# HG changeset patch
# User iracooke
# Date 1402912058 14400
# Node ID ffd1d25b8080e04f7e26cf7b65f5e1528095d900
# Parent 50eb60757ca59d4f6b01e541d18f06327d2f73d0
Uploaded
diff -r 50eb60757ca5 -r ffd1d25b8080 README
--- a/README Sun Jun 09 08:19:31 2013 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,5 +0,0 @@
-This package installs a wrapper script for the X!Tandem search engine
-
-Requirements:
-This package depends on the galaxy_protk and protk_trans_proteomic_pipeline packages
-Please see instructions for those packages before installing
diff -r 50eb60757ca5 -r ffd1d25b8080 README.md
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/README.md Mon Jun 16 05:47:38 2014 -0400
@@ -0,0 +1,6 @@
+## What is it?
+Galaxy tool definition file and wrapper scripts for the [X!Tandem search engine](http://www.thegpm.org/tandem/index.html).
+
+## This tool requires that the protk rubygem and X!Tandem itself are installed.
+
+
diff -r 50eb60757ca5 -r ffd1d25b8080 repository_dependencies.xml
--- a/repository_dependencies.xml Sun Jun 09 08:19:31 2013 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,5 +0,0 @@
-
-
-
-
-
diff -r 50eb60757ca5 -r ffd1d25b8080 tandem.xml
--- a/tandem.xml Sun Jun 09 08:19:31 2013 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,143 +0,0 @@
-
-
-
- galaxy_protk
- trans_proteomic_pipeline
-
-
- Run an X!Tandem Search
-
-
- #if $database.source_select=="built_in":
- rvm 1.9.3@protk-1.2.2 do tandem_search.rb -d $database.dbkey
- #else #rvm 1.9.3@protk-1.2.2 do tandem_search.rb -d $database.fasta_file
- #end if
-
- --var-mods='
- $variable_mods
- #for $custom_variable_mod in $custom_variable_mods:
- ,${custom_variable_mod.custom_mod}
- #end for
- '
-
- --fix-mods='
- $fixed_mods
- #for $custom_fix_mod in $custom_fix_mods:
- ,${custom_fix_mod.custom_mod}
- #end for
- '
-
- $input_file -o $output -r --enzyme=$enzyme --precursor-ion-tol-units=$precursor_tolu -v $missed_cleavages -f $fragment_ion_tol -p $precursor_ion_tol $allow_multi_isotope_search --keep-params-files
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-**What it does**
-
-Runs an MS/MS database search using the X!Tandem search engine. Output is in the form of a pepXML file containing identified peptides along with their raw search scores.
-
-----
-
-**References**
-
-Please see http://www.thegpm.org/GPM/references.html for details of references describing the X!Tandem search engine.
-
-
-
-
diff -r 50eb60757ca5 -r ffd1d25b8080 tandem_to_pepxml.xml
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/tandem_to_pepxml.xml Mon Jun 16 05:47:38 2014 -0400
@@ -0,0 +1,25 @@
+
+
+ protk
+ trans_proteomic_pipeline
+
+
+ Converts a tandem result file to pepXML
+
+
+ tandem_to_pepxml.rb $input_file -o $output
+
+
+
+
+
+
+
+
+
+
+
+ Convert X!Tandem results to pepXML
+
+
+
diff -r 50eb60757ca5 -r ffd1d25b8080 test-data/bsa.fasta
--- a/test-data/bsa.fasta Sun Jun 09 08:19:31 2013 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,26 +0,0 @@
->sp|ALBU_BOVIN|
-MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIA
-FSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCK
-VASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEF
-KADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGAC
-LLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKAE
-FVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKE
-CCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFL
-GSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKL
-KHLVDEPQNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVS
-RSLGKVGTRCCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTKCC
-TESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEKQIKKQT
-ALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVV
-STQTALA
->sp|AMYS_HUMAN|
-MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPK
-GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTR
-CNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWD
-FNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNH
-LIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVI
-DLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
-FMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGF
-TRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCE
-HRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWT
-FSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAED
-PFIAIHAESKL
\ No newline at end of file
diff -r 50eb60757ca5 -r ffd1d25b8080 test-data/bsa.mzML
--- a/test-data/bsa.mzML Sun Jun 09 08:19:31 2013 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,96 +0,0 @@
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
- RPrt68CEaUDI7236swRrQLecS3FVwmxAdcjNcANFbUBlwi/182NuQL/xtWeWAm9AGm7A54clb0BNSkG3FyJxQJOMnIU9QXFAFCLgEKpScUCe6pCb4fJyQNbiUwAME3RA529CIQJSdUDmllZDYmJ2QFch5SfVQXdAOiNKe4NRd0A2WaMeolJ4QGwE4nX9YXhAG7tE9VZyeUAaNPRPcNN6QDyInSl0JHtAEqCmli1Te0CuDRXj/JJ7QBsS91h6gnxAet/42jOzfEC94xQdyZJ9QEbT2clgMn5Ah78ma9RCf0CAYI4ev1J/QPCiryCNKoBAqiuf5XkxgEDtuyL4H3qAQDI4Sl7dgYBAEVMiiZ66gEBi+IiY0tGAQDMbZJKR2YBAjL6CNCMKgUA0ETY8vUGBQEymCkYlUoFAzzEge71hgUB8D5cc97WBQKYnLPHAuYFArDlAMEfigUBWSPlJ9fGBQP2H9NsX/oFApMLYQlApgkBmFMstLUKCQG2tLxLaWYJAMPDce3ixgkAYsrrVc7mCQHAlOzbCOYNAPrMkQI1Bg0Ang6PkFWqDQOrPfqRIgoNAdZMYBBaKg0BaL4ZyIrqDQGIQWDm0woNANUHUfcDJg0AMAiuHVgqEQCzUmubdUoRAL6NYbilqhEDXwFYJlpqEQGjon+CiooRA9Pi9TT/ShEBrZcIvNdqEQBqjdVR16oRAs5jYfBzyhEBx5ldzwFGFQIz4Tsx6eoVAhPBo4wiKhUCCHJQwE5KFQCUGgZUD0oVAy9b6IuHZhUBeukkMAmKGQM11Gmkp8oZA1xcJbTnDh0AWwf9WMsuHQJhRLLd0SohAldQJaGJTiEAUyy2thoKIQNuizAbZColAjZyFPa0SiUDLSpNSkGKJQCveyDzymolAS80eaMXqiUB47j1csvKJQONTAIzneopAejarPlfTikAMPPcerlOLQDdPdciNW4tA1EM0usPji0CY3ZOHBauMQD90QX3L845A/+xHigh8j0D7OnDOKPaRQAUXK2oQ+pFAbqMBvCU+kkA=
-
-
-
-
-
- AABIQgAAUEIAAMpCAABkQwAA8EEAACBCAEAHRQAAgEIAACRDAICRQwAAhEIAAE9EAADwQQAAjkIAAAhCAