881 49024 1+
+715.33205 578 1+
+724.36936 902
+727.37423 1714 1+
+733.41880 1422 1+
+741.39506 284 1+
+745.44201 15507 1+
+752.36032 1512
+753.36071 823
+755.39352 939
+763.36247 837 1+
+770.37294 1049
+779.41338 5910 1+
+789.40876 481 1+
+797.42217 59705 1+
+841.48223 371 1+
+847.43634 604 1+
+862.46500 1543 1+
+880.46044 4106 1+
+898.47187 33851 1+
+903.40914 243 1+
+910.43294 1209
+951.49768 808 1+
+969.51137 5492 1+
+1020.52748 233 1+
+1038.53110 811 1+
+1056.54170 4080 1+
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 875, +MSn(483.2538), 89.2 min
+PEPMASS=483.25374 16982
+CHARGE=3+
+155.07949 167
+157.08688 317
+158.07506 316
+172.05681 496
+175.10342 4431 1+
+177.09597 624
+177.59012 138 2+
+183.10139 352
+184.09871 178
+185.14984 164
+197.11776 656
+199.10192 769 2+
+200.12300 1118 1+
+206.12910 586
+207.63892 219
+208.12306 166
+211.11270 188
+213.07963 472
+214.08866 149
+215.13682 2296 1+
+218.14016 1816 2+
+221.13227 1038 2+
+225.12638 600
+226.12661 296
+228.13285 1681 2+
+229.64619 367
+230.13192 176
+231.10540 1471 1+
+233.16646 383
+234.62563 197 2+
+239.14618 238
+240.13334 884
+241.08298 2615 1+
+243.13133 3786 2+
+244.13686 522
+246.14932 150
+248.13933 218
+249.12686 357
+250.15007 438
+252.15856 142
+257.14620 1076 2+
+258.12768 196
+259.09643 2839 1+
+261.16917 305
+265.16969 245
+268.12885 458
+270.16903 158
+271.14322 7957 1+
+273.65743 696 2+
+277.10932 330
+281.14644 188
+282.66121 991 2+
+284.83124 136
+285.15842 1491 1+
+288.20520 6472 1+
+294.18715 184
+296.18139 141
+299.15296 180
+303.66175 147
+304.13603 268
+306.11735 143
+308.17249 345
+309.17813 273
+311.08415 138
+312.17209 180
+312.64195 200
+313.14916 836 2+
+315.13905 138
+321.65998 1248 2+
+324.14301 143
+326.18039 374
+327.18884 178
+330.19531 534 2+
+337.16372 160
+338.19688 174
+339.20521 6683 2+
+342.20850 264
+344.19818 390
+345.20631 213
+346.16176 160
+351.18454 227
+352.13066 415
+353.14595 161
+354.17297 1741 1+
+354.66347 163
+356.22783 5252 1+
+359.65106 189
+363.20462 197
+366.21615 161
+366.94473 192
+367.04557 136
+367.20430 280
+368.18597 369
+369.15276 1776 1+
+370.93138 187
+371.23639 269
+372.18299 1815 2+
+373.19491 361
+375.20367 199
+377.17873 332
+377.66715 524 2+
+379.17773 206
+382.16325 1078 1+
+384.21929 6105 1+
+386.18354 1733 2+
+388.15443 1191 1+
+393.20545 272
+393.68394 142
+394.75327 224
+396.17138 170
+397.19657 1690 1+
+400.19525 974 1+
+403.70872 260
+409.25236 136
+411.21304 217
+414.19568 1682 1+
+418.24742 428
+419.23737 424
+420.23139 255
+421.24553 158
+425.16683 191
+429.23298 196
+430.18225 286
+433.21960 185
+433.71026 150
+434.58820 135
+435.27304 26795 1+
+436.11017 332
+440.23589 168
+441.25727 644 1+
+442.72522 255 2+
+443.78326 141
+447.17711 147
+448.17449 167
+450.23322 1185 2+
+451.21132 346
+452.14985 152
+452.29266 210
+453.22809 200
+454.20605 209
+455.25843 656 1+
+459.24611 1248 2+
+463.27061 284
+464.26725 145
+464.79005 139
+465.20127 402
+466.23053 228
+467.21115 346
+468.24398 2414 1+
+471.23303 135
+473.31905 262
+474.22894 250
+477.23109 182
+478.22429 414
+479.24797 251
+480.20943 240
+481.23164 308
+481.65213 222
+482.27673 438
+483.23271 2297 1+
+483.77864 386
+485.25538 3375 1+
+485.66150 259
+485.85535 222
+486.64383 255
+486.81258 176
+488.78208 153
+489.77086 153
+490.18935 149
+493.21540 144
+494.22453 184
+495.26087 1375
+496.24246 3301 1+
+501.22214 1512 1+
+505.75130 157
+507.25890 153
+508.21492 597
+510.27498 171
+511.21342 542
+512.21360 389
+513.26817 5644 1+
+514.76114 139
+522.27511 194
+525.23056 334
+526.22951 1141 1+
+529.25074 380
+530.23686 144
+534.31627 161
+543.23519 1235 1+
+546.30758 6693 1+
+554.25370 149
+561.26285 185
+562.26069 221
+564.31515 44659 1+
+564.75055 135
+565.70261 158
+571.25361 180
+574.31008 215
+578.32863 138
+579.28334 479
+580.29181 321
+581.29397 263
+583.28734 142
+584.29412 133
+594.30031 260
+597.29754 1354 1+
+600.30764 233
+601.29748 139
+606.31193 163
+607.27124 514
+608.27928 260
+612.27070 164
+613.24908 140
+614.30743 1238 1+
+623.28131 180
+624.31148 1033
+625.29105 3067 1+
+637.23271 179
+638.28600 245
+639.30603 213
+640.26960 227
+641.29423 236
+642.31268 4307 1+
+648.35471 163
+654.27805 373
+655.26516 588
+656.26166 156
+657.30167 362
+658.27896 265
+659.38334 1372 1+
+664.87804 173
+667.34365 145
+672.29579 1330 1+
+677.40315 15632 1+
+682.39027 134
+687.40092 162
+708.33908 259
+709.32292 265
+710.40005 145
+718.37144 211
+725.34852 226
+726.33687 637
+727.36245 218
+735.33275 187
+736.33300 1115 1+
+740.36282 163
+743.35869 1134 1+
+753.34184 1509
+754.32703 5220 1+
+768.36125 214
+770.43124 281
+771.35980 7912 1+
+785.37036 454
+788.43502 1596 1+
+806.44637 3764 1+
+848.39827 146
+856.45870 230
+866.46417 185
+867.41631 403
+868.42968 324
+884.44316 1130 1+
+899.45917 388 1+
+917.48494 462 1+
+935.48451 1273 1+
+1013.45897 151
+1047.52379 136
+1064.55252 193
+1065.51811 223
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 207, +MSn(785.9179), 35.7 min
+PEPMASS=785.91791 103759
+CHARGE=2+
+168.05094 846
+186.06702 3315 1+
+200.13280 1616 1+
+204.08177 9197 1+
+228.12926 2310 1+
+242.14767 176
+243.14199 216
+248.07130 222
+249.16146 263
+260.19112 1185 1+
+263.13345 229
+277.15209 139
+303.13061 167
+313.22642 489
+314.23651 137
+341.22289 3046 1+
+357.19189 386
+364.16370 1084 1+
+366.14662 2402 1+
+375.21190 144
+391.20707 159
+402.23773 337
+403.17219 207
+407.17527 334
+408.23101 145
+416.22818 371
+427.25843 258
+427.75239 140
+444.22073 193
+445.22144 158
+446.25750 1391 1+
+454.30766 803
+455.30621 262
+459.19230 240
+460.19626 319
+471.23733 152
+473.20061 147
+474.21970 130
+485.30693 793
+486.30083 226
+487.25595 126
+488.26706 362
+489.26016 167
+491.25650 185
+508.23735 424
+509.23373 164
+515.29074 287
+515.72025 1979
+516.22453 1257
+516.71930 4907 2+
+519.24442 144
+525.24603 172
+527.28073 274
+527.69691 259
+528.21625 162
+528.70633 187
+529.23967 173
+533.27623 187
+534.26933 187
+534.70604 166
+535.69639 151
+539.30626 462
+540.28703 210
+541.30146 140
+542.29249 151
+542.69324 183
+543.27533 183
+543.66892 189
+544.22596 752
+544.73614 564
+545.23236 867
+545.72746 495
+546.23172 339
+551.28867 179
+552.28315 151
+552.83226 141
+556.23017 160
+557.24148 212
+558.30390 186
+559.28375 285
+560.30217 415
+561.28925 897
+562.28872 288
+563.20123 195
+564.23065 176
+569.24360 307
+569.33229 327
+570.30881 192
+577.25345 143
+583.30708 183
+584.29094 138
+590.28869 132
+590.82281 174
+591.31871 234
+607.29493 145
+615.83496 351
+616.31880 640
+616.82671 381
+617.32017 188
+619.30235 137
+620.33443 134
+623.31968 211
+632.29400 218
+638.31041 151
+640.36116 295
+641.34644 179
+642.32819 174
+646.28503 128
+648.29188 174
+649.28936 171
+654.33102 275
+654.83147 131
+655.31711 133
+656.33441 185
+656.82885 211
+657.32834 179
+660.33375 131
+661.30604 173
+663.83857 154
+664.34775 165
+664.84740 183
+666.30888 141
+669.32101 142
+671.34832 142
+672.36385 999
+672.85969 2874 2+
+679.85625 143
+685.39706 160
+686.35236 129
+689.35615 303
+690.33128 396
+691.33750 223
+694.86291 131
+697.31596 156
+703.28298 134
+705.35313 155
+706.78811 150
+720.32112 129
+728.91280 165
+729.39424 351
+729.89165 205
+731.36743 374
+731.87715 194
+732.38136 183
+733.40566 190
+733.90751 247
+734.37980 301
+734.87659 221
+739.34746 147
+742.32875 226
+743.32439 212
+754.39992 183
+760.35838 219
+761.38280 131
+766.36918 152
+767.35346 219
+768.33131 170
+768.87453 219
+769.38318 289
+770.38507 126
+771.38019 170
+772.38888 132
+773.36652 128
+774.35926 128
+775.36036 145
+776.90718 4392 2+
+781.40646 250
+781.90517 275
+782.39808 537
+782.89912 374
+783.39609 649
+783.89687 2111 2+
+785.38190 2317
+785.92749 130631 2+
+788.40788 7141 2+
+788.71033 270
+789.74498 147
+791.37911 289
+791.46262 2779 1+
+791.90028 199
+805.32403 184
+806.35096 177
+817.42144 169
+818.43597 230
+853.47872 239
+854.48418 143
+922.02338 370
+922.53182 399
+923.01823 235
+923.51462 136
+931.48193 200
+932.47962 296
+1002.54104 204
+1003.51895 353
+1004.52692 168
+1011.52596 185
+1023.54982 536
+1024.07753 413
+1024.55582 229
+1025.06258 137
+1030.43772 227
+1031.45235 164
+1032.43133 448 1+
+1087.46268 204
+1088.45429 131
+1089.45738 238
+1090.44533 152
+1117.56496 312
+1118.54981 464
+1119.55553 234
+1125.09851 229
+1125.60116 254
+1126.09599 167
+1126.59405 281
+1230.65661 189
+1231.64088 314
+1232.67258 212
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 1198, +MSn(1139.0413), 115.6 min
+PEPMASS=1139.04127 35714
+CHARGE=2+
+186.06697 101
+204.08122 658 1+
+218.15805 107
+243.13278 49
+244.14801 53
+246.22237 54
+251.14872 164 1+
+274.09103 57
+321.15376 58
+325.11619 49
+333.18005 293 1+
+339.22438 51
+349.23383 60
+350.19890 79
+357.25298 112
+361.18195 67
+363.21490 51
+366.15222 525
+386.22623 51
+403.21231 77
+407.16634 198
+411.21791 52
+414.21908 132 1+
+422.91091 53
+428.18724 63
+450.19182 55
+455.22002 60
+458.21991 58
+459.25228 57
+462.23993 134 1+
+464.22820 304 1+
+470.31991 74
+476.29331 53
+480.28262 83
+482.22868 52
+485.25041 65
+489.25799 153 1+
+492.24929 87
+506.26005 61
+516.27349 63
+517.29339 65
+519.28106 74
+527.24775 64
+528.21011 167
+530.22998 65
+531.27603 67
+533.26067 72
+536.28554 64
+538.26136 61
+546.29327 53
+547.27119 114
+556.27785 68
+558.27866 57
+567.32504 85
+569.31436 82
+573.33909 50
+575.29770 52
+577.31281 295 1+
+584.36969 64
+584.85450 50
+586.38917 58
+588.21636 74
+591.28306 52
+594.35884 56
+596.29058 131 1+
+601.34493 105
+603.76938 49
+608.32113 70
+610.30278 208 1+
+613.28983 84
+634.26092 57
+639.31798 76
+642.32708 127
+645.27320 61
+645.69784 58
+647.30985 51
+648.27876 66
+648.89845 53
+649.26542 88
+651.86457 99
+657.51323 54
+662.35531 61
+662.65258 67
+663.38722 68
+665.34001 63
+669.36545 72
+680.88636 56
+684.39273 58
+688.39727 74
+689.31390 85
+690.25527 54
+691.34634 66
+692.26103 50
+697.82582 63
+705.45498 56
+708.32745 431 1+
+715.86714 95
+720.86810 51
+723.31208 61
+723.81323 52
+724.33712 69
+725.38017 243 1+
+729.37254 67
+730.37981 58
+736.31255 60
+737.29632 56
+739.33837 151
+741.40356 53
+746.32342 52
+748.32907 55
+749.38571 55
+750.81507 50
+752.30818 66
+769.41580 69
+770.49326 53
+771.45780 138 1+
+784.46852 80
+787.39974 136
+788.88140 51
+791.37784 55
+794.33014 78
+797.91877 70
+804.41933 74
+807.92282 62
+812.49865 51
+817.93752 57
+818.33864 175 1+
+821.08182 51
+827.45839 220 1+
+829.42781 83
+829.99761 73
+831.45037 69
+832.37338 177 1+
+836.41444 153 1+
+839.99869 73
+849.84689 60
+850.43848 65
+851.77661 50
+853.46598 59
+874.71994 57
+879.45280 56
+882.78317 59
+883.12336 150 1+
+883.75565 64
+887.13603 74
+891.15961 62
+893.89203 66
+898.52515 53
+901.43356 83
+903.55364 53
+913.47898 52
+916.73700 49
+925.41887 53
+926.46277 58
+936.32494 51
+939.92914 51
+949.49739 82
+951.49325 81
+956.40132 57
+957.45010 98
+962.24731 54
+973.06172 53
+975.48281 61
+977.52036 53
+979.62809 64
+989.48089 54
+996.01011 66
+1000.55753 81
+1002.86138 59
+1003.50586 68
+1014.47728 51
+1018.53806 49
+1019.55891 54
+1024.48755 51
+1032.55672 98
+1047.47530 52
+1050.46109 52
+1050.77269 60
+1052.83591 57
+1054.49573 51
+1056.58009 51
+1060.22130 57
+1063.04664 60
+1065.98145 64
+1066.98258 79
+1067.45511 69
+1070.35707 64
+1070.52062 56
+1073.59406 92
+1078.54663 197 1+
+1078.96389 57
+1080.85322 49
+1085.51386 64
+1088.57092 61
+1093.26795 101
+1093.70242 60
+1101.69695 57
+1110.27813 89
+1111.57026 50
+1113.53491 76
+1116.30722 76
+1116.54939 54
+1119.72494 58
+1128.58448 53
+1130.57950 83
+1133.48916 52
+1133.72142 298 3+
+1135.36036 127
+1135.59531 406 3+
+1137.29030 918 3+
+1139.05306 12081 2+
+1142.39291 447 3+
+1143.59063 65
+1144.28433 213 3+
+1144.55008 243 2+
+1146.67923 614 2+
+1146.92036 64
+1164.81650 59
+1199.56811 71
+1208.58517 49
+1211.65642 56
+1241.74299 63
+1248.64072 54
+1314.55958 53
+1325.53523 50
+1339.03334 52
+1395.84822 50
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 39, +MSn(594.3056), 25.0 min
+PEPMASS=594.30561 305807
+CHARGE=2+
+155.07260 370
+157.08131 359
+172.09849 1425
+173.11568 34216 1+
+175.10675 6062 1+
+182.08264 563
+183.07162 2004 1+
+187.12601 617
+199.09747 635
+200.09853 3198
+201.11542 21273 1+
+207.10960 419
+214.13234 479
+215.12585 750
+216.11441 475
+217.09836 406
+218.14316 2816 1+
+225.11889 479
+226.11063 2668 1+
+228.12474 700
+230.13364 454
+235.13190 514
+237.11938 534
+240.12798 791
+242.14698 3071 1+
+244.12150 5264 1+
+246.18023 948
+258.13947 697
+262.13190 401
+263.09532 1396 1+
+264.14388 303 2+
+265.12332 513
+270.12648 620
+270.15613 370
+271.16114 500
+284.14457 987
+285.14238 466
+288.20409 7748 1+
+294.15118 647
+296.16556 479
+297.14640 359
+298.18553 568
+301.18120 1275 2+
+302.17831 689
+303.20276 380
+311.16679 6143 1+
+315.13200 363
+316.15466 362
+327.16877 565
+329.18526 23732 1+
+330.68109 480
+337.16397 383
+339.20229 2271 1+
+341.18047 2266 2+
+342.18337 594
+343.68311 393
+344.17552 380
+345.18526 470
+355.18522 1281 2+
+357.20500 714
+359.19150 600
+360.18753 360
+363.14064 508
+363.26046 355
+365.19022 353
+368.67940 457
+372.19016 828
+373.17609 440
+377.18022 1788 2+
+381.15949 724
+382.20081 1059
+383.20685 1355 2+
+384.22315 369
+385.68938 2214 2+
+394.70134 2607 2+
+398.18489 659
+399.22256 959
+400.21637 5683 2+
+401.21611 2452 1+
+404.20953 672
+409.18611 518
+413.19654 729
+414.21862 447
+416.25743 12901 1+
+417.73347 348
+418.72812 474
+421.71371 1288 2+
+423.20185 364
+425.21557 922
+426.20436 1609 2+
+427.17854 590
+430.24063 718
+431.22210 464
+436.21111 350
+440.23661 1298 2+
+442.22951 657
+443.20590 665
+444.18576 565
+445.20705 581
+446.19154 383
+447.22207 362
+448.20763 441
+450.71396 393
+452.22415 421
+453.21480 384
+454.22561 432
+455.22439 383
+456.20716 400
+457.24598 444
+458.24891 1149 2+
+459.23277 613
+459.71180 789
+460.22859 378
+462.24950 380
+463.22934 402
+464.23731 430
+465.21664 353
+466.20663 657
+467.22883 370
+467.72048 358
+468.21687 3905 2+
+470.22986 512
+471.23230 428
+472.22468 599
+474.76332 2763 2+
+476.23076 15326 2+
+479.72812 387
+480.23730 521
+483.20727 631
+484.26505 2164 2+
+485.24504 96050 2+
+488.24202 5298 2+
+491.24359 543
+492.20198 406
+493.23262 606
+494.25107 36643 2+
+497.24317 390
+499.23986 646
+500.26657 516
+501.25474 941
+502.24559 502
+503.25559 527
+503.76630 539
+504.25425 646
+505.24740 452
+506.26772 584
+507.27004 487
+507.78313 454
+508.26819 397
+508.74891 486
+509.25266 6870 1+
+509.76626 2770 2+
+512.75556 499
+518.27365 4981 2+
+520.24517 757
+520.75119 403
+521.25528 737
+522.27197 482
+523.26037 364
+524.24324 371
+524.77877 368
+525.26031 437
+526.24910 396
+527.28049 3247 1+
+528.77335 422
+529.26629 4818 1+
+529.77100 372
+533.26445 2874 1+
+533.77631 691
+537.22154 763
+537.78046 2397 2+
+539.23420 542
+540.26810 440
+541.25115 499
+541.80892 392
+542.27525 4089 2+
+545.30145 16233 1+
+546.78991 7408 2+
+550.26461 417
+550.78809 4975 2+
+554.26389 687
+555.24201 5767 2+
+557.26358 563
+559.28509 575
+560.28295 539
+562.26627 660
+563.28366 747
+564.24960 438
+565.25716 589
+566.27302 489
+567.27094 545
+567.79343 536
+568.28013 837
+568.76860 372
+569.26537 462
+571.30038 6646 1+
+571.78325 382
+572.80705 364
+575.28924 790
+576.30239 881
+576.79594 982
+577.29036 3889 2+
+580.27482 424
+581.26732 397
+582.27981 471
+583.26186 504
+584.27539 459
+584.74780 358
+585.30195 2428
+585.79709 7112 2+
+587.29528 6747 1+
+587.80999 2661 1+
+591.80433 499
+592.31834 4893 1+
+592.81370 6251 2+
+593.80916 9898 1+
+594.31137 13305 1+
+594.81066 14243 2+
+596.32230 8965
+596.82180 5149
+597.33559 21633 2+
+600.31403 494
+601.35513 389 1+
+603.30872 567
+609.26881 367
+610.23976 460
+617.30320 451
+618.29392 415
+622.32074 552
+624.32035 354
+625.28949 985
+626.28892 739
+627.28680 413
+641.33462 520
+642.32238 4530 1+
+657.34846 570
+659.34988 31888 1+
+666.25121 809
+667.29244 419
+667.84246 483
+668.27956 422
+670.32403 617
+671.32880 464
+681.35367 848 1+
+683.27203 742
+684.28772 650
+685.31676 549
+689.32627 2191 1+
+701.31755 378
+703.37516 365
+709.36316 958 1+
+723.38692 772
+724.39818 416
+734.37650 8195 1+
+750.35647 355
+753.35317 2157 1+
+765.40643 479 1+
+770.37148 6038 1+
+788.39540 34576 1+
+796.35739 634
+797.36294 435
+798.38391 358
+799.42547 1847 1+
+817.42175 669
+824.38901 518
+835.43523 13389 1+
+841.41210 1003
+842.42014 2703 1+
+851.40145 1417 1+
+859.43440 63497 1+
+870.41049 371
+879.46594 221 1+
+915.49055 298 1+
+924.47921 507
+935.42647 228 1+
+946.46625 410
+948.51936 1656 1+
