# HG changeset patch
# User guerler
# Date 1616535481 0
# Node ID 0dd6880ff95025f2874324b02a6336df79ca971b

"planemo upload commit 2ce78baac81e5fc7df43ca3ec81a3c51fdb98003"

diff -r 000000000000 -r 0dd6880ff950 hhsearch.xml
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/hhsearch.xml	Tue Mar 23 21:38:01 2021 +0000
@@ -0,0 +1,138 @@
+<tool id="hhsearch" name="HHsearch" version="@TOOL_VERSION@+galaxy@VERSION_SUFFIX@" profile="20.01">
+    <description>detecting remote homologues of proteins</description>
+    <macros>
+        <token name="@TOOL_VERSION@">3.2.0</token>
+        <token name="@VERSION_SUFFIX@">0</token>
+        <xml name="ffindex_single_inputs">
+            <param name="ffdata" type="data" format="ffdata" label="PDB Database" help="Database Data file." />
+            <param name="ffindex" type="data" format="ffindex" label="PDB Database Index" help="Database Index file." />
+        </xml>
+    </macros>
+    <requirements>
+        <requirement type="package" version="@TOOL_VERSION@">hhsuite</requirement>
+    </requirements>
+    <command detect_errors="exit_code"><![CDATA[
+        #if $db_source.db_source_selector == 'indexed':
+            ln -s '${db_source.ffindex.fields.path}.ffdata' hhdb_hhm.ffdata &&
+            ln -s '${db_source.ffindex.fields.path}.ffindex' hhdb_hhm.ffindex &&
+        #else
+            ln -s '$db_source.ffdata' hhdb_hhm.ffdata &&
+            ln -s '$db_source.ffindex' hhdb_hhm.ffindex &&
+        #end if
+
+        #if $db_source_cs219.db_source_selector == 'indexed':
+            ln -s '${db_source_cs219.ffindex.fields.path}.ffdata' hhdb_cs219.ffdata &&
+            ln -s '${db_source_cs219.ffindex.fields.path}.ffindex' hhdb_cs219.ffindex &&
+        #else
+            ln -s '$db_source_cs219.ffdata' hhdb_cs219.ffdata &&
+            ln -s '$db_source_cs219.ffindex' hhdb_cs219.ffindex &&
+        #end if
+
+        $method
+        -cpu \${GALAXY_SLOTS:-1}
+        -e '$e'
+        -i '$i'
+        -d hhdb
+        -o '$output'
+    ]]>    </command>
+    <inputs>
+        <param argument="--i" type="data" format="fasta,hmm3" label="Query Sequence" help="Single sequence or multiple sequence alignment (MSA)
+                in FASTA format, or HMM in hhm3 format." />
+        <param name="method" type="select" display="radio" label="Search Method" help="Select a search method. See help below for more information.">
+            <option value="hhsearch" selected="true">HHsearch</option>
+            <option value="hhblits">HHblits</option>
+        </param>
+        <conditional name="db_source">
+            <param name="db_source_selector" type="select" label="Custom or built-in HHM index" help="Built-ins have been indexed using ffindex">
+                <option value="indexed" selected="true">Use a built-in index</option>
+                <option value="history">Use a HHM index from history</option>
+            </param>
+            <when value="indexed">
+                <param name="ffindex" type="select" label="Select ffindex" help="">
+                    <options from_data_table="ffindex_indices">
+                        <filter type="sort_by" column="0" />
+                        <filter type="static_value" column="3" value="hhm" />
+                        <validator type="no_options" message="No indices are available" />
+                    </options>
+                </param>
+            </when>
+            <when value="history">
+                <expand macro="ffindex_single_inputs" />
+            </when>
+        </conditional>
+
+        <conditional name="db_source_cs219">
+            <param name="db_source_selector" type="select" label="Custom or built-in cs219 index" help="Built-ins have been indexed using ffindex">
+                <option value="indexed" selected="true">Use a built-in index</option>
+                <option value="history">Use a cs219 index from history</option>
+            </param>
+            <when value="indexed">
+                <param name="ffindex" type="select" label="Select ffindex" help="">
+                    <options from_data_table="ffindex_indices">
+                        <filter type="sort_by" column="0" />
+                        <filter type="static_value" column="3" value="cs219" />
+                        <validator type="no_options" message="No indices are available" />
+                    </options>
+                </param>
+            </when>
+            <when value="history">
+                <expand macro="ffindex_single_inputs" />
+            </when>
+        </conditional>
+        <param name="e" type="float" value="0.001" min="0" max="1" label="E-value cutoff for inclusion in result alignment. (-e)" />
+    </inputs>
+    <outputs>
+        <data format="hhr" name="output" />
+    </outputs>
+    <tests>
+        <test>
+            <param name="method" value="hhblits" />
+            <param name="i" value="6VYB_A.fasta" />
+            <conditional name="db_source">
+                <param name="db_source_selector" value="history" />
+                <param name="ffindex" value="dbCAN-fam-V8/dbCAN-fam-V8_hhm.ffindex" />
+                <param name="ffdata" value="dbCAN-fam-V8/dbCAN-fam-V8_hhm.ffdata" />
+            </conditional>
+            <conditional name="db_source_cs219">
+                <param name="db_source_selector" value="history" />
+                <param name="ffindex" value="dbCAN-fam-V8/dbCAN-fam-V8_cs219.ffindex" />
+                <param name="ffdata" value="dbCAN-fam-V8/dbCAN-fam-V8_cs219.ffdata" />
+            </conditional>
+            <output name="output" file="6VYB_A.hhr" lines_diff="4" ftype="hhr" />
+        </test>
+        <test>
+            <param name="method" value="hhblits" />
+            <param name="i" value="6VYB_A.fasta" />
+            <conditional name="db_source">
+                <param name="db_source_selector" value="indexed" />
+                <param name="ffindex" value="hmm_dbcan" />
+            </conditional>
+            <conditional name="db_source_cs219">
+                <param name="db_source_selector" value="indexed" />
+                <param name="ffindex" value="cs219_dbcan" />
+            </conditional>
+            <output name="output" file="6VYB_A.hhr" lines_diff="4" ftype="hhr" />
+        </test>
+    </tests>
+    <help><![CDATA[
+
+**What it does**
+
+HHsearch aligns a profile HMM against a database of target profile HMMs. The search first aligns the
+query HMM with each of the target HMMs using the Viterbi dynamic programming algorithm, which finds the
+alignment with the maximum score. The E-value for the target HMM is calculated from the Viterbi score. 
+Target HMMs that reach sufficient significance to be reported are realigned using the Maximum Accuracy algorithm (MAC).
+This algorithm maximizes the expected number of correctly aligned pairs of residues minus a penalty between 0 and 1.
+Values near 0 produce greedy, long, nearly global alignments, values above 0.3 result in shorter, local alignments.
+
+HHblits is an accelerated version of HHsearch that is fast enough to perform iterative searches through millions of profile HMMs,
+e.g. through the Uniclust profile HMM databases, generated by clustering the UniProt database into clusters of globally alignable sequences. 
+Analogously to PSI-BLAST and HMMER3, such iterative searches can be used to build MSAs by starting from a single query sequence.
+Sequences from matches to profile HMMs below some E-value threshold (e.g. 10−3) are added to the query MSA for the next search iteration.