+951.45425 1416 1+
+967.52282 164 1+
+969.48201 1088
+970.46650 9289 1+
+987.49487 22927 1+
+1035.54003 1431 1+
+1074.55364 253 1+
+1092.57254 1966 1+
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 758, +MSn(847.7508), 76.8 min
+PEPMASS=847.75082 94230
+CHARGE=3+
+159.09700 313 1+
+168.05036 130
+175.11292 112
+186.06662 935
+187.09653 1114 1+
+197.12168 91
+201.11125 240
+204.08160 3057 1+
+215.13024 392
+232.13991 1328 1+
+246.17938 227
+255.16823 227
+263.13894 185
+296.19250 90
+297.12633 71
+300.19229 2350 1+
+310.21264 974 1+
+314.21365 224
+315.14770 80
+319.17335 2255 1+
+325.18779 133
+328.22266 965 1+
+342.21243 91
+344.19066 657 1+
+349.14624 95
+351.21417 114
+357.16829 115
+358.15543 97
+359.23911 130
+364.19151 160
+366.15217 1263 2+
+367.13845 219 1+
+369.21394 1509 1+
+375.67188 362 2+
+387.22763 1953 1+
+399.29555 728 1+
+402.18285 78
+406.20943 2494 1+
+414.19179 118
+415.17863 120
+416.22978 107
+426.23826 182
+427.29482 2847 1+
+432.21888 1717 2+
+434.23685 81
+434.75693 67
+435.20819 85
+442.20645 73
+443.24244 97
+444.22861 77
+446.20748 73
+448.23347 161
+454.28599 344 1+
+458.23986 417 1+
+464.28256 823 1+
+469.77846 101
+471.26512 84
+472.31577 486 1+
+473.73008 317
+474.23425 417 2+
+480.25433 73
+482.27211 9386 2+
+485.32957 101
+486.25590 140
+489.23850 97
+492.25228 109
+500.30755 2672 1+
+504.21249 68
+507.25349 2280 1+
+519.24954 326 1+
+523.27116 395 2+
+524.32794 106
+525.35137 92
+526.80330 98
+527.27050 67
+529.35382 92
+530.23570 69
+531.23850 205
+532.27728 2789 2+
+537.27465 119
+539.31987 465 1+
+541.36294 527 1+
+545.26367 85
+549.27183 128
+550.27860 76
+555.30452 344 1+
+556.78393 137
+557.31677 1203 1+
+564.00416 68
+565.26602 401 2+
+573.28062 122
+575.29053 71
+577.29658 93
+585.28402 103
+594.28260 69
+594.80866 69
+595.27238 84
+599.34339 101
+601.32277 115
+602.80047 621 2+
+603.29456 807 1+
+604.79053 250 1+
+608.31844 80
+610.37484 392 2+
+612.26434 134
+613.80855 2640 2+
+621.29772 5499 1+
+628.31125 193
+628.84966 138
+630.27465 588 1+
+631.88057 5488 2+
+634.35540 100
+635.29617 94
+636.29789 138
+637.42391 365 1+
+639.83194 115
+640.84503 70
+641.84547 90
+642.31087 86
+643.32002 69
+644.31133 244 1+
+646.31028 126
+646.80552 330 2+
+648.34999 85
+650.36038 370 1+
+654.34574 112
+654.83937 104
+655.32208 68
+657.29872 101
+658.33118 1076 2+
+660.32718 88
+662.34618 122
+663.38129 76
+664.31574 599 1+
+666.84230 73
+668.36338 1162 1+
+672.31618 86
+676.25834 72
+677.83527 671 2+
+681.41010 339
+681.88693 905 2+
+686.37152 2234 1+
+687.60618 80
+690.31780 112
+694.27009 128
+695.29962 89
+696.33429 359 1+
+696.83865 81
+697.84470 255
+698.35048 350 1+
+702.36560 90
+703.37424 71
+705.31784 132
+706.35475 1492 2+
+709.40120 93
+709.87731 68
+710.43867 73
+712.87794 78
+716.34554 105
+717.36261 94
+721.86630 74
+722.33308 92
+724.91384 73
+725.86827 530 2+
+728.37847 138
+730.35050 496 2+
+731.29707 403 1+
+733.33993 586 1+
+735.85783 71
+736.34992 90
+737.88008 640 2+
+739.86173 3795 2+
+742.36274 308 3+
+744.34195 100
+746.37400 83
+746.83644 89
+747.35764 117
+748.36387 287 1+
+750.34270 7695 1+
+755.39332 71
+756.99518 68
+757.44801 71
+758.38195 104
+761.37260 76
+762.33091 99
+765.34277 356 1+
+767.42703 758 1+
+770.37279 691 2+
+773.39050 95
+774.37081 80
+775.32015 104
+775.89700 126
+776.35399 96
+777.34084 67
+779.57250 86
+779.73079 643 3+
+780.90649 86
+781.39570 191
+783.37114 77
+784.40199 91
+785.44258 2029 1+
+786.03245 121
+788.90739 97
+789.39855 4476 2+
+793.36616 766 1+
+794.91777 116
+798.39652 129
+800.40499 84
+803.40058 77
+804.36672 78
+805.37900 429 2+
+809.10307 70
+810.41397 102
+812.44384 80
+814.38455 1393 2+
+816.06405 182
+816.36349 589 1+
+817.89564 87
+821.39154 104
+822.41111 92
+823.02182 889 2+
+826.41311 83
+827.40720 309 1+
+828.92521 67
+830.40290 89
+830.91194 1256 2+
+835.49959 880 2+
+836.75294 93
+838.33842 76
+839.92157 2035 2+
+841.20991 126
+841.42113 3356 3+
+843.94609 400
+844.15898 159
+844.45825 576
+845.02468 18134 2+
+846.92646 6004 2+
+847.08020 5094 3+
+849.91905 602 2+
+850.67552 110
+850.89755 1002 2+
+851.05678 129
+853.02850 97
+853.45078 873 3+
+860.38742 76
+861.41004 96
+863.43049 2918 1+
+867.45822 129
+868.48837 114
+869.45627 71
+869.92364 138
+870.44458 121
+878.91499 1345 2+
+883.45853 72
+887.45666 2447 2+
+890.42162 81
+892.40330 478 1+
+896.47105 412 1+
+896.95962 75
+905.43132 88
+914.49110 1124 1+
+919.47847 113
+919.90997 67
+920.46022 104
+928.45381 848 2+
+938.57093 562 1+
+946.44946 153
+947.46122 339 1+
+960.97469 610 2+
+964.47770 5093 1+
+975.49563 76
+979.44171 182
+981.42885 66
+983.52455 76
+990.53923 91
+992.95832 90
+993.45691 133
+994.41994 77
+1001.51410 309 1+
+1007.46911 84
+1012.47488 591 2+
+1018.49498 81
+1021.48017 1800 2+
+1046.52402 81
+1052.62088 101
+1053.61564 97
+1063.54729 1236 1+
+1068.59293 70
+1069.01146 133
+1069.53658 107
+1070.04856 92
+1078.02585 102
+1078.48073 303
+1079.49522 99
+1104.06121 72
+1112.53879 456 2+
+1121.56090 519 2+
+1129.52476 406 1+
+1161.48401 68
+1179.56448 81
+1226.62336 174
+1227.64652 133
+1262.75386 678 1+
+1315.65509 379 1+
+1478.66696 86
+1578.82302 81
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 871, +MSn(724.3762), 88.9 min
+PEPMASS=724.37624 328342
+CHARGE=2+
+157.08314 305
+172.05889 494
+175.10619 2202 1+
+183.10668 243
+200.12971 2149 1+
+215.12797 128
+225.15331 112
+226.10339 135
+228.13063 2059 1+
+240.12603 445 1+
+243.13826 1113 1+
+253.12391 131
+257.15957 494 1+
+259.09490 138
+262.10277 89
+268.13786 164
+271.14039 16948 1+
+285.15511 1470 1+
+288.20588 3023 1+
+295.13308 206
+312.14245 101
+313.15998 213
+314.67763 108
+322.15223 94
+323.16279 124
+325.68298 79
+327.19691 83
+329.16807 93
+331.18154 86
+337.16563 187
+339.19584 1174 1+
+351.16836 147
+355.16626 315
+356.22896 8508 1+
+366.21371 124
+367.20551 251
+368.20766 194
+369.17810 626 1+
+372.18512 247
+373.19632 88
+375.22965 110
+382.17280 580 1+
+384.22489 6433 1+
+388.13366 199
+392.19258 90
+396.19026 129
+397.17563 1214 1+
+400.18685 592 1+
+405.20037 95
+414.20692 1714 1+
+422.18301 106
+424.19587 86
+425.15920 107
+435.27417 8198 1+
+440.25540 167
+441.21234 83
+442.20086 137
+443.25607 100
+448.21454 84
+449.19964 101
+450.23086 1495 1+
+456.23658 77
+457.20935 116
+458.23316 122
+467.24851 279
+468.24218 2714 1+
+472.26093 125
+474.25025 104
+476.24304 80
+477.24110 118
+478.23598 905 1+
+483.22357 158
+484.20539 100
+485.26381 2742 1+
+489.17415 76
+493.24394 81
+495.25827 1157
+496.24377 4159 1+
+501.22254 271
+502.21656 196
+503.29529 133
+504.24928 77
+508.23306 145
+509.21350 99
+511.20965 126
+512.18999 124
+513.26849 6118 1+
+518.27187 80
+523.76861 447 2+
+525.21847 175
+526.21456 749 1+
+529.23866 178
+530.25359 150
+532.78003 110
+533.25695 121
+534.26026 91
+541.26304 83
+542.79647 95
+543.24729 670 1+
+545.30455 100
+546.31010 277
+546.78088 79
+547.30481 130
+551.29435 82
+552.25418 93
+553.32840 94
+562.26074 90
+563.22806 82
+564.31560 9723 1+
+571.27726 140
+571.82007 89
+572.29592 120
+573.25866 101
+574.30467 108
+579.27744 255
+580.28677 997 2+
+582.28546 111
+585.32528 91
+586.29071 117
+589.31427 2223 2+
+593.29327 100
+594.29389 190
+595.28461 86
+596.28177 208
+597.28436 329
+598.28197 207
+599.27435 174
+600.27368 93
+602.33977 98
+606.28067 100
+607.28286 289
+608.28034 123
+609.27849 135
+612.27743 149
+614.29436 1053 1+
+620.29377 86
+620.77711 78
+624.29938 576
+625.28976 1731 1+
+628.32618 259
+628.86183 97
+629.31868 198
+629.83228 144
+630.26173 99
+633.29090 78
+637.31987 1295 2+
+640.31202 80
+642.31231 2488 1+
+642.84105 86
+646.33133 3873 2+
+650.37071 602 1+
+651.83272 91
+653.27394 116
+655.26276 496 1+
+657.32835 290
+657.81171 246
+658.32482 133
+659.29234 110
+660.30067 112
+665.82264 256
+666.32692 686 2+
+671.31385 120
+672.27559 337
+673.29324 185
+673.87329 85
+674.29682 101
+674.84841 1792 2+
+677.39909 7208 1+
+688.38949 106
+689.37074 88
+693.32010 123
+694.31392 111
+697.85252 105
+698.35525 222
+701.36334 140
+701.88413 91
+702.32190 123
+705.39132 116
+705.85032 108
+706.35729 1394 2+
+710.35737 87
+712.33750 105
+713.29571 84
+715.36965 11248 2+
+720.86067 81
+721.40555 157
+721.94921 115
+723.22442 119
+723.38924 201
+723.69699 153
+723.84124 88