+
+Download databases from: http://wwwuser.gwdg.de/~compbiol/data/hhsuite/databases/hhsuite_dbs/
+    ]]>    </help>
+    <citations>
+        <citation type="doi">10.1093/bioinformatics/bti125</citation>
+    </citations>
+</tool>
\ No newline at end of file
diff -r 000000000000 -r 0dd6880ff950 test-data/6VYB_A.fasta
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/6VYB_A.fasta	Tue Mar 23 21:38:01 2021 +0000
@@ -0,0 +1,20 @@
+>6VYB_A
+AYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHPVLPFNDG
+VYFASTEKSNIIRGWIFGTTLDSKSLLIVNNATNVVIKVCEFQFCNDPFLG
+VCTFEYVSFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVD
+LPIGINITRFQTLLAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSET
+KCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASV
+YAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFV
+IRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDNYNYLYRLFR
+KSNLKPFERDISTFPLQSYGFQPTNVGYQPYRVVVLSFELLHAPATVCGPK
+KSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDP
+QTLEILDITPCSFGGVSVITPGTNTSNEVAVLYQDVNCTEVNVFQTRAGCL
+IGAEHVNNSYECDIPIGAGICASYQTQSIIAYTMSLGAENSVAYSNNSIAI
+PTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNR
+ALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKSKRSF
+IEDLLFNKVTFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQ
+IPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALG
+KLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLI
+TGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYH
+LMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNG
+THWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDS
\ No newline at end of file
diff -r 000000000000 -r 0dd6880ff950 test-data/6VYB_A.hhr
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/6VYB_A.hhr	Tue Mar 23 21:38:01 2021 +0000
@@ -0,0 +1,156 @@
+Query         6VYB_A
+Match_columns 966
+No_of_seqs    1 out of 1
+Neff          1
+Searched_HMMs 100
+Date          Sun Jul 26 21:21:46 2020
+Command       hhblits -i test-data/query.fasta -o query.hhr -d test-data/dbCAN-fam-V8/dbCAN-fam-V8 
+
+ No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
+  1 ABN54336.1|CE12|183-378|9.5e-5  17.2     1.1  0.0014   32.1   0.0   13  586-598     1-13  (210)
+  2 ANU56961.1|PL12_2.hmm|1.8e-61|   3.4     9.9   0.013   24.9   0.0   32  900-931    38-69  (131)
+  3 CAX58257.1|CE11|4-276|4.9e-122   2.1      18   0.023   25.0   0.0   38  857-894     6-54  (277)
+  4 APK54672.1|GT103                 2.1      18   0.023   24.9   0.0  168  629-825     1-184 (232)
+  5 AAD04130.1|GT13|24-440|6.3e-18   1.7      23    0.03   25.6   0.0   47  302-349   156-203 (390)
+  6 ACR10769.1|PL1|79-276|1.4e-54    1.3      33   0.041   21.6   0.0   53   59-111    59-115 (196)
+  7 AAR43340.1|GT19|17-374|6.8e-14   1.3      33   0.041   23.4   0.0   14  254-267   116-129 (357)
+  8 BAD47100.1|GH125|74-473|3.2e-1   1.3      32   0.041   24.6   0.0   41   98-138   291-338 (402)
+  9 ACY95489.1|CBM14|33-88|9.4e-16   1.1      38   0.047   18.2   0.0   36  238-277    39-74  (81)
+ 10 AAK92730.1|PL1_1.hmm|3.6e-111|   0.9      49   0.063   21.4   0.0   50  277-326    18-67  (199)
+
+No 1
+>ABN54336.1|CE12|183-378|9.5e-54
+Probab=17.23  E-value=1.1  Score=32.05  Aligned_cols=13  Identities=38%  Similarity=0.705  Sum_probs=11.0  Template_Neff=5.400
+
+Q 6VYB_A          586 TMYICGDSTECSN  598 (966)
+Q Consensus       586 tmyicgdstecsn  598 (966)
+                      |+|||||||-|..
+T Consensus         1 tI~l~GDSTva~~   13 (210)
+T ABN54336.1|CE1    1 TIFLAGDSTVANY   13 (210)
+Confidence            6899999998853
+
+
+No 2
+>ANU56961.1|PL12_2.hmm|1.8e-61|404-534
+Probab=3.41  E-value=9.9  Score=24.92  Aligned_cols=32  Identities=25%  Similarity=0.544  Sum_probs=26.7  Template_Neff=2.600
+
+Q 6VYB_A          900 ICHDGKAHFPREGVFVSNGTHWFVTQRNFYEP  931 (966)
+Q Consensus       900 ichdgkahfpregvfvsngthwfvtqrnfyep  931 (966)
+                      .-++|+-.||..|.||-.|..--..+|+.|..
+T Consensus        38 Lw~~GRnf~PDaG~yvY~Gd~~~~~~R~wfR~   69 (131)
+T ANU56961.1|PL1   38 LWVKGRNFFPDAGSYVYAGDSEINKLRNWFRQ   69 (131)
+Confidence            56899999999999999998866777777753
+
+
+No 3
+>CAX58257.1|CE11|4-276|4.9e-122
+Probab=2.10  E-value=18  Score=25.00  Aligned_cols=38  Identities=32%  Similarity=0.532  Sum_probs=26.5  Template_Neff=4.700
+
+Q 6VYB_A          857 KRVDFCGKGYHL------MSFPQSAPHGVVFLHVT-----YVPAQEKNF  894 (966)
+Q Consensus       857 krvdfcgkgyhl------msfpqsaphgvvflhvt-----yvpaqeknf  894 (966)
+                      +.|.+.|.|.|-      --.|..+.+|++|..+-     .+||.-.+.
+T Consensus         6 ~~v~~~GiGLHsG~~v~l~l~PA~~~tGIvF~R~dl~~~~~IpA~~~~V   54 (277)
+T CAX58257.1|CE1    6 RSVSLTGVGLHSGKKVTLTLRPAPANTGIVFRRTDLDGPPEIPADADNV   54 (277)
+Confidence            456778888773      44688888999998875     555554443
+
+
+No 4
+>APK54672.1|GT103
+Probab=2.06  E-value=18  Score=24.88  Aligned_cols=168  Identities=24%  Similarity=0.353  Sum_probs=95.1  Template_Neff=2.800
+
+Q 6VYB_A          629 FAQVKQIYKTPPIKDFGGFNFSQILPDPSKSKRSFIEDLLFNKVTFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFG  708 (966)
+Q Consensus       629 faqvkqiyktppikdfggfnfsqilpdpskskrsfiedllfnkvtfngltvlpplltdemiaqytsallagtitsgwtfg  708 (966)
+                      |.|-|.|+.-+.+.+-..--+.--||..-..++.|-.+.-.+---|.||--                      ..||.  
+T Consensus         1 ~~~~~~~~s~~~~~~~d~~~i~LsLPET~~RR~~f~~~~~~G~q~FdGlR~----------------------~~GWI--   56 (232)
+T APK54672.1|GT1    1 FSQYKSIFSQCEISPQDVDFICLSLPETIERRRDFEQDNPYGIQLFDGLRH----------------------RPGWI--   56 (232)
+Confidence            456667776666666555445555777666666666555544444555432                      34663  
+
+
+Q 6VYB_A          709 AGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTAS------AL-------GKLQDVVNQNA  775 (966)
+Q Consensus       709 agaalqipfamqmayrfngigvtqnvlyenqklianqfnsaigkiqdslsstas------al-------gklqdvvnqna  775 (966)
+                       |+++..-+..+-|-   --+..+-.+-|..-+....|.+.+..+++-|...-+      .|       -|+..|-....
+T Consensus        57 -GCglSyk~l~r~al---~~~~~~lti~EDDV~fp~df~~~~~~v~~yL~~~~~~WDvFsGliAdlH~dtkIl~ve~~~g  132 (232)
+T APK54672.1|GT1   57 -GCGLSYKFLARKAL---ENGIPQLTICEDDVLFPPDFESKYSQVKDYLDTRRNDWDVFSGLIADLHPDTKILKVERFDG  132 (232)
+Confidence             33333333222222   234455567788888888888888888887753221      11       23444444444
+
+
+Q 6VYB_A          776 QALNTLVKQLSSNFGAISSVLNDILSRLDPPEAE---VQIDRLITGRLQSLQT  825 (966)
+Q Consensus       776 qalntlvkqlssnfgaissvlndilsrldppeae---vqidrlitgrlqslqt  825 (966)
+                      ...-++=|-.|--|..-+.-.-++|+..||....   ..|||.+.. .+.|..