+724.38216 40703 2+
+725.65558 122
+727.37398 284
+727.87047 190
+728.35316 221
+728.86836 81
+729.37819 244
+736.32899 250
+738.38350 112
+739.33298 84
+743.36555 297
+744.33875 154
+750.30669 101
+751.35070 95
+753.33584 173
+754.33911 1488 1+
+762.34613 82
+764.37931 88
+765.40329 87
+768.38075 164
+769.35582 132
+771.35662 1502 1+
+785.36579 243
+786.38534 114
+788.42372 279
+789.43438 123
+800.34898 84
+806.44517 7862 1+
+816.41566 93
+839.41244 199
+840.38992 83
+849.44197 110
+856.45505 163
+857.41577 153
+866.42923 155
+867.42866 800 1+
+884.45353 812 1+
+898.39476 108
+899.41502 80
+914.44725 131
+917.47822 863 1+
+935.48960 11936 1+
+968.47765 85
+978.46886 84
+996.46876 199
+997.45259 125
+1013.48970 904 1+
+1046.52995 919 1+
+1062.57318 81
+1063.50997 88
+1064.53502 10520 1+
+1074.52569 319
+1075.53327 99
+1076.50429 81
+1143.57033 83
+1159.56625 414 1+
+1175.57101 81
+1177.62127 1761 1+
+1187.59795 111
+1188.63859 112
+1273.60337 112
+1274.67063 115
+1291.67111 166
+1292.73473 135
+1348.68955 562 1+
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 752, +MSn(697.6842), 76.3 min
+PEPMASS=697.68418 239817
+CHARGE=3+
+172.06169 105
+173.11520 1101 1+
+183.10086 280
+186.07803 106
+187.13299 256
+197.12054 132
+199.17335 4051 1+
+201.11523 3105 1+
+215.13440 475
+217.09140 191
+226.11987 99
+227.17252 3854 1+
+229.12171 442
+233.13677 99
+234.12212 1875 1+
+237.12252 139
+243.11570 310 1+
+245.09338 254 1+
+246.15997 132
+247.08480 86
+249.14457 125
+260.19489 397 1+
+262.12043 2026 1+
+267.13338 212
+268.19185 255 1+
+274.12231 110
+277.13775 94
+278.14844 172
+283.15571 556 1+
+286.20727 87
+287.14367 599 1+
+291.14205 1198 1+
+294.07460 93
+296.19623 4218 1+
+302.11752 208
+302.16947 691 1+
+310.19147 85
+311.16395 108
+312.14714 109
+313.16938 94
+314.20294 1088 1+
+315.17812 88
+319.14507 2754 1+
+323.17977 146
+328.18794 337 1+
+330.15620 157
+334.69283 424 2+
+340.22605 1166 1+
+345.15302 78
+346.17957 89
+347.20543 431 1+
+348.15914 110
+354.18512 83
+356.18819 463 1+
+358.17446 657 1+
+361.19613 85
+362.19439 314 1+
+366.17447 88
+367.19188 353 1+
+370.24472 83
+371.23432 101
+374.23057 102
+375.20936 1645 1+
+380.22444 165
+381.19781 111
+385.20658 544 1+
+387.25476 357 1+
+392.21020 483 2+
+394.18230 150
+397.24643 735 1+
+400.20911 146
+403.21642 270 1+
+407.25870 119
+410.21531 144
+414.21501 130
+415.19418 381 1+
+415.25622 2132 1+
+418.24238 751 1+
+422.18731 116
+423.20286 89
+424.23044 112
+425.22979 155
+430.21362 130
+431.22714 130
+432.22785 1663 1+
+440.20064 133
+441.23664 172
+442.22103 111
+444.27636 143
+451.24752 152
+452.27025 119
+453.26925 79
+454.21886 94
+455.28399 457 1+
+456.73248 866 2+
+457.23481 1265 1+
+462.27246 203
+462.76966 287 2+
+464.21202 86
+465.28817 438 2+
+468.23532 121
+469.27660 344 1+
+471.24957 706 1+
+474.24830 139
+476.25109 1060 1+
+479.24119 166
+480.26245 1516 1+
+487.32391 212
+488.28049 556 1+
+491.26747 171
+492.24918 110
+495.22374 140
+497.24480 122
+498.28516 1789 1+
+503.26391 142
+504.26959 121
+505.27628 130
+506.22912 80
+509.24892 144
+510.25669 103
+511.26708 408 2+
+513.28990 1312 2+
+515.26296 264
+516.28051 1560 1+
+522.25070 106
+523.26143 82
+525.90001 109
+526.28662 107
+527.26697 101
+527.79569 256
+528.29214 209
+528.76969 148 2+
+530.26755 392 1+
+533.27855 1373 1+
+537.28645 144
+538.29217 85
+538.77291 95
+539.30102 153
+544.28922 83
+548.26814 546 1+
+551.22073 133
+553.27459 366 1+
+553.59871 342 3+
+555.29846 1399 1+
+556.80529 181
+559.59709 141
+559.94160 142
+560.28809 659 1+
+560.81365 98
+565.24319 80
+566.29606 486 1+
+567.79645 85
+569.29643 133
+569.83398 1798 2+
+572.25431 82
+574.28373 90
+575.33706 109
+576.29855 151
+577.29962 101
+577.79678 1432 2+
+580.28852 91
+581.27768 167
+581.63842 88
+581.95395 82
+584.32476 439
+585.31461 1377 2+
+587.29660 448 3+
+588.29723 154
+589.30700 102
+590.27400 107
+591.31247 113
+593.28710 1171 3+
+597.31013 90
+599.33428 79
+601.38704 100
+602.32200 112
+603.83803 111
+604.32215 119
+604.79970 87
+605.29579 820 1+
+610.30374 82
+610.62766 96
+611.29177 82
+613.32017 100
+615.80408 101
+616.32052 425 1+
+618.97356 1339 3+
+620.31459 138
+621.30275 152
+623.29686 411 1+
+624.97505 902 3+
+626.33811 659 1+
+626.87988 141
+630.98081 5889 3+
+633.30856 683 2+
+637.30495 125
+639.27881 98
+641.31666 100
+641.84567 320
+642.33220 3353 2+
+647.31348 112
+647.97516 113
+648.35221 680 2+
+651.33614 89
+652.26699 152
+653.30573 149
+653.98600 500 3+
+659.29488 110
+659.99419 949 3+
+661.33733 1154 1+
+666.34005 143
+667.30172 99
+668.37838 568 1+
+671.35656 114
+672.34550 91
+673.34082 102
+677.35290 490 1+
+677.84854 90
+679.36280 253
+680.34027 891 1+
+682.88614 102
+683.34182 490 2+
+685.68067 2427 3+
+687.32887 129
+688.39373 121
+688.84794 108
+689.29191 83
+689.37156 118
+689.84583 146
+690.33330 107
+691.35141 4775 3+
+691.86391 2008 2+
+694.46084 649 4+
+695.40759 284
+695.79678 81
+696.37862 502 4+
+696.98237 112
+697.38101 1547
+697.68971 31313 3+
+698.69560 5252 6+
+699.89264 423
+700.39323 13694 2+
+703.35669 162
+703.72590 157
+704.06968 147
+704.38587 93
+706.84414 3999 2+
+709.36712 80
+716.32431 79
+717.38367 107
+718.37872 96
+720.44721 82
+721.40529 81
+726.93469 98
+737.33850 128
+738.38020 81
+744.38706 92
+751.32711 106
+753.29449 105
+761.37956 92
+765.36157 78
+774.36212 79
+775.35811 78
+777.45364 1106 1+
+783.41312 500 1+
+788.37714 6312 2+
+791.38767 88
+794.94331 106
+795.41140 128
+798.33857 86
+800.45171 84
+804.39842 467 1+
+809.42398 102
+811.41130 81
+812.44322 926 1+
+817.41542 119
+820.94408 589 2+
+824.39721 92
+829.39275 440 2+
+838.90118 5968 2+
+858.43193 99
+865.43832 113
+866.39690 96
+867.02139 107
+871.43245 155
+871.91286 88
+876.40030 80
+877.48910 132
+877.99536 169
+878.48106 96
+879.48246 168
+880.44126 450 2+
+882.45614 84
+888.51197 98
+889.42701 8146 2+
+892.41765 129
+910.40886 136
+912.45769 654 1+
+924.53203 667 1+
+929.56906 200 1+
+937.45308 80
+941.49062 887 1+
+945.96758 2934 2+
+980.47536 244 2+
+989.48765 2756 2+
+993.50160 104
+1025.57253 1061 1+
+1056.53210 992 1+
+1138.66069 423 1+
+1169.62194 1553 1+
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 75, +MSn(641.8547), 26.7 min
+PEPMASS=641.85466 516186
+CHARGE=2+
+157.07624 504
+169.11566 1571 1+
+175.06196 2426 1+
+183.10960 407
+185.08194 1727 1+
+191.10915 714
+197.12157 1272 1+
+199.17393 38017 1+
+199.49184 254 5+
+201.11310 1949 1+
+213.09429 4694 1+
+218.14657 476
+219.10785 1286 2+
+224.10532 473
+226.14638 449
+227.17242 22606 1+
+230.11076 2916 1+
+242.11333 1221 1+
+244.11376 649
+246.62952 410 2+
+251.14472 464
+254.13919 868
+255.14584 3315 1+
+255.64103 660
+260.19164 4404 1+
+262.12436 416
+266.15755 593
+269.14171 2829 2+
+272.15992 704
+282.14332 370
+283.17302 581
+284.16802 6169 1+
+296.19843 3534 1+
+298.15741 487 2+
+300.13958 593
+306.64018 1389 2+
+311.17251 12109 1+
+314.20919 7856 1+
+319.19496 762
+320.17577 228 2+
+324.12594 399
+325.16950 686 2+
+326.16170 3983 2+
+328.19437 379
+329.15031 2012 1+
+332.19902 925
+333.18143 725
+333.68090 467 2+
+337.19159 376
+339.23928 514
+340.17097 549
+341.15417 14744 1+
+342.67374 1380 1+
+345.20865 551
+347.16596 880
+349.22558 739
+355.19281 5565 1+
+356.17685 3052 2+
+360.19390 701
+364.17097 405
+367.22792 4750 3+
+368.20495 2261 1+
+368.68755 2076 2+
+371.19935 437
+371.65503 468
+373.20319 2376 2+
+374.20339 467
+375.22666 549
+382.16992 366
+382.70284 6189 2+
+385.22042 2114 2+
+386.23753 627
+387.16298 710
+390.20111 1137 2+
+395.20432 368
+396.24447 4437 1+
+404.18165 1404
+404.68968 890 2+
+406.20532 395
+407.19474 438
+409.26412 369
+411.19081 385
+413.20233 2642 2+
+414.23242 686
+415.23964 472
+416.21488 445
+417.22503 379
+421.19791 440
+422.21208 722
+423.22015 839
+424.24584 7494 1+
+428.19195 1370 2+
+431.22850 510
+431.71771 520
+432.23086 553
+433.23482 1221 2+
+434.23636 403
+437.20843 3178 1+
+438.20819 1642 2+
+440.71403 2242 2+
+442.23523 3311 1+
+444.18553 1723 1+
+445.71575 6553 2+
+448.20515 363
+449.22031 525
+449.73815 7578 2+
+451.22004 928
+452.21477 701
+454.22064 546
+455.22261 589
+456.21463 701
+457.21901 362
+458.29687 1500
+458.75397 3075 2+
+460.23207 2447 2+
+461.22805 839
+462.19420 387
+463.26602 474
+466.23827 545