+T Consensus       133 ~~yv~iDkMtSmV~NIYs~~al~~L~~Wd~~~~d~~TNTIDRylE~-~~~LrV  184 (232)
+T APK54672.1|GT1  133 IEYVTIDKMTSMVFNIYSESALEKLAQWDEKNHDAETNTIDRYLEN-QEGLRV  184 (232)
+Confidence            4555555555555555555555788888876544   468998753 334433
+
+
+No 5
+>AAD04130.1|GT13|24-440|6.3e-183
+Probab=1.69  E-value=23  Score=25.58  Aligned_cols=47  Identities=28%  Similarity=0.384  Sum_probs=24.8  Template_Neff=3.500
+
+Q 6VYB_A          302 ADSFVIRGDEVRQIAPGQTGKIADYNYKLP-DDFTGCVIAWNSNNLDNY  349 (966)
+Q Consensus       302 adsfvirgdevrqiapgqtgkiadynyklp-ddftgcviawnsnnldny  349 (966)
+                      +++++|-.|. -.|||.--.-...--+-|. |+---||-|||.|.....
+T Consensus       156 ~~~VII~EdD-m~iapDFf~yf~~~~~lL~~D~sl~cvSaWNDNG~~~~  203 (390)
+T AAD04130.1|GT1  156 FSRVIIVEDD-LEIAPDFFSYFSATYPLLDRDPSLWCVSAWNDNGKEQF  203 (390)
+Confidence            3344444433 3566653322222222233 444579999999987654
+
+
+No 6
+>ACR10769.1|PL1|79-276|1.4e-54
+Probab=1.28  E-value=33  Score=21.64  Aligned_cols=53  Identities=25%  Similarity=0.395  Sum_probs=33.8  Template_Neff=5.700
+
+Q 6VYB_A           59 KSN-IIRGWIFGTTLD--SKSLLIVNNATNVVIKVCEFQFCNDPFLGVCTF-EYVSF  111 (966)
+Q Consensus        59 ksn-iirgwifgttld--sksllivnnatnvvikvcefqfcndpflgvctf-eyvsf  111 (966)
+                      .+| |||-.-|-...+  ...-+-++++.+|.|--|+|.-..|-.+.+..- .||.+
+T Consensus        59 ~~NVIIRnl~~~~~~~~~~~Dai~i~~s~nVWIDHcsfs~~~Dg~ldv~~~s~~VTi  115 (196)
+T ACR10769.1|PL1   59 ASNVIIRNLRIRDGNDGFDGDAISIDGSSNVWIDHCSFSWGGDGLIDIKKGSDNVTI  115 (196)
+Confidence            344 566666655553  223333578899999999999998887755432 34443
+
+
+No 7
+>AAR43340.1|GT19|17-374|6.8e-144
+Probab=1.27  E-value=33  Score=23.45  Aligned_cols=14  Identities=36%  Similarity=0.700  Sum_probs=11.3  Template_Neff=5.700
+
+Q 6VYB_A          254 SVYAWNRKRISNCV  267 (966)
+Q Consensus       254 svyawnrkrisncv  267 (966)
+                      +|+||..+|+..-.
+T Consensus       116 qvWAWr~~R~k~i~  129 (357)
+T AAR43340.1|GT1  116 QVWAWRPGRIKKIK  129 (357)
+Confidence            79999999987643
+
+
+No 8
+>BAD47100.1|GH125|74-473|3.2e-189
+Probab=1.27  E-value=32  Score=24.58  Aligned_cols=41  Identities=32%  Similarity=0.588  Sum_probs=32.3  Template_Neff=3.500
+
+Q 6VYB_A           98 DPFLGVCTFEYVSFKNLREFVFKNIDGYF-------KIYSKHTPINLV  138 (966)
+Q Consensus        98 dpflgvctfeyvsfknlrefvfknidgyf-------kiyskhtpinlv  138 (966)
+                      -|+||-|.-+---+.|-|+|+...-.-||       -|=|.|++.+-+
+T Consensus       291 lPylG~~~~~DpiYqnTR~~iLS~~NPYy~~G~~~~GIGsPHtg~~~i  338 (402)
+T BAD47100.1|GH1  291 LPYLGYCSKDDPIYQNTRRFILSKENPYFYEGKAAEGIGSPHTGPRYI  338 (402)
+Confidence            48899999888889999999988766665       266778876655
+
+
+No 9
+>ACY95489.1|CBM14|33-88|9.4e-16
+Probab=1.13  E-value=38  Score=18.15  Aligned_cols=36  Identities=31%  Similarity=0.470  Sum_probs=23.4  Template_Neff=6.300
+
+Q 6VYB_A          238 TNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSA  277 (966)
+Q Consensus       238 tnlcpfgevfnatrfasvyawnrkrisncvadysvlynsa  277 (966)
+                      ...||.|.+|+...-.=++.++-+   .|--| |+-|||.
+T Consensus        39 ~~~Cp~g~~FD~~~~~C~~~~~v~---~C~~~-~~~~~~~   74 (81)
+T ACY95489.1|CBM   39 EFSCPPGLVFDPETQTCDWPENVD---DCSNC-SIRYNSG   74 (81)
+Confidence            458999999998876666644431   24433 5666664
+
+
+No 10
+>AAK92730.1|PL1_1.hmm|3.6e-111|138-336
+Probab=0.87  E-value=49  Score=21.39  Aligned_cols=50  Identities=28%  Similarity=0.484  Sum_probs=43.2  Template_Neff=2.500
+
+Q 6VYB_A          277 ASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADY  326 (966)
+Q Consensus       277 asfstfkcygvsptklndlcftnvyadsfvirgdevrqiapgqtgkiady  326 (966)
+                      .|+.|..--|++-.--+.-|+|--|+....|.|=.+..+.|+..|-|.|-
+T Consensus        18 ~S~KTIDGRGa~V~I~~g~citiq~v~nVIIHgi~IH~c~p~~~g~ir~s   67 (199)
+T AAK92730.1|PL1   18 NSFKTIDGRGANVHIANGACITIQYVSNVIIHGIHIHDCKPGGNGMVRDS   67 (199)
+Confidence            46777777888888888899999999999999999999999998888764
+
+
diff -r 000000000000 -r 0dd6880ff950 test-data/dbCAN-fam-V8/dbCAN-fam-V8_cs219.ffdata
Binary file test-data/dbCAN-fam-V8/dbCAN-fam-V8_cs219.ffdata has changed
diff -r 000000000000 -r 0dd6880ff950 test-data/dbCAN-fam-V8/dbCAN-fam-V8_cs219.ffindex
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/dbCAN-fam-V8/dbCAN-fam-V8_cs219.ffindex	Tue Mar 23 21:38:01 2021 +0000
@@ -0,0 +1,641 @@
+AA1	130000	614
+AA10	98449	182
+AA11	89861	198
+AA12	161477	401
+AA13	205723	233
+AA14	84523	269
+AA15	202053	196
+AA16	2537	168
+AA1_1	72683	316
+AA1_2	163839	340
+AA1_3	13117	316
+AA2	50468	260
+AA3	175231	645
+AA3_1	132900	776
+AA3_2	109017	591
+AA3_3	152711	592
+AA3_4	117354	551
+AA4	29900	535
+AA5	101197	751
+AA5_1	127310	826
+AA5_2	56821	607
+AA6	51847	197
+AA7	83849	457
+AA8	137667	816
+AA9	65399	217
+CBM1	143663	30
+CBM10	587	29
+CBM11	31337	166
+CBM12	7963	35
+CBM13	202249	200
+CBM14	6549	82
+CBM15	187832	146
+CBM16	181198	132
+CBM17	173997	204
+CBM18	77912	41
+CBM19	126554	45
+CBM2	53796	105
+CBM20	139439	91
+CBM21	7998	107
+CBM22	179903	157
+CBM23	134513	161
+CBM24	106005	77
+CBM25	60676	79
+CBM26	70634	78
+CBM27	163083	167
+CBM28	77953	209
+CBM29	154838	145
+CBM3	142429	87
+CBM30	62778	92
+CBM31	116063	93
+CBM32	616	120
+CBM34	16724	117
+CBM35	0	117
+CBM36	81639	125
+CBM37	156062	63
+CBM38	49755	133