+467.23573 680
+467.76841 4953 2+
+469.24184 814
+469.73831 1550 2+
+471.23700 414
+472.24170 539
+473.24077 1314 2+
+474.22800 3663 2+
+476.25578 930
+477.23960 619
+479.20335 1119
+480.22288 7198 2+
+483.22169 363
+485.25498 5076 2+
+486.27516 5424 1+
+489.23538 72180 2+
+492.25176 2048 1+
+494.24538 36799 2+
+497.21870 4347 2+
+498.21635 2169 1+
+501.23246 416
+502.23902 528
+503.23752 414
+504.24771 473
+505.23859 3115 1+
+509.26598 1070
+510.26960 18596 1+
+510.75566 2120 1+
+514.24945 432
+515.21792 11022 1+
+519.25945 926
+519.76502 10283 2+
+524.26529 441
+525.23856 464
+528.29530 831
+528.77420 45394 2+
+532.27861 851
+532.78954 417
+533.27907 728
+533.76615 801
+534.28621 6724 1+
+536.76590 476
+537.27615 8844 1+
+544.25574 395
+544.77159 427
+545.27401 982
+545.77630 4150 2+
+547.27362 766
+549.31450 588
+550.33824 1112 2+
+552.30285 644
+553.27816 28247 2+
+555.29953 6522 1+
+556.78286 482
+561.27325 543
+563.27766 625
+564.28329 575
+565.26265 536
+567.25553 659
+567.80182 401
+568.26389 382
+569.27911 1535 3+
+570.27426 588
+572.27885 634
+573.32166 3098 1+
+574.95207 2492 3+
+576.28965 3715 1+
+576.80779 787
+579.29385 2574 1+
+580.79998 447
+581.29486 3695 2+
+583.28839 689
+584.27765 531
+585.31465 11743 2+
+588.30914 3578 2+
+589.80859 12768
+590.30613 57032 2+
+593.27881 405
+594.26871 629
+595.30754 1882 1+
+597.30307 24326 1+
+602.33404 508
+606.29724 2803 1+
+611.31760 545
+612.27308 2710 1+
+615.28992 737
+616.28188 367
+617.28413 616
+618.31389 725
+619.32575 614
+620.30929 672
+621.30659 613
+622.31126 403
+623.31594 976
+623.83182 5789 2+
+624.32317 4908 1+
+629.27600 613
+630.29943 753
+631.30444 754
+631.83725 368
+632.32837 823
+632.84408 16883 2+
+635.30491 2425 1+
+638.32542 819
+638.82793 914
+639.34426 9000 1+
+639.83616 539
+640.35104 11701 2+
+641.61829 959
+641.85719 119893 2+
+644.83985 3152 1+
+645.36120 9421 1+
+649.33173 2821 1+
+651.31612 14766 1+
+658.38079 425
+659.27157 620
+660.33609 531
+666.35452 2370 1+
+668.36700 3869 1+
+673.26874 364
+675.32476 657
+676.33051 972
+677.32626 394
+679.31058 385
+683.32704 387
+686.40161 782
+687.38918 389
+689.33014 383
+690.33663 514
+692.36213 889
+693.33450 870
+694.31299 428
+698.32379 385
+700.85795 3593 2+
+710.37423 12201 1+
+714.34801 673
+715.33494 394
+716.30650 531
+717.31850 443
+719.35375 467
+720.36126 373
+730.35836 413
+731.35946 393
+732.33882 388
+734.34192 383
+736.36783 4441 1+
+742.30941 532
+743.29953 506
+745.39911 607 1+
+747.37057 2510 1+
+752.33746 472
+755.43332 920
+756.40011 567
+760.33313 493
+762.35763 485
+763.37134 477
+764.39840 8590 1+
+769.43357 1219 1+
+773.41811 800
+775.38564 376
+779.39494 2657 1+
+789.35817 670
+790.36410 709
+791.34341 491
+793.37455 8998 1+
+797.41609 17668 1+
+805.37677 476
+806.39095 429
+807.36669 1889
+808.37209 4467 1+
+813.34479 548
+814.34714 485
+823.39804 550
+824.41104 394
+825.38234 10991 1+
+831.34264 782
+832.35975 474
+846.37175 657
+847.36180 886
+848.37281 544
+849.36982 482
+850.38276 362
+851.40764 390
+853.41503 264 2+
+855.37663 270 1+
+862.40882 888
+863.38469 407
+865.46237 153 1+
+870.93624 362
+875.40910 603 1+
+880.42079 11305 1+
+890.42423 7821 1+
+896.44752 546
+898.46903 15351 1+
+903.42450 570
+904.41634 509
+910.45080 668
+911.44299 462
+916.50067 876 1+
+919.45687 1417 1+
+921.43924 2526 1+
+928.47151 399
+929.47253 444
+934.52955 449 1+
+938.46935 4794 1+
+941.49094 617
+942.49672 419
+943.52599 581
+945.47427 178 1+
+947.44872 1597 1+
+959.43849 4113 1+
+969.50269 6466 1+
+977.46349 24398 1+
+987.48348 4937 1+
+993.43012 567 1+
+1038.52276 2206 1+
+1056.54113 28139 1+
+1090.54532 406 1+
+1105.54904 3279 1+
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 220, +MSn(824.3852), 36.3 min
+PEPMASS=824.38516 93979
+CHARGE=3+
+175.10603 144
+186.06797 237
+204.08069 1047 1+
+208.07612 122
+225.09599 2140 1+
+289.15373 182
+289.18597 127
+303.18256 272
+324.17207 3448 1+
+343.19459 181
+364.18129 141
+366.15431 291
+367.15241 142
+377.19898 144
+378.18675 185
+379.18941 124
+395.24626 122
+406.17366 330
+407.17571 129
+419.22323 181
+422.71534 116
+423.24182 1876 1+
+426.23163 349
+427.23466 153
+433.21038 122
+436.26241 150
+445.27837 134
+462.26309 379
+466.23555 331
+467.24959 117
+472.25073 405
+475.20477 125
+480.26252 495
+481.25883 263
+487.23688 168
+490.27250 2818 2+
+491.26680 1055 1+
+493.22126 486
+511.25082 177
+514.30309 209
+515.71782 511
+516.22314 269
+516.71982 1251 2+
+518.30028 174
+519.25517 209
+532.29662 148
+539.31135 219
+542.20764 136
+543.73512 144
+544.23563 2589
+544.73112 1704
+545.22856 6262 2+
+551.29209 2160 1+
+552.82195 183
+555.26334 144
+556.21353 360
+556.70245 159
+557.22977 228
+560.29186 153
+560.80250 416
+561.29989 353
+562.26489 289
+563.24368 244
+564.22308 182
+570.21077 130
+571.20278 273
+572.20918 238
+572.69248 169
+575.34746 488
+576.34948 221
+580.27684 1760 1+
+581.76530 126
+584.27461 126
+585.33267 1225 1+
+589.29202 124
+596.32598 169
+602.36224 148
+603.35252 5958 1+
+608.31005 202
+609.31293 366
+613.80774 458
+614.31245 323
+616.28724 147
+618.31807 153
+618.77762 174
+619.29575 216
+620.38031 15377 1+
+620.78184 121
+621.79834 143
+624.80630 281
+625.30598 209
+625.79796 445
+626.32532 409
+626.79601 127
+627.32041 177
+627.78978 215
+628.28187 155
+631.84006 155
+632.80341 172
+637.27931 135
+638.29882 135
+638.97394 167
+642.32773 170
+652.81685 199
+653.30546 125
+654.32980 156
+655.30323 163
+656.84103 123
+671.31868 118
+672.33663 147
+672.84189 130
+679.29364 128
+681.31277 161
+681.80981 240
+682.31086 157
+688.33030 136
+689.30116 121
+690.88717 158
+691.39544 189
+691.91885 139
+693.36432 1269 1+
+698.34307 152
+700.38317 151
+706.30471 156
+717.33664 134
+721.40401 1319 1+
+721.93205 262
+724.30071 168
+725.31998 177
+732.35527 157
+745.64721 122
+749.30513 128
+751.40313 169
+757.38700 243
+757.88154 169
+758.37908 156
+758.91246 147
+759.37044 144
+763.39852 124
+765.30925 153
+767.36146 133
+767.90065 156
+769.39086 127
+770.36085 159
+771.38810 133
+771.86371 326
+772.35607 295
+772.86434 216
+773.38812 171
+773.88035 117
+774.93547 120
+776.38252 152
+777.31586 346
+778.43304 327
+779.40731 157
+790.33959 119
+790.86182 131
+791.36655 160
+792.35201 131
+795.33185 386
+796.36017 249
+796.71194 164
+803.34704 143
+805.31364 162
+809.40866 127
+810.36775 138
+811.34958 140
+811.90696 127
+812.38996 149
+813.39108 154
+814.85811 122
+815.38319 231
+817.34057 145
+817.76869 141
+818.05884 118
+818.39302 2549 3+
+820.41444 2934 2+
+821.92359 19723 2+
+824.39481 99594 3+
+826.74129 1007
+826.95686 188
+827.48938 2118 3+
+827.95210 3364 2+
+829.41042 33670 2+
+831.15118 195
+832.37626 143
+844.40622 261
+845.37653 164
+847.40092 128
+847.89196 134
+857.89439 126
+863.48805 457
+864.45429 233
+875.88445 346
+876.39822 407
+876.90458 196
+877.38861 146
+932.46898 169
+934.50675 148
+960.95152 257
+961.45200 184
+961.94188 160
+962.44639 177
+965.45475 196
+966.45568 135
+979.53772 108 1+
+1021.55412 145
+1024.96935 209
+1025.47693 304
+1026.45177 184
+1030.43046 2679
+1031.43171 1647
+1032.43314 5174 1+
+1074.51564 327
+1074.99635 239
+1075.51259 204
+1078.55376 189
+1079.55259 124
+1087.44873 205
+1089.44985 549 1+
+1123.98786 164
+1124.55951 135
+1125.02722 192
+1226.60588 216
+1227.59915 156
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 81, +MSn(610.3171), 27.0 min
+PEPMASS=610.31708 553347
+CHARGE=3+
+175.10584 482
+187.12923 441
+211.10648 418
+212.12820 471
+215.13654 855
+217.08534 709
+228.13042 1103
+243.13148 570
+244.14520 1355 2+
+261.14815 680
+294.16676 598
+295.17886 3183 1+
+301.66317 307 2+
+303.18173 742
+306.66014 182 2+
+311.14394 505
+313.18669 2393 2+
+324.15516 409
+325.69719 679
+329.68232 1036 2+
+344.17827 450
+353.22048 465
+357.18890 481
+363.71192 538
+366.20817 814 2+
+367.70168 1058
+368.20878 538
+371.20512 994
+371.69103 527
+372.19364 475
+376.22410 823
+376.73282 524
+380.20798 2490 2+
+397.19752 513
+399.19587 1351
+416.25643 752
+418.22427 1032
+418.72920 501
+422.20080 410
+422.74818 4730 2+
+427.17772 140 10+
+428.72291 606
+429.20972 562
+429.71963 1637 2+
+432.77024 915
+433.26416 756
+436.75022 654
+437.23443 553
+438.72547 3275 2+
+441.20382 425
+447.18245 1090
+447.75056 5884 2+
+454.23892 456
+457.22530 529
+458.75857 1115
+459.26052 894
+463.23691 620
+463.72566 568
+468.74958 678
+469.25225 792
+470.24570 454
+470.76266 525
+471.26774 944
+472.25425 610
+473.24402 416
+475.24442 450
+478.26448 603
+478.76484 830
+479.24701 698
+480.23090 1071
+480.73216 619
+481.20940 477
+483.28011 806
+486.26272 531
+487.28312 3241 1+
+487.78016 1471
+489.23798 5268 2+
+493.23689 1350
+493.74266 651
+494.25587 488
+497.75997 652
+498.26516 959
+498.77377 431
+505.24625 620
+506.75588 504
+507.26111 648
+509.25635 429
+517.28246 681
+518.25525 525
+519.25913 748
+521.27024 1234
+522.26747 448
+522.77608 530
+523.27163 561
+525.23348 446
+528.25193 708
+530.28422 519
+532.27267 609
+535.65698 548
+535.97982 866
+536.29646 1400
+536.64611 455
+537.27788 498
+539.25136 1227
+540.26985 544
+541.65708 514
+541.98444 574
+542.29849 440
+544.31660 1233
+545.29334 475
+546.25613 1794 3+
+547.25622 480
+548.26510 629
+549.27486 457
+549.78528 716
+550.27686 691
+551.26301 468
+551.78075 462
+552.30899 515
+553.29753 471
+554.75981 541
+555.28200 425
+556.28057 836
+556.60510 739
+556.78983 480
+557.28918 959
+558.28835 877
+559.28749 619
+560.28156 651
+560.79567 8020 2+
+562.27036 1376
+562.63293 443
+562.76947 514
+563.27039 792
+564.95071 1408
+565.28155 1361
+565.61710 744
+566.25734 514
+567.27298 597
+569.29386 855
+570.95240 17218 3+
+573.29223 679
+574.28215 523
+575.26532 780
+575.57400 573
+576.27310 1407
+576.62291 1324
+576.95707 90559 3+
+578.92695 678
+579.28186 752
+580.26075 1060
+580.57657 744
+581.28000 454
+584.29287 436
+585.30222 624
+587.30423 5245 1+
+588.76991 425
+592.29659 428
+593.30745 525
+594.74920 423
+595.32166 869
+596.30509 677
+597.28800 647
+598.26266 414
+598.65602 586
+598.80218 441
+598.97438 497
+599.29657 1023
+600.30818 414
+600.81917 1030
+601.31111 2469 3+
+601.80789 1068
+602.31906 6395 1+
+602.82223 4570 2+
+604.64762 10805 3+
+605.78949 820
+606.29674 938
+606.82285 750
+607.00287 492
+607.31580 6069
+607.64455 560
+607.81577 11234 2+
+608.31813 17521 1+
+608.60711 452
+609.31945 16298 3+
+609.67886 12134 7+
+610.32528 208376 3+
+611.81556 16211 2+
+612.31301 8015 1+
+613.82331 28989 2+
+618.32279 460
+625.36611 3715 1+
+629.31446 470
+630.31715 684
+632.31915 529
+637.84994 966
+638.33318 1093
+646.84836 1456
+647.34791 1416
+648.34941 424
+649.33744 3274 1+
+656.37513 463
+658.35737 3729 1+
+666.36181 522
+668.33826 411
+690.34767 664
+691.34155 428
+692.32948 716
+714.37462 506
+724.84984 423
+726.40182 565
+731.40907 2711 1+
+734.39965 1546
+735.39302 929
+736.89377 544
+737.40776 458
+742.38390 599
+747.37696 840
+748.36219 465
+751.44820 615
+752.42373 422
+759.40869 3555 1+
+792.40972 423
+793.37882 731
+794.36579 426
+801.41469 4801 2+
+812.40809 1512
+813.40028 502
+818.88056 379 2+
+835.44558 504
+842.43408 431
+844.48908 407 1+
+848.42217 907
+849.43048 602
+849.93438 473
+850.42982 528
+856.42782 470
+858.43198 3764 1+
+858.44366 5856 2+
+864.48116 493
+872.49204 467
+876.44367 775 1+
+894.49384 1663 1+
+985.47932 748
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 588, +MSn(764.3961), 63.5 min
+PEPMASS=764.39611 329352
+CHARGE=2+
+171.06574 223
+173.11746 1147 1+
+175.10731 996
+183.10201 748
+186.06517 385
+189.08190 293
+193.08463 212
+201.11832 3443 1+
+204.08594 415
+218.13993 157
+221.08846 384
+228.09996 514
+231.09473 135
+238.15571 180
+239.13604 245
+240.12993 182
+242.14430 166
+245.12748 273
+246.10861 761 1+
+249.15113 389
+250.15919 221
+256.15173 165
+263.14240 163
+266.15423 305
+272.15288 214
+273.12204 321
+276.13262 238
+277.14570 631 1+
+284.16292 5932 1+
+291.17628 125
+294.14706 393
+295.16645 245
+296.17678 180
+301.14856 201
+302.17125 941 1+
+304.14024 1188 1+
+313.18503 165
+314.18057 170
+315.17338 870 1+
+319.16561 806 1+
+322.15291 5250 1+
+325.66247 156
+326.17054 155
+328.18859 137
+329.15014 130
+331.19452 256
+332.19417 160
+334.17943 1597 1+
+341.18549 2752 1+
+344.19966 256
+345.15895 321
+346.16010 377
+349.19227 125
+359.19973 3261 1+
+363.18336 152
+364.16531 336
+365.15714 150
+373.17698 406
+374.16712 648 1+
+379.21447 3371 1+
+381.18207 2496 1+
+389.22506 128
+390.20234 303
+391.16823 1958 1+
+402.19709 232
+403.20331 283
+405.17401 236
+407.22941 979 1+
+409.18001 5822 1+
+415.18503 152
+417.21800 380
+418.20861 199
+419.18510 249
+420.21790 391
+421.21469 227
+427.24556 173
+435.22936 1779
+436.23331 15196 1+
+440.20730 131
+442.21260 125
+445.21952 158
+446.21829 179
+447.23663 1241 1+
+447.74264 124
+454.27653 135
+458.23003 2552 1+
+469.24176 129
+470.25225 134
+472.27526 365
+473.26321 166
+474.24647 152
+476.25247 993
+477.23711 2373 1+
+478.75195 1557 2+
+485.24956 135
+486.23252 3691 1+
+492.23116 225
+494.26385 10765 1+
+495.76385 191
+500.28300 356
+501.26397 195
+502.26644 156
+503.24590 375
+503.77148 1112 1+
+504.24928 8580 1+
+512.25505 165
+515.24273 129
+517.24011 144
+518.26117 1247 2+
+521.24381 177
+522.25851 19014 1+
+527.30621 165
+530.28498 248
+531.26924 162
+532.25083 264
+533.27274 168
+534.27242 181
+535.30234 134
+536.27522 1323 1+
+540.26787 301
+540.59800 216
+541.27462 186
+545.29365 129
+548.29939 266
+549.31485 4751 1+
+555.30607 210
+560.30061 179
+561.24618 156
+562.30555 226
+568.28909 132
+569.27772 227
+570.28427 340
+570.72350 201
+571.29296 360
+571.73103 233
+572.29604 323
+573.29400 188
+576.30531 353
+577.29883 147
+578.30703 181
+581.29616 160
+582.31358 220
+585.30753 2414 2+
+587.28850 876 1+
+589.32944 372
+590.31527 1360 1+
+596.78749 176
+597.32088 144
+599.31694 2239 1+
+602.83273 145
+603.30302 159
+604.81393 277
+605.29951 1578 1+
+605.79127 137
+607.34330 4358 1+
+610.86416 204
+611.32113 296
+613.81940 1858 2+
+617.32545 3855 1+
+623.30322 1104 1+
+629.30942 266
+630.28001 147
+631.30616 197
+632.34508 138
+635.34355 8168 1+
+638.82592 136
+642.33678 169
+643.35531 128
+646.34098 368
+646.82420 569
+647.32174 1098 2+
+650.33534 188
+655.33746 12039 2+
+659.33047 128
+660.35771 204
+662.28833 130
+663.36460 6478
+663.92017 136
+664.34316 20390 2+
+669.82812 142
+674.31112 124
+676.34560 125
+679.31706 156
+681.31759 198
+684.38063 164
+685.35625 133
+686.38574 138
+689.85484 1775 2+
+690.35368 1111 1+
+698.85462 393
+699.35362 2034 1+
+699.85209 1211 2+
+706.35852 160
+707.85585 7542 2+
+710.87430 134
+716.33474 282
+717.35163 182
+718.37036 1870 1+
+724.37897 329
+724.86715 214
+729.36561 155
+733.37489 200
+734.35040 675 1+
+736.38905 1975 1+
+737.88724 258
+738.90018 132
+741.86770 167
+742.37477 230
+742.88826 124
+744.41495 181
+745.34951 164
+745.84731 144
+746.39260 9013 2+
+749.38342 154
+752.35700 373
+752.86187 156
+753.35834 245
+755.39214 7823 2+
+758.70475 138
+759.40955 202
+760.37664 172
+760.81023 147
+761.38505 760 1+
+761.90237 202
+762.88454 925 2+
+764.40239 49270 2+
+767.35517 1872 2+
+769.39236 1251 2+
+770.72144 225
+774.39248 306
+775.39296 253
+779.35569 198
+780.38604 136
+791.39516 153
+792.40314 10327 1+
+811.41380 145
+829.42543 249
+830.39134 155
+842.38206 135
+847.42507 409
+848.42652 237
+849.42456 182
+857.43414 129
+865.44000 1286 1+
+874.43412 180
+875.44806 511
+876.42620 912 1+
+885.99756 206
+886.46833 304
+887.47530 156
+891.45224 137
+892.45784 268
+893.45506 30048 1+
+951.49253 155
+956.49662 1002 1+
+961.46361 242
+979.48863 1114 1+
+988.46949 128
+989.52619 220
+1006.53910 13746 1+
+1035.51506 392 1+
+1074.56711 163
+1075.54078 151
+1092.56749 939 1+
+1149.58790 159
+1169.60779 2038 1+
+1226.63151 2480 1+
+1327.69052 397
+1328.65352 376
+1414.71149 159
+1415.72336 141
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 748, +MSn(789.0604), 76.1 min
+PEPMASS=789.06034 660608
+CHARGE=3+
+168.05363 199
+175.10323 160
+185.15328 110
+186.06786 1280 1+
+189.07388 87
+199.14666 158 1+
+200.11747 123 2+
+204.08304 2684 1+
+213.13936 102
+214.11683 472 1+
+226.11072 152
+227.16909 130
+228.13226 100
+229.12375 160 1+
+234.14014 625 1+
+239.17266 76
+243.12711 251 1+
+246.13650 249 1+
+256.13701 85
+260.18572 82
+263.13476 174 1+
+265.13001 273 1+
+269.11522 70
+278.15842 175 1+
+281.13121 75
+286.13626 147 1+
+295.11963 80
+298.66821 137 2+
+302.15750 133 1+
+307.14475 73
+316.12780 74
+323.66919 80
+326.18136 177 1+
+328.13774 340 1+
+334.16027 83
+339.15671 83
+341.20260 164