+CBM39	78942	95
+CBM4	24839	132
+CBM40	71507	177
+CBM41	128335	107
+CBM42	17609	137
+CBM43	116609	85
+CBM44	82069	65
+CBM45	35210	83
+CBM46	59324	90
+CBM47	8105	129
+CBM48	125686	98
+CBM49	193665	79
+CBM5	177402	44
+CBM50	178810	47
+CBM51	64368	135
+CBM52	189940	52
+CBM53	76078	89
+CBM54	168537	117
+CBM55	182270	47
+CBM56	80372	182
+CBM57	156125	143
+CBM58	176573	117
+CBM59	50728	146
+CBM6	169738	133
+CBM60	165499	111
+CBM61	1500	143
+CBM62	103830	132
+CBM63	203091	79
+CBM64	39709	84
+CBM65	20745	120
+CBM66	139530	158
+CBM67	62100	183
+CBM68	186041	95
+CBM69	52322	130
+CBM70	123217	165
+CBM71	147133	204
+CBM72	5128	130
+CBM73	100024	51
+CBM74	187978	309
+CBM75	49888	283
+CBM76	154983	160
+CBM77	148424	104
+CBM78	145774	133
+CBM79	126599	111
+CBM8	9993	144
+CBM80	69465	89
+CBM81	59414	98
+CBM82	106082	130
+CBM83	164179	110
+CBM84	78162	138
+CBM85	26881	167
+CBM9	13433	193
+CE1	116156	210
+CE10	172669	335
+CE11	52044	278
+CE12	97509	211
+CE13	36921	354
+CE14	106403	125
+CE15	62870	346
+CE16	79037	267
+CE2	97071	210
+CE3	92750	196
+CE4	4980	148
+CE5	57610	190
+CE6	161252	98
+CE7	183858	317
+CE8	171685	291
+CE9	77362	372
+GH1	107679	399
+GH10	81764	305
+GH100	40271	453
+GH101	143693	708
+GH102	110459	155
+GH103	120684	294
+GH104	177446	145
+GH105	194761	330
+GH106	112942	795
+GH107	111119	330
+GH108	143579	84
+GH109	161350	127
+GH11	195727	179
+GH110	205956	549
+GH111	85330	657
+GH112	188287	716
+GH113	25744	309
+GH114	106212	191
+GH115	58293	701
+GH116	59512	364
+GH117	48439	240
+GH118	170684	485
+GH119	168654	1084
+GH12	11026	153
+GH120	148528	101
+GH121	156268	1401
+GH122	190610	340
+GH123	142516	536
+GH124	117905	319
+GH125	128442	403
+GH126	8234	325
+GH127	124794	530
+GH128	151708	225
+GH129	190950	658
+GH13	177591	394
+GH130	48679	298
+GH131	86835	256
+GH132	2705	306
+GH133	193305	360
+GH134	123520	160
+GH135	63216	240
+GH136	72999	518
+GH137	203908	368
+GH138	60755	922
+GH139	94778	811
+GH13_1	28119	307
+GH13_10	180360	316
+GH13_11	93920	357
+GH13_12	138483	313
+GH13_13	82134	394
+GH13_14	116694	331
+GH13_15	106528	286
+GH13_16	139688	355
+GH13_17	31503	351
+GH13_18	165610	344
+GH13_19	24971	361
+GH13_2	69554	311
+GH13_20	121854	302
+GH13_21	43260	318
+GH13_22	76167	402
+GH13_23	32724	346
+GH13_24	182317	298
+GH13_25	176690	439
+GH13_26	193744	301
+GH13_27	35293	320
+GH13_28	88374	318
+GH13_29	39793	346
+GH13_3	68240	296
+GH13_30	148629	376
+GH13_31	42301	352
+GH13_32	17746	304
+GH13_33	6631	325
+GH13_34	44319	245
+GH13_35	14870	355
+GH13_36	92946	319
+GH13_37	3769	321
+GH13_38	178857	376
+GH13_39	103962	321
+GH13_4	147337	401
+GH13_40	10137	361
+GH13_41	28809	324
+GH13_42	123680	425
+GH13_5	102512	348
+GH13_6	47406	307
+GH13_7	128845	291
+GH13_8	52452	294
+GH13_9	70712	323
+GH14	95878	417
+GH140	186136	452
+GH141	197431	596
+GH142	164289	550
+GH143	100075	575
+GH144	118224	441
+GH145	11179	420
+GH146	110614	505
+GH147	160402	850
+GH148	158304	182
+GH149	22061	1154
+GH15	126710	341
+GH150	53901	943
+GH151	20865	133
+GH152	181330	217
+GH153	101948	360
+GH154	74901	350
+GH156	134674	553
+GH157	80554	657
+GH158	155143	139
+GH159	98631	292
+GH16	161878	228
+GH160	201456	98
+GH161	23603	1077
+GH162	131816	499
+GH163	71684	258
+GH164	136160	696
+GH165	114700	703
+GH17	117	270
+GH18	19637	322
+GH19	108078	220
+GH2	1643	713
+GH20	46197	333
+GH22	184175	123
+GH23	123382	138
+GH24	191608	140
+GH25	163250	175
+GH26	16841	307
+GH27	41459	371
+GH28	119028	346
+GH29	84792	336
+GH3	59876	241
+GH30	192233	419
+GH30_1	37275	419
+GH30_2	6956	421
+GH30_3	174201	426
+GH30_4	153303	488
+GH30_5	52746	459
+GH30_6	189992	456
+GH30_7	97720	446
+GH30_8	35613	389
+GH30_9	38410	448
+GH31	76569	415
+GH32	141568	283
+GH33	19959	337
+GH34	177985	467
+GH35	111700	302
+GH36	204276	681
+GH37	9235	489
+GH38	169871	278
+GH39	162659	424
+GH4	48977	180
+GH42	133676	372
+GH43	111449	251
+GH43_1	130614	311
+GH43_10	203170	272
+GH43_11	184298	293
+GH43_12	136856	415
+GH43_13	18050	306
+GH43_14	63456	292
+GH43_15	82528	277
+GH43_16	90059	313
+GH43_17	44564	271
+GH43_18	179233	271
+GH43_19	141851	242
+GH43_2	129136	307
+GH43_20	140043	281
+GH43_21	64503	232
+GH43_22	5258	245
+GH43_23	98923	275
+GH43_24	87091	254
+GH43_25	120978	219
+GH43_26	68536	295
+GH43_27	78300	324
+GH43_28	186588	264
+GH43_29	158486	280
+GH43_3	88692	300
+GH43_30	106814	270
+GH43_31	50874	280
+GH43_32	153791	316
+GH43_33	165954	321
+GH43_34	138796	285
+GH43_35	50171	297
+GH43_36	198911	267
+GH43_37	43578	244
+GH43_4	104283	315
+GH43_5	4090	288
+GH43_6	119374	295
+GH43_7	27048	272
+GH43_8	150204	283
+GH43_9	149005	293
+GH44	13626	519
+GH45	67130	197
+GH46	15225	220
+GH47	125784	448
+GH48	145907	621
+GH49	33070	562
+GH5	34512	274
+GH50	91682	649
+GH51	57800	493
+GH52	122156	419
+GH53	121197	342
+GH54	20998	316
+GH55	173004	714
+GH56	109608	334
+GH57	28426	383
+GH58	65616	450
+GH59	90372	628
+GH5_1	67327	312
+GH5_10	31854	308
+GH5_11	189003	315
+GH5_12	108298	542
+GH5_13	82805	276
+GH5_14	49157	278
+GH5_15	79304	301
+GH5_16	200339	338
+GH5_17	73517	294
+GH5_18	147738	283
+GH5_19	30435	275
+GH5_2	99198	246
+GH5_20	38858	347
+GH5_21	18356	301
+GH5_22	36002	288
+GH5_23	29133	281
+GH5_24	144401	316
+GH5_25	166275	264
+GH5_26	195906	280
+GH5_27	51154	332
+GH5_28	736	337
+GH5_29	151933	343
+GH5_30	199178	437
+GH5_31	167824	285
+GH5_32	7377	342
+GH5_33	175876	279
+GH5_34	113737	239
+GH5_35	53205	142
+GH5_36	182615	288
+GH5_37	12425	314
+GH5_38	79605	313
+GH5_39	63748	306
+GH5_4	26053	294
+GH5_40	44835	285
+GH5_41	37694	257
+GH5_42	164839	256
+GH5_43	130925	372
+GH5_44	201554	305
+GH5_45	180060	300
+GH5_46	140324	260
+GH5_47	96295	281
+GH5_48	154107	317
+GH5_49	186852	295
+GH5_5	102860	286
+GH5_50	202449	286
+GH5_51	155282	352
+GH5_52	69865	287
+GH5_53	132315	387
+GH5_54	204957	283
+GH5_55	15445	267
+GH5_56	142093	164
+GH5_7	181547	296
+GH5_8	194045	269
+GH5_9	151402	306
+GH6	95589	289
+GH62	62283	279
+GH63	185313	728
+GH64	71942	369
+GH65	119669	381
+GH66	129443	557
+GH67	104598	675
+GH68	88992	401
+GH7	179504	399
+GH70	27320	799
+GH71	21314	372
+GH72	124105	306
+GH73	105876	129
+GH74	171976	321
+GH75	97281	228
+GH76	178452	358
+GH77	191748	485
+GH78	43822	497
+GH79	150487	454
+GH8	18657	326
+GH80	107084	64
+GH81	115403	660
+GH82	84306	217
+GH83	5503	550
+GH84	171169	300
+GH85	194314	311
+GH86	196186	606
+GH87	149298	906
+GH88	4378	330
+GH89	64735	664
+GH9	25332	412
+GH90	54844	552
+GH91	137271	396
+GH92	187147	496
+GH93	135227	312
+GH94	66066	1064
+GH95	184591	722
+GH96	75251	615
+GH97	68831	634
+GH98	107148	327
+GH99	85987	328
+GT1	203442	466
+GT10	182903	358
+GT101	26347	226
+GT102	47713	366
+GT103	67810	233
+GT104	1073	382
+GT105	40724	76
+GT106	49435	320
+GT107	158766	843
+GT11	177129	273
+GT12	81211	136
+GT13	166539	391
+GT14	100650	249
+GT15	32162	280
+GT16	180676	351
+GT17	83081	285
+GT18	56100	721
+GT19	189318	358
+GT20	41830	471
+GT21	73811	234
+GT22	148021	403
+GT23	117025	329
+GT24	87345	250
+GT25	57428	182
+GT26	142257	172
+GT27	8559	301
+GT28	190448	162
+GT29	168109	248
+GT2_Cellulose_synt	15712	723
+GT2_Chitin_synth_1	36290	164
+GT2_Chitin_synth_2	10498	528
+GT2_Glyco_tranf_2_2	143052	277
+GT2_Glyco_tranf_2_3	53347	231
+GT2_Glyco_tranf_2_4	139081	97
+GT2_Glyco_tranf_2_5	70152	211
+GT2_Glyco_trans_2_3	30710	198
+GT2_Glycos_transf_2	200677	171
+GT3	195091	636
+GT30	77734	178
+GT31	139178	188
+GT32	7719	84
+GT33	176155	418
+GT34	152276	246
+GT35	93265	655
+GT37	37951	459
+GT38	174627	468
+GT39	109942	233
+GT4	40139	132
+GT40	140584	213
+GT41	112002	588
+GT42	81347	292
+GT43	61677	209
+GT44	11599	104
+GT45	64054	117
+GT46	45120	357
+GT47	96576	298
+GT48	14145	725
+GT49	146528	356
+GT5	134048	465
+GT50	113976	265
+GT51	67639	171
+GT52	159609	262
+GT53	144717	1057
+GT54	40800	290
+GT55	60117	381
+GT56	51486	361
+GT57	29414	486
+GT58	122575	366
+GT59	92331	419
+GT6	98166	283
+GT60	103146	321
+GT61	155634	240
+GT62	39205	268
+GT63	46530	341
+GT64	163425	252
+GT65	74045	341
+GT66	11703	722
+GT67	205240	338
+GT68	140797	382
+GT69	127051	237
+GT7	17148	251
+GT70	72311	372
+GT71	79918	265
+GT72	202735	356
+GT73	116366	243
+GT74	83366	283
+GT75	198027	354
+GT76	30908	429
+GT77	34786	228
+GT78	87595	135
+GT79	33632	880
+GT8	32442	282
+GT80	192652	380
+GT81	89393	283
+GT82	100899	298
+GT83	131297	519
+GT84	199615	216
+GT85	157669	431
+GT87	39473	236
+GT88	170149	535
+GT89	183261	597
+GT9	107475	204
+GT90	9724	269
+GT91	114241	459
+GT92	126232	322
+GT93	26573	308
+GT94	110175	284
+GT95	74386	295
+GT96	91000	305
+GT97	58994	330
+GT98	18983	654
+GT99	12739	378
+PL1	68043	197
+PL10	6053	287
+PL10_1	16435	289
+PL10_2	122941	276
+PL10_3	70363	271
+PL11	42653	607
+PL11_1	105273	603
+PL11_2	99444	580
+PL12	199831	141
+PL12_1	3011	136
+PL12_2	121539	132
+PL12_3	205578	145
+PL13	103467	363
+PL14	387	200
+PL14_1	125324	209
+PL14_2	20296	210
+PL14_3	201859	194
+PL14_4	53578	218
+PL14_5	154424	211
+PL15	55396	134
+PL15_1	172297	140
+PL15_2	76984	158
+PL16	173718	279
+PL17	124411	139
+PL17_1	175095	136
+PL17_2	163677	162
+PL18	187643	189
+PL1_1	83649	200
+PL1_10	108840	177
+PL1_11	71035	181
+PL1_12	2356	181
+PL1_13	155874	188
+PL1_2	89676	185
+PL1_3	17399	210
+PL1_4	152522	189
+PL1_5	6340	209
+PL1_6	62562	216
+PL1_7	165095	183
+PL1_8	96874	197
+PL1_9	121671	183
+PL2	159871	531
+PL20	181843	230
+PL21	141179	73
+PL21_1	139366	73
+PL22	60498	178
+PL22_1	181027	171
+PL22_2	20506	239
+PL23	3147	622
+PL24	36454	467
+PL25	150941	461
+PL26	166930	894
+PL27	196792	639
+PL28	71216	291
+PL29	118665	363
+PL2_1	198381	530
+PL2_2	46871	535
+PL3	85128	202
+PL30	45477	720
+PL31	80183	189
+PL32	135539	621
+PL33	154635	203
+PL33_1	7803	160
+PL33_2	24680	159
+PL34	158100	204
+PL35	64171	197
+PL36	61886	214
+PL36_1	132702	198
+PL36_2	35014	196
+PL37	87730	644
+PL3_1	168357	180
+PL3_2	182073	197
+PL3_3	75866	212
+PL3_4	128136	199
+PL3_5	102308	204
+PL4	55530	570
+PL4_1	94277	501
+PL4_2	200848	608
+PL4_3	120050	634
+PL4_4	162106	553
+PL4_5	86315	520
+PL5	141252	316
+PL5_1	78624	318
+PL6	41090	369
+PL6_1	91305	377
+PL6_2	48079	360
+PL6_3	8860	375
+PL7	172437	232
+PL7_1	74681	220
+PL7_2	165278	221
+PL7_3	171469	216
+PL7_4	77142	220
+PL7_5	193032	273
+PL8	189676	264
+PL8_1	4708	272
+PL8_2	146884	249
+PL8_3	143329	250
+PL8_4	124550	244
+PL9	199972	367
+PL9_1	23215	388
+PL9_2	21686	375
+PL9_3	112590	352
+PL9_4	125533	153
+SLH	1455	45
+cohesin	127288	22
+dockerin	194625	136
diff -r 000000000000 -r 0dd6880ff950 test-data/dbCAN-fam-V8/dbCAN-fam-V8_hhm.ffdata
Binary file test-data/dbCAN-fam-V8/dbCAN-fam-V8_hhm.ffdata has changed
diff -r 000000000000 -r 0dd6880ff950 test-data/dbCAN-fam-V8/dbCAN-fam-V8_hhm.ffindex
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/dbCAN-fam-V8/dbCAN-fam-V8_hhm.ffindex	Tue Mar 23 21:38:01 2021 +0000
@@ -0,0 +1,641 @@