+345.16330 564 1+
+348.16022 120
+355.17313 95
+357.21382 84
+360.17950 113
+362.19421 88
+363.17889 367 1+
+366.14545 1180
+367.22634 92
+369.21146 80
+375.20177 295 1+
+376.20271 240 2+
+385.23033 68
+386.68899 117
+387.20360 163 1+
+396.16891 104
+399.22766 335 1+
+406.13893 74
+412.24098 74
+413.22153 131
+413.63915 69
+414.21827 385 1+
+414.72117 200 2+
+421.21383 73
+422.72891 92
+425.27054 73
+426.22874 133
+427.15806 101
+429.18971 83
+431.73704 100
+434.21429 371 2+
+440.23389 120 2+
+441.27189 188 2+
+443.23281 69
+445.21169 239
+449.26849 102
+452.19693 105
+453.21568 189 1+
+455.23734 325 1+
+457.73126 255 2+
+459.21003 210 1+
+460.64549 72
+463.02139 73
+463.25821 258 1+
+468.16591 123 8+
+469.22546 71
+470.23769 340 1+
+472.23497 370 1+
+476.27310 352 1+
+479.24868 271 1+
+484.20746 121 3+
+485.25192 123
+485.89105 128 1+
+487.26210 101
+488.27811 442 2+
+489.27401 123
+491.27610 78
+492.25755 208 1+
+494.87828 77
+496.25062 207 2+
+497.23628 225 1+
+499.13547 107
+501.28015 341 2+
+504.25064 180 1+
+505.74613 121
+509.23859 571 2+
+511.23593 93
+513.22563 68
+514.26091 321 1+
+515.78829 73
+516.21446 321 1+
+517.73326 490 2+
+518.25000 718 1+
+522.19963 119
+522.31664 249 2+
+522.77712 141 1+
+524.27252 293 1+
+525.73512 110
+526.74106 1088 2+
+528.75694 249 2+
+530.31283 154 1+
+532.26870 178
+532.76420 76
+533.29611 354 1+
+535.27418 245
+537.79018 104
+539.34769 223 1+
+542.26609 234 2+
+543.26577 158 1+
+544.72249 107 6+
+545.29314 373
+545.78333 382 1+
+545.88256 110
+546.79489 450 4+
+547.28383 391 1+
+550.25972 438 1+
+550.62882 69
+551.52274 69
+552.75107 136 1+
+554.22826 114
+555.30544 163
+555.72721 227 1+
+557.34670 138
+558.24887 76
+559.23699 112
+560.25782 106
+561.26178 244 1+
+565.23394 81
+565.77843 81
+568.25055 721 2+
+568.94839 202 3+
+570.80505 89
+571.27391 388 1+
+572.26405 1035 1+
+573.74092 546 1+
+574.26275 552 2+
+576.25250 111
+576.33365 126
+576.93162 69
+577.24557 241 1+
+578.77901 345 2+
+580.81822 178 1+
+582.25657 3840 2+
+585.26275 79
+585.81043 161 1+
+586.47273 347 5+
+588.92302 75
+591.30690 1071 1+
+591.80844 350 2+
+595.29272 415 1+
+595.57853 73
+597.05781 243 4+
+598.80308 144 1+
+600.36292 156 1+
+601.83819 718 2+
+603.27057 139
+604.36778 83
+605.18113 370 1+
+605.80898 114
+607.30193 553 1+
+610.79936 139
+611.82764 151
+612.30503 367 2+
+613.26953 386 1+
+616.28799 567 1+
+616.83875 250 4+
+620.76209 252 1+
+621.33942 115
+621.76258 334 2+
+623.75086 255 4+
+624.80527 347
+625.29564 419 1+
+626.84239 202
+628.30838 160
+628.79145 240 1+
+629.10440 74
+630.31780 272
+630.79751 666 2+
+632.32200 429 2+
+633.13698 141 6+
+634.30746 285 1+
+638.80144 2744 2+
+641.33851 363 1+
+642.92737 117
+643.32791 295 1+
+643.78198 143 1+
+645.30539 220 1+
+645.99810 84
+649.84667 239 2+
+650.84420 184 6+
+651.31398 351 2+
+652.86352 250 5+
+653.68214 292 3+
+653.78269 108
+655.31656 389 2+
+657.29662 393 2+
+658.65757 74
+658.80832 394 1+
+659.34706 696 2+
+659.54472 89
+661.30779 147
+662.33394 1753 1+
+662.98887 76
+664.80175 466 2+
+666.84377 287 1+
+668.29327 459 1+
+669.84562 161 1+
+671.79374 178 1+
+672.33360 244 1+
+673.84176 488 1+
+675.33845 591 3+
+677.27444 303 5+
+678.30609 217
+678.66034 96
+678.85301 227
+679.34951 647 2+
+681.71678 109
+682.34627 702 1+
+682.81853 88
+685.87534 75
+686.36692 91
+686.82152 644 1+
+687.32611 1211 2+
+690.17499 112
+690.35612 120
+691.39132 270 1+
+692.21982 105
+693.28349 95
+695.33855 104
+695.82683 2419 2+
+698.24550 238 3+
+700.84029 118 1+
+701.33846 413 1+
+703.06151 130 1+
+704.87622 73
+705.34689 316 1+
+706.84227 72
+708.91511 370 2+
+709.71193 77
+710.84413 95
+710.96853 130
+711.31883 548 3+
+711.97350 407 6+
+713.35807 76
+713.72056 140
+714.39514 286 2+
+716.32381 246 2+
+718.42336 143 1+
+719.73265 101
+721.35176 290 2+
+721.86309 492 1+
+722.87749 534 2+
+724.80420 256 2+
+726.34471 696 1+
+728.72303 71
+728.86508 321 2+
+730.35980 386 2+
+731.11079 80
+732.37869 341 2+
+733.67320 84
+734.35109 151
+734.78467 188 1+
+735.05526 79
+735.36141 304 1+
+736.87077 248 1+
+737.37398 200
+737.82358 694 3+
+737.87009 497 4+
+741.42422 285 1+
+742.34755 268 1+
+743.35032 1506 2+
+746.22281 103
+746.69452 254 5+
+746.69551 186 1+
+748.46110 319 5+
+749.36968 4433 1+
+749.87433 87
+750.00169 118
+750.38016 1514 3+
+751.39776 977 4+
+752.36992 3662 2+
+753.87813 479 4+
+754.68962 267 3+
+756.77941 179 1+
+757.34111 342 2+
+758.09667 94
+759.35116 267 1+
+759.36226 344 5+
+760.39301 264 4+
+761.80613 81
+762.96146 140
+764.38478 731 2+
+766.24966 85
+767.48425 76
+767.83080 169
+768.03997 792 3+
+768.87793 780 4+
+770.26715 94
+770.52342 170 1+
+771.38741 337 1+
+771.57964 265 3+
+772.79407 346 2+
+774.38687 186
+775.39358 348 2+
+775.80937 79
+777.39717 384 2+
+777.73279 151
+779.02079 237 1+
+779.38799 1104 1+
+780.41024 848 5+
+780.88302 1054 2+
+782.42203 1558 3+
+783.71879 1607 3+
+785.90442 1916 4+
+786.90744 600
+787.43022 773
+787.87240 2556 1+
+788.44323 3518 3+
+788.69040 131
+789.39355 6354 1+
+790.07854 9112 3+
+791.86166 2053 2+
+793.36353 1075 4+
+793.39398 1696 1+
+793.90508 2109 2+
+795.40688 748 3+
+799.90639 227 1+
+800.38263 548 1+
+802.85562 68
+806.37758 124
+808.42948 365 1+
+808.90757 940 2+
+810.25436 68
+811.38547 71
+812.23514 69
+818.47011 138 1+
+820.39240 186 4+
+822.37621 220 1+
+823.91467 70
+824.53510 190 1+
+828.35696 142
+830.44926 258 2+
+831.38259 240 2+
+833.73296 172 2+
+835.47722 341 1+
+838.39954 381 1+
+843.69739 348 4+
+849.37478 157
+850.46373 130 1+
+852.41727 483 2+
+853.58068 85
+854.41003 243 1+
+854.95366 75
+859.89074 73
+860.41684 126
+861.68267 72
+862.45799 2398 1+
+867.42131 295 1+
+868.02636 84
+872.44863 70
+876.46623 153
+879.46753 133
+883.46008 89
+885.57961 69
+886.91520 447 2+
+889.45587 95
+893.26286 71
+894.47023 74
+895.44332 255 1+
+898.11120 70
+906.48905 68
+915.95314 86
+916.45598 138 1+
+919.44999 117
+920.35712 126 1+
+922.47057 304 1+
+928.14763 69
+930.09622 255 3+
+931.63497 144 1+
+938.49247 76
+939.39210 81
+942.96554 107
+946.43107 72
+949.96936 76
+951.61894 68
+952.41378 70
+953.51113 146 1+
+964.47090 100
+975.54894 689 1+
+977.99884 69
+988.46161 136 1+
+994.47681 72
+1001.66182 79
+1005.50861 268 1+
+1010.52750 76
+1012.48182 72
+1030.51962 82
+1034.51140 144
+1035.42095 91
+1036.44483 171
+1042.40321 68
+1049.54127 75
+1059.53373 101
+1072.58198 122
+1084.00854 71
+1084.44818 74
+1089.61573 301
+1090.57148 178
+1092.60711 75
+1093.28383 83
+1110.53230 114
+1163.50587 437 1+
+1277.55625 82
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 591, +MSn(509.9328), 63.7 min
+PEPMASS=509.93283 45836
+CHARGE=3+
+173.11595 2631 1+
+175.10557 1545
+183.10405 1016
+185.08676 437
+187.13044 484
+189.07737 835
+190.09059 464
+193.08545 712
+200.13298 2798
+201.11831 5835 1+
+203.10013 2607 1+
+213.08730 1334
+215.13201 1234
+221.08759 697
+226.08170 1583
+228.11890 2372 1+
+231.10045 4561 1+
+240.13549 456
+244.09556 2559 1+
+246.10939 842
+249.16104 1403
+258.14667 688
+262.12851 384
+270.15725 747
+275.16186 5169 2+
+277.14338 623
+280.15298 1130 2+
+284.16342 1331
+285.15976 501
+294.15087 1623
+295.14764 531
+304.16173 698
+305.16441 916
+306.17490 646
+311.17481 683
+312.16390 605
+315.16128 1341
+315.66371 442
+317.15971 435
+318.17103 707
+319.16883 502
+322.15373 4774 2+
+323.16232 1016
+323.66899 1638 2+
+326.16913 559
+327.14363 552
+332.18328 2829 2+
+334.19157 1966 2+
+335.18419 455
+339.19472 976
+341.18747 692
+341.69380 474
+342.19453 474
+344.18861 542
+345.14909 6841 1+
+345.69542 462
+350.69177 513
+351.18508 609
+357.20804 954
+358.20354 408
+359.19827 1114
+359.69467 8141 2+
+362.18213 490
+363.17826 553
+364.16635 568
+368.69976 3396 2+
+373.16230 829
+374.15031 560
+379.20906 9250 2+
+380.20940 1942
+381.18352 4692 1+
+388.19641 960 2+
+391.17340 2736 1+
+396.70520 1964 2+
+401.19429 414
+402.22981 679
+403.20062 465
+406.20710 890
+406.71635 439
+407.23140 1067
+407.69915 665
+409.17939 7221 1+
+413.20911 1097
+415.21177 690
+415.70747 450
+416.21544 401
+417.21388 991
+418.21058 590
+419.20920 2725 2+
+420.21346 791
+424.21505 6638 2+
+429.71412 1051
+430.22533 1295
+431.23508 468
+432.23691 471
+433.22108 598
+435.22372 2413 2+
+436.23419 114800 1+
+438.72215 8297 2+
+441.19784 518