+AA1	4899912	78853
+AA10	22364198	21228
+AA11	21760883	23972
+AA12	10127010	45991
+AA13	20516545	23633
+AA14	19150205	29478
+AA15	21972583	26896
+AA16	22692389	18431
+AA1_1	15112952	36685
+AA1_2	13331028	39956
+AA1_3	15074691	38261
+AA2	19526212	31159
+AA3	4131972	77066
+AA3_1	1966671	87859
+AA3_2	5534746	81506
+AA3_3	5471387	63359
+AA3_4	6188528	57631
+AA4	6673812	57641
+AA5	2054530	88778
+AA5_1	1499532	92324
+AA5_2	5116111	70166
+AA6	21904075	23148
+AA7	8447955	55076
+AA8	1591856	91833
+AA9	21017071	29388
+CBM1	24391847	4224
+CBM10	24396071	3984
+CBM11	22751985	18988
+CBM12	24386862	4985
+CBM13	21665784	27011
+CBM14	24233176	11523
+CBM15	23118308	14914
+CBM16	23636325	17248
+CBM17	21545499	22657
+CBM18	24380826	6036
+CBM19	24368810	5523
+CBM2	23967498	15068
+CBM20	24121820	13479
+CBM21	23953233	14265
+CBM22	22999327	21499
+CBM23	22869454	20500
+CBM24	24285071	9108
+CBM25	24264306	10430
+CBM26	24274736	10335
+CBM27	22731910	20075
+CBM28	21429187	22980
+CBM29	23168702	13382
+CBM3	24166463	12142
+CBM30	24112417	9403
+CBM31	24102924	9493
+CBM32	23808866	18522
+CBM34	23883759	16794
+CBM35	23866186	17573
+CBM36	23764961	14182
+CBM37	24330092	8276
+CBM38	23550726	15988
+CBM39	24090953	11971
+CBM4	23617311	19014
+CBM40	22554699	21017
+CBM41	23938205	15028
+CBM42	23373752	17442
+CBM43	24178605	11563
+CBM44	24317611	6225
+CBM45	24222718	10458
+CBM46	24135299	10939
+CBM47	23714498	17844
+CBM48	24051532	13880
+CBM49	24255048	9258
+CBM5	24374333	6493
+CBM50	24355770	7028
+CBM51	23467055	17834
+CBM52	24338368	5870
+CBM53	24155032	11431
+CBM54	23852940	13246
+CBM55	24350170	5600
+CBM56	22342846	21352
+CBM57	23217315	19419
+CBM58	23840505	12435
+CBM59	23101620	16688
+CBM6	23530995	19731
+CBM60	23913555	12822
+CBM61	23198196	19119
+CBM62	23602089	15222
+CBM63	24244699	10349
+CBM64	24213431	9287
+CBM65	23794728	14138
+CBM66	22977074	22253
+CBM67	22265672	26073
+CBM68	24078815	12138
+CBM69	23680758	14832
+CBM70	22770973	20057
+CBM71	21521992	23507
+CBM72	23666324	14434
+CBM73	24344238	5932
+CBM74	15589050	33193
+CBM75	18054658	25579
+CBM76	22927390	15378
+CBM77	23995686	11718
+CBM78	23516448	14547
+CBM79	23900553	13002
+CBM8	23182084	16112
+CBM80	24146238	8794
+CBM81	24041935	9597
+CBM82	23653573	12751
+CBM83	23926377	11828
+CBM84	23358170	15582
+CBM85	22710820	21090
+CBM9	22023070	27155
+CE1	21327849	31391
+CE10	13575504	47403
+CE11	18493789	37156
+CE12	21231270	28245
+CE13	12477654	42512
+CE14	23747505	17456
+CE15	12976262	43834
+CE16	19266147	30344
+CE2	21299941	27908
+CE3	21946227	26356
+CE4	23079671	21949
+CE5	22074701	25238
+CE6	24029537	12398
+CE7	14853220	41327
+CE8	17244642	40294
+CE9	11315293	49833
+GH1	10222179	59107
+GH10	16086916	43464
+GH100	8607671	52602
+GH101	3018581	78835
+GH102	23020826	20542
+GH103	16976975	40440
+GH104	23150367	18335
+GH105	13893254	45534
+GH106	1865071	101600
+GH107	13860996	32258
+GH108	24202138	11293
+GH109	23732342	15163
+GH11	22467323	23580
+GH110	6372976	65294
+GH111	3818805	69235
+GH112	2741306	78192
+GH113	15551554	37496
+GH114	22050225	24476
+GH115	3177471	91984
+GH116	11675547	46849
+GH117	20290163	27688
+GH118	7842856	45713
+GH119	275912	105920
+GH12	23058839	20832
+GH120	24007404	12091
+GH121	0	145952
+GH122	13292547	38481
+GH123	6503802	60411
+GH124	14680312	29531
+GH125	9939030	48205
+GH126	14131175	41554
+GH127	6838327	68838
+GH128	20766455	30460
+GH129	3688064	69947
+GH13	10323799	56324
+GH130	16596931	32723
+GH131	19645795	29908
+GH132	15981846	37214
+GH133	12012432	47872
+GH134	22909624	17766
+GH135	20258054	32109
+GH136	7147898	60535
+GH137	11503184	39644
+GH138	884209	99488
+GH139	1683689	90836
+GH13_1	15801175	37656
+GH13_10	15034430	40261
+GH13_11	12240218	46810
+GH13_12	15329875	35218
+GH13_13	10380123	49155
+GH13_14	13745273	42840
+GH13_15	17623415	31555
+GH13_16	12395098	43151
+GH13_17	12677624	40121
+GH13_18	13020096	42567
+GH13_19	11884204	42982
+GH13_2	15516055	35499
+GH13_20	16209527	39211
+GH13_21	14779104	39118
+GH13_22	9987235	44088
+GH13_23	12933731	42531
+GH13_24	16565762	31169
+GH13_25	8959721	49481
+GH13_26	16349901	39462
+GH13_27	14605345	34629
+GH13_28	14743159	35945
+GH13_29	12893836	39895
+GH13_3	16702351	35809
+GH13_30	11009221	46321
+GH13_31	12595687	43235
+GH13_32	16130380	37689
+GH13_33	14095951	35224
+GH13_34	20059717	26850
+GH13_35	12359845	35253
+GH13_36	14639974	40338
+GH13_37	14531437	34409
+GH13_38	10967010	42211
+GH13_39	14491311	40126
+GH13_4	10079450	47560
+GH13_40	11843678	40526
+GH13_41	14210008	37058
+GH13_42	9210624	43680
+GH13_5	12763798	43396
+GH13_6	15766084	35091
+GH13_7	17212299	32343
+GH13_8	16943621	33354
+GH13_9	14247066	39802
+GH14	9667733	50217
+GH140	8660273	54216
+GH141	5400748	70639
+GH142	6310933	62043
+GH143	5758752	61151
+GH144	8907551	52170
+GH145	9361225	50176
+GH146	7208433	67420
+GH147	1285009	98431
+GH148	22318092	24754
+GH149	145952	129960
+GH15	13243451	49096
+GH150	783158	101051
+GH151	23500078	16370
+GH152	20989122	27949
+GH153	11967967	44465
+GH154	12717745	46053
+GH156	6075064	61644
+GH157	3758011	60794
+GH158	23321282	17351
+GH159	17149020	33141
+GH16	20706101	34050
+GH160	24019495	10042
+GH161	381832	127878
+GH162	7331349	54284
+GH163	19557371	32320
+GH164	3269455	71438
+GH165	3097416	80055
+GH17	19046243	37447
+GH18	14327558	49391
+GH19	20894491	30636
+GH2	2909398	109183
+GH20	13664192	47325
+GH22	23779143	15585
+GH23	23338633	19537
+GH24	23284422	20405
+GH25	22575716	25386
+GH26	15722385	43699
+GH27	11365126	46146
+GH28	12844157	49679
+GH29	13529185	46319
+GH3	20193005	34349
+GH30	9507467	58508
+GH30_1	9565975	51730
+GH30_2	9312489	48736
+GH30_3	9155615	55009
+GH30_4	7655338	59255
+GH30_5	8392788	55167
+GH30_6	8503031	45541
+GH30_7	8858377	49174
+GH30_8	10474566	44407
+GH30_9	8816018	42359
+GH31	9765578	60003
+GH32	18012894	41764
+GH33	13480840	48345
+GH34	8047999	48229
+GH35	16168069	41458
+GH36	3340893	97188
+GH37	7590578	64760
+GH38	18455001	38788
+GH39	9254304	58185
+GH4	22443823	23500
+GH42	11265935	49358
+GH43	19771686	37755
+GH43_1	15481551	34504
+GH43_10	18881651	35291
+GH43_11	17050383	35020
+GH43_12	9717950	47628
+GH43_13	15950769	31077
+GH43_14	17117138	31882
+GH43_15	18557858	29224
+GH43_16	15292466	37409
+GH43_17	18978890	33376
+GH43_18	18945954	32936
+GH43_19	20163300	29705
+GH43_2	15687773	34612
+GH43_20	18179623	29685
+GH43_21	20570935	25158
+GH43_22	20027683	32034
+GH43_23	18680246	30847
+GH43_24	19675703	34251
+GH43_25	20925127	19937
+GH43_26	16837033	40393
+GH43_27	14172729	37279
+GH43_28	19432342	31515
+GH43_29	18305557	35034
+GH43_3	16455992	37553
+GH43_30	19012266	33977
+GH43_31	18273072	32485
+GH43_32	14997289	37141
+GH43_33	14456320	34991
+GH43_34	17747441	38277
+GH43_35	16629654	33439
+GH43_36	19238007	28140
+GH43_37	20107715	27475
+GH43_4	15184740	39619
+GH43_5	17455625	36056
+GH43_6	16804369	32664
+GH43_7	18853165	28486
+GH43_8	17982480	30414
+GH43_9	17017415	32968
+GH44	7087569	60329
+GH45	21879662	24413
+GH46	20868296	26195
+GH47	8755470	60548
+GH48	4771540	70910
+GH49	5890318	58683
+GH5	18711093	41253
+GH50	4054954	77018
+GH51	7522665	67913
+GH52	9461847	45620
+GH53	13130596	44389
+GH54	14931063	35059
+GH55	2819498	89900
+GH56	13622907	41285
+GH57	10608286	52610
+GH58	8714489	40981
+GH59	4568953	72481
+GH5_1	15403452	38974
+GH5_10	15652666	35107
+GH5_11	15149637	35103
+GH5_12	6438270	65532
+GH5_13	18616345	32766
+GH5_14	18426387	28614
+GH5_15	16318898	31003
+GH5_16	13409806	35930
+GH5_17	16916274	27347
+GH5_18	17950326	32154
+GH5_19	18649111	31135
+GH5_2	19996434	31249
+GH5_20	12807194	36963
+GH5_21	16287054	31844
+GH5_22	17423400	32225
+GH5_23	18151533	28090
+GH5_24	14966122	31167
+GH5_25	19400652	31690
+GH5_26	18243809	29263
+GH5_27	13711517	33756
+GH5_28	13445736	35104
+GH5_29	13062663	34007
+GH5_30	9009202	43187
+GH5_31	17720441	27000
+GH5_32	13096670	33926
+GH5_33	18400446	25941
+GH5_34	20344074	25302
+GH5_35	23236734	14283
+GH5_36	17390619	32781
+GH5_37	15224359	34718
+GH5_38	15259077	33389
+GH5_39	15914673	36096
+GH5_4	16877426	38848
+GH5_40	17689738	30703
+GH5_41	19589691	27894
+GH5_42	19617585	28210
+GH5_43	11227453	38482
+GH5_44	16053855	33061
+GH5_45	16427329	28663
+GH5_46	19494873	31339
+GH5_47	18121689	29844
+GH5_48	14818222	34998
+GH5_49	16770788	33581
+GH5_5	17555058	36593
+GH5_50	17591651	31764
+GH5_51	12558566	37121
+GH5_52	17528048	27010
+GH5_53	10568579	39707
+GH5_54	17922402	27924
+GH5_55	19210828	27179
+GH5_56	22811327	14778
+GH5_7	16663093	39258
+GH5_8	19118075	32130
+GH5_9	15876013	38660
+GH6	17352841	37778
+GH62	18368278	32168
+GH63	2143308	91052
+GH64	11457840	45344
+GH65	10784632	50493
+GH66	5949001	65799
+GH67	3438081	80943
+GH68	10031323	48127
+GH7	10173001	49178
+GH70	1774525	90546
+GH71	11180658	46795
+GH72	15838831	37182
+GH73	23695590	18908
+GH74	14416625	39695
+GH75	20679482	26619
+GH76	12158210	49615
+GH77	7774745	68111
+GH78	7385633	70624
+GH79	8548572	59099
+GH8	14051431	44520
+GH80	24323836	6256
+GH81	3601511	86553
+GH82	20965729	23393
+GH83	6246159	64774
+GH84	16389363	37966
+GH85	15442426	39125
+GH86	5186277	73331
+GH87	983697	106982
+GH88	13818094	42902
+GH89	3519024	82487
+GH9	9825581	58416
+GH90	6136708	51820
+GH91	10281286	42513
+GH92	7456257	66408
+GH93	15365093	38359
+GH94	509710	145659
+GH95	2495876	99876
+GH96	4842450	57462
+GH97	4486992	81961
+GH98	14016766	34665
+GH99	13977770	38996
+GT1	8096228	72211
+GT10	12108747	49463
+GT101	20740151	26304
+GT102	11635708	39839
+GT103	20491630	24915
+GT104	10705003	37352
+GT105	24294179	8996
+GT106	14565846	39499
+GT107	1383440	116092
+GT11	18784599	39298
+GT12	23422325	14930
+GT13	10429278	45288
+GT14	19895596	35011
+GT15	18209308	34501
+GT16	12638922	38702
+GT17	17654970	34768
+GT18	2595752	77072
+GT19	12060304	48443
+GT20	7888569	64430
+GT21	20429652	30274
+GT22	9883997	55033
+GT23	13938788	38982
+GT24	19837137	28373
+GT25	22291745	26347
+GT26	22601102	23956
+GT27	16248738	38316
+GT28	22845740	23714
+GT29	19930607	34333
+GT2_Cellulose_synt	2321677	73509
+GT2_Chitin_synth_1	22791030	20297
+GT2_Chitin_synth_2	6907165	52810
+GT2_Glyco_tranf_2_2	18530945	26913
+GT2_Glyco_tranf_2_3	20596093	29194
+GT2_Glyco_tranf_2_4	24065412	13403
+GT2_Glyco_tranf_2_5	21205841	25429
+GT2_Glyco_trans_2_3	21732640	28243
+GT2_Glycos_transf_2	22667797	24592
+GT3	4350457	75068
+GT30	22512883	24951
+GT31	22179250	26598
+GT32	24190168	11970
+GT33	9617705	50028
+GT34	19964940	31494
+GT35	3888040	90060
+GT37	8340009	52779
+GT38	7952999	44365
+GT39	20459926	31704
+GT4	23581318	20771
+GT40	21143249	22975
+GT41	5616252	81261
+GT42	17085403	31735
+GT43	21403582	25605
+GT44	23982566	13120
+GT45	23827388	13117
+GT46	12207825	32393
+GT47	16524763	40999
+GT48	2234360	87317
+GT49	12317692	42153
+GT5	8168439	67893
+GT50	19332926	32259