+442.22508 672
+446.21982 1162
+447.23193 6324 2+
+453.23169 428
+458.23306 3732 2+
+459.23135 1552
+460.24217 555
+463.21732 447
+467.73368 500
+468.23824 525
+472.24587 669
+472.73946 394
+473.24644 481
+476.25340 1259
+477.24763 1567
+478.23810 724
+480.22319 384
+481.23881 685
+481.75682 524
+486.24100 3334 2+
+487.22784 1267
+488.23985 475
+490.24462 2755 2+
+492.23120 863
+493.22964 428
+494.26272 10740 1+
+494.76998 458
+495.76229 577
+498.25771 716
+499.24315 459
+500.25909 613
+501.25752 467
+502.23978 456
+503.29494 515
+503.77672 1087
+504.25193 8834 1+
+504.60034 619
+506.56664 378
+507.22128 7278 1+
+507.71103 1758
+508.21426 6527 2+
+511.89830 1253
+512.23878 1310
+512.55518 1611
+512.88851 1152
+513.24575 1092
+513.59244 394
+514.25578 455
+515.25871 458
+518.26644 986
+519.27136 493
+520.27205 467
+521.77949 438
+522.26035 19306 1+
+524.78844 418
+526.28298 500
+532.28902 705
+533.29224 523
+534.23823 421
+536.27289 975
+539.29216 637
+543.30211 403
+546.26374 526
+548.29037 587
+549.31645 21010 1+
+553.27118 425
+559.29869 4373 1+
+564.27648 380
+568.30517 5770 1+
+576.29187 457
+576.78817 677
+577.29892 658
+578.29939 407
+585.29566 515
+587.29093 905
+588.28656 787
+590.31943 1002
+591.32019 481
+599.31662 1648
+600.31627 911
+604.80197 495
+605.29785 4744 1+
+605.80385 540
+607.33196 4170 1+
+617.32307 3801 1+
+621.30488 642
+623.30417 1314
+624.30186 459
+629.30371 591
+630.30133 394
+633.29994 396
+635.34153 8145 1+
+643.30018 730 1+
+646.33070 7284 1+
+646.82369 668
+655.32372 583
+655.83479 1012
+656.34217 719
+656.85228 405
+663.35929 28903 1+
+664.85206 473
+667.37586 1581 1+
+672.33723 381
+674.33663 1308
+675.34251 571
+681.32897 457
+681.84372 405
+682.35367 697
+690.34628 1008
+690.84840 536
+691.35686 574
+698.84832 506
+699.34271 1200
+699.84382 788
+700.36933 1328
+701.37759 500
+708.37701 564
+710.79707 419
+711.79199 426
+716.33050 691
+717.34037 442
+718.38207 5509 1+
+734.34804 1145
+735.34752 834
+736.39224 2117 1+
+752.34853 853
+753.36007 412
+757.41084 901 1+
+761.35559 446
+762.34727 412
+766.48607 588
+774.39155 959
+775.38554 6730 1+
+779.37133 414
+792.40313 10054 1+
+803.38441 992
+829.40715 545
+830.39938 587
+831.38906 464
+837.41113 942 1+
+847.42282 2950 1+
+858.41857 399
+865.44249 1698
+866.41430 1495
+867.52772 588
+869.44017 230 1+
+875.43106 546
+876.43702 5104 1+
+893.45658 8739 1+
+915.45885 333 1+
+943.45179 791
+944.46504 665
+961.47030 830
+962.46146 928
+971.47473 200 1+
+979.48197 4959 1+
+989.53004 584
+1006.54607 892
+1007.53391 495
+END IONS
+
+BEGIN IONS
+TITLE= Cmpd 204, +MSn(524.2825), 35.5 min
+PEPMASS=524.28252 121118
+CHARGE=3+
+155.10117 348
+175.11028 361
+183.10336 5108 1+
+187.13047 225
+199.17421 2625
+200.13196 33224 1+
+211.10594 1225 1+
+215.12409 361
+226.13432 500
+227.17006 1847
+228.13144 18133 1+
+232.13692 1304 1+
+235.10842 221
+237.15965 256
+242.18076 795
+243.14286 407
+246.11492 364
+249.16132 282
+253.00067 249
+254.15788 833
+255.00060 369
+255.16767 782
+260.19709 4827 1+
+265.15351 223
+270.15767 4430 2+
+277.14641 230
+279.17162 1374 1+
+282.16704 1911 1+
+296.20389 694
+300.15278 383
+301.12576 370
+307.16584 651
+308.17510 252
+309.18899 245
+313.21852 850
+314.19522 321
+323.20753 452
+324.19096 1657 1+
+330.16744 240
+331.19963 1920 1+
+338.16763 376
+341.21918 7076 4+
+342.19219 2562 2+
+343.22059 451
+350.24866 1120 1+
+355.20585 407
+359.19970 689
+360.18583 344
+361.68768 266 2+
+367.19099 244
+368.24304 252
+378.20951 295
+379.04198 240
+380.15312 263
+386.22588 261
+394.20036 279
+397.18930 219
+401.14990 1748 2+
+402.24387 4608 1+
+402.65659 605
+403.70861 233
+409.22811 1394 2+
+410.15152 1752 2+
+410.88985 505
+411.17602 3045 2+
+413.24164 444
+414.22362 486
+416.22110 413
+416.70940 292
+417.22857 251
+418.23474 381
+421.25238 294
+421.73966 244
+426.21675 248
+428.22972 239
+429.17325 315
+430.17075 270
+434.25838 238
+438.24279 321
+440.24187 308
+442.56097 225
+443.23417 364
+445.20653 278
+446.25552 1309 1+
+448.58149 2092 3+
+448.71546 222
+450.15162 299
+450.65043 351
+451.15276 567
+451.67050 255
+452.22354 223
+454.30122 754
+457.73387 510
+458.21297 530
+458.66576 597
+459.17771 3056 2+
+463.22023 246
+464.24895 327
+466.19192 10003 1+
+466.69777 7075 2+
+468.17898 6393 2+
+471.22935 282
+471.72203 287
+472.23038 358
+472.65587 1706 2+
+473.66287 1513 2+
+475.26616 350
+475.74949 7282 2+
+479.25400 287
+480.24997 378
+481.24971 260
+482.22266 234
+483.24891 550
+483.75051 637
+484.25605 674
+484.76780 348
+485.25215 304
+486.27652 3378 3+
+488.25512 315
+488.74086 623
+489.24804 505
+489.60421 5115 3+
+490.11852 315
+491.10403 234
+491.25857 304
+491.76888 299
+492.23741 293
+492.77542 301
+492.94213 253
+493.25294 3243 2+
+493.61104 285
+493.92789 283
+495.26160 350
+496.27081 342
+497.21431 248
+497.73865 1675 2+
+498.93795 3860 3+
+500.26886 363
+501.23989 781
+501.76795 13523 2+
+503.76949 3133 2+
+506.25384 2984 1+
+506.72395 542
+506.92214 2573 3+
+508.13403 378
+510.24437 2756 2+
+512.25955 500
+512.62404 457
+512.94077 21422 3+
+514.71510 1155
+515.21383 2199
+515.72374 10778 2+
+517.93443 646
+518.28260 13998 3+
+521.28683 452
+521.56374 372
+521.76339 284
+521.91923 326
+522.24967 3064 1+
+522.78132 1390
+523.72516 64261 1+
+524.23217 11234
+524.94550 1582
+525.26711 48416 2+
+526.53100 255
+527.21581 7168
+527.71377 20425 2+
+530.26002 455
+534.25025 312
+535.26329 384
+536.28811 274
+537.28924 392
+538.26822 297
+539.30807 7017 1+
+541.76035 328
+542.28618 574
+542.76378 381
+543.27684 602
+549.28903 361
+550.28398 766
+550.77316 2320 2+
+555.30352 459
+557.30677 379
+558.26941 517
+559.28509 33371 2+
+562.29648 266
+564.25243 463
+564.78649 228
+565.29024 326
+569.30831 259
+576.27394 235
+582.26157 398
+585.28501 257
+590.30827 376
+594.28295 1596 1+
+599.30416 261
+602.34436 249
+603.35006 234
+604.33465 386
+605.32957 236
+606.31089 307
+606.81906 1107
+607.31452 4285 2+
+614.82734 236
+615.30599 247
+615.82587 63376 2+
+619.18336 285
+620.82708 287
+621.31931 585
+622.31862 362
+638.31668 275
+639.31129 326
+640.34296 266
+645.18213 232
+647.19066 256
+648.32360 252
+650.33238 225
+654.28084 231
+654.87083 245
+655.35521 382
+656.36221 326
+662.34087 247
+663.36119 731
+663.85229 2941 2+
+669.36335 246
+671.33727 773
+671.87836 477
+672.36859 92472 2+
+676.30154 383
+677.34589 715
+677.87484 242
+681.43108 239 2+
+682.33415 228
+683.37711 1275 1+
+689.34719 4920 1+
+704.36673 294
+711.28085 605
+720.38724 318
+722.36809 2276 1+
+725.38632 335
+725.88345 243
+728.91114 5096 2+
+733.37743 663
+733.90267 9462 2+
+743.32913 238
+775.43439 834
+776.41090 351
+777.40820 278
+784.37111 2315 1+
+790.35711 724
+791.35297 405
+801.29252 478 1+
+803.29086 477
+804.32001 303
+817.44894 1604 1+
+819.29576 1483 1+
+821.34477 2052 1+
+858.38227 360
+903.45006 245
+931.49625 610
+932.38827 895 1+
+935.35068 813 1+
+944.30447 498 1+
+946.31847 531 1+
+971.46111 499
+1002.52863 762 1+
+1084.53371 468
+1099.54819 244
+1100.53904 486 1+
+1117.55479 637
+1118.57910 362
+END IONS
+
diff -r 186fdc4b3310 -r 6cdbfdffb38e tool_dependencies.xml
--- a/tool_dependencies.xml Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,9 +0,0 @@
-
-
-
-
-
-
-
-
-
diff -r 186fdc4b3310 -r 6cdbfdffb38e update.sh
--- a/update.sh Mon Sep 16 17:32:18 2013 -0400
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,35 +0,0 @@
-#!/bin/bash
-
-LICENSE_FILE=LICENSE
-# Ensure repository contains license file.
-if [ ! -e "$LICENSE_FILE" ];
-then
- wget http://www.apache.org/licenses/LICENSE-2.0.txt -O "$LICENSE_FILE"
-fi
-
-# Run repository specific update actions.
-if [ -f update_repo.sh ];
-then
- ./update_repo.sh
-fi
-
-wget https://raw.github.com/gist/3749747/README_GALAXYP.md -O README_GALAXYP.md
-
-# Create repository README
-if [ ! -e README_REPO.md ];
-then
- echo "TODO: Document this tool repository." > README_REPO.md
-fi
-cat README_REPO.md README_GALAXYP.md > README.md
-
-
-# If version file exists, update all tools to this version
-VERSION_FILE=version
-if [ -e "$VERSION_FILE" ];
-then
- VERSION=`cat $VERSION_FILE`
-
- # Replace tool version in each tool XML file `
- find -iname "*xml" -exec sed -i'' -e '0,/version="\(.\+\)"/s/version="\(.\+\)"/version="'$VERSION'"/1g' {} \;
-
-fi