+GT51	22644060	23737
+GT52	19463857	31016
+GT53	655369	127789
+GT54	17284936	31794
+GT55	10742355	42277
+GT56	11801304	42374
+GT57	7714593	60152
+GT58	11592957	42751
+GT59	9411401	50446
+GT6	17888984	33418
+GT60	14376949	39676
+GT61	20227354	30700
+GT62	19179683	31145
+GT63	13212617	30834
+GT64	19709954	30262
+GT65	13174985	37632
+GT66	2395186	100690
+GT67	13370984	38822
+GT68	10660896	44107
+GT69	20369376	28362
+GT7	19740216	31470
+GT70	11140895	39763
+GT71	19296491	36435
+GT72	12287028	30664
+GT73	20135190	28110
+GT74	17858011	30973
+GT75	12438249	39405
+GT76	9100038	55577
+GT77	20649668	29814
+GT78	23454678	12377
+GT79	1197474	87535
+GT8	18080237	41452
+GT80	10835125	40570
+GT81	17822289	35722
+GT82	16493545	31218
+GT83	7010085	77484
+GT84	21096867	25062
+GT85	9052389	47649
+GT87	20397738	31914
+GT88	6618219	55593
+GT89	5333360	67388
+GT9	21491858	30134
+GT90	19083690	34385
+GT91	8284884	55125
+GT92	14286868	40690
+GT93	15622243	30423
+GT94	17785718	36571
+GT95	16738160	32628
+GT96	16019060	34795
+GT97	13788113	29981
+GT98	3978100	76854
+GT99	10875695	42942
+PL1	21853525	26137
+PL10	17491681	36367
+PL10_1	17316730	36111
+PL10_2	18587082	29263
+PL10_3	18916942	29012
+PL11	5042312	73799
+PL11_1	5259608	73752
+PL11_2	5697513	61239
+PL12	23251017	18413
+PL12_1	23405911	16414
+PL12_2	23566714	14604
+PL12_3	23133222	17145
+PL13	11764724	36580
+PL14	21619103	24677
+PL14_1	21384043	19539
+PL14_2	21259515	20012
+PL14_3	21999479	23591
+PL14_4	20945064	20665
+PL14_5	21186624	19217
+PL15	23484889	15189
+PL15_1	23269430	14992
+PL15_2	22962553	14521
+PL16	18340591	27687
+PL17	23304827	16455
+PL17_1	23391194	14717
+PL17_2	22826105	19635
+PL18	22122520	18678
+PL1_1	21643780	22004
+PL1_10	22537834	16865
+PL1_11	22403877	19486
+PL1_12	22385426	18451
+PL1_13	22162176	17074
+PL1_2	22205848	23409
+PL1_3	21279527	20414
+PL1_4	22141198	20978
+PL1_5	21359240	24803
+PL1_6	21071580	25287
+PL1_7	22246456	19216
+PL1_8	21832147	21378
+PL1_9	22229257	17199
+PL2	6731453	56466
+PL20	20625287	24381
+PL21	24303175	7581
+PL21_1	24310756	6855
+PL22	22490903	21980
+PL22_1	22625058	19002
+PL22_2	20317851	26223
+PL23	4641434	74342
+PL24	7997364	50635
+PL25	8236332	48552
+PL26	1090679	106795
+PL27	4279868	70589
+PL28	17182161	30138
+PL29	11722396	42328
+PL2_1	6787919	50408
+PL2_2	6564213	54006
+PL3	21594049	25054
+PL30	2672824	68482
+PL31	22099939	22581
+PL32	4715776	55764
+PL33	21568156	25893
+PL33_1	22889954	19670
+PL33_2	22942768	19785
+PL34	21472104	19754
+PL35	21784855	24652
+PL36	21121929	21320
+PL36_1	21715403	17237
+PL36_2	21927223	19004
+PL37	4209038	70830
+PL3_1	22423363	20460
+PL3_2	21809507	22640
+PL3_3	21166224	20400
+PL3_4	21692795	22608
+PL3_5	21452167	19937
+PL4	5819903	70415
+PL4_1	7275853	55496
+PL4_2	4978765	63547
+PL4_3	4425525	61467
+PL4_4	6014800	60264
+PL4_5	6959975	50110
+PL5	14894547	36516
+PL5_1	14709843	33316
+PL6	11411272	46568
+PL6_1	10918637	48373
+PL6_2	11927186	40781
+PL6_3	11101377	39518
+PL7	20540178	30757
+PL7_1	20843621	24675
+PL7_2	20796915	22716
+PL7_3	21046459	25121
+PL7_4	20819631	23990
+PL7_5	18752346	32253
+PL8	19365185	35467
+PL8_1	18823897	29268
+PL8_2	19865510	30086
+PL8_3	19809441	27696
+PL8_4	20086567	21148
+PL9	11542828	50129
+PL9_1	10518973	49606
+PL9_2	11055542	45835
+PL9_3	12520166	38400
+PL9_4	23041368	17471
+SLH	24362798	6012
+cohesin	24400055	3247
+dockerin	23437255	17423
diff -r 000000000000 -r 0dd6880ff950 test-data/ffindex_indices.loc
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/ffindex_indices.loc	Tue Mar 23 21:38:01 2021 +0000
@@ -0,0 +1,4 @@
+##ffindex indices
+#unique_id	display name	path	type
+hmm_dbcan	HMM 2021-03-17-dbCAN	${__HERE__}/dbCAN-fam-V8/dbCAN-fam-V8_hhm	hhm
+cs219_dbcan	cs19 2021-03-17-dbCAN	${__HERE__}/dbCAN-fam-V8/dbCAN-fam-V8_cs219	cs219
\ No newline at end of file
diff -r 000000000000 -r 0dd6880ff950 tool-data/ffindex_indices.loc.sample
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/tool-data/ffindex_indices.loc.sample	Tue Mar 23 21:38:01 2021 +0000
@@ -0,0 +1,7 @@
+# ffindex collection, you can add multiple indices here and seperate them via the type (last column)
+# The path should point to a directory and the file-prefix ('pdb_prefix').
+# The folder needs to contain two files pdb_prefix.ffindex and pdb_prefix.ffdata
+#
+#identifer	description from the PDB set	/mnt/pdb_indices/pdb/pdb_prefix	pdb
+#identifer	description from the HHR set	/mnt/hhr/hhr_prefix	hhr
+
diff -r 000000000000 -r 0dd6880ff950 tool_data_table_conf.xml.sample
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/tool_data_table_conf.xml.sample	Tue Mar 23 21:38:01 2021 +0000
@@ -0,0 +1,6 @@
+<tables>
+    <table name="ffindex_indices" comment_char="#" allow_duplicate_entries="False">
+        <columns>value, name, path, type</columns>
+        <file path="tool-data/ffindex_indices.loc" />
+    </table>
+</tables>
diff -r 000000000000 -r 0dd6880ff950 tool_data_table_conf.xml.test
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/tool_data_table_conf.xml.test	Tue Mar 23 21:38:01 2021 +0000
@@ -0,0 +1,7 @@
+<tables>
+    <!-- Location of ffindex indexes for testing -->
+    <table name="ffindex_indices" comment_char="#" allow_duplicate_entries="False">
+        <columns>value, name, path, type</columns>
+        <file path="${__HERE__}/test-data/ffindex_indices.loc" />
+    </table>
+</tables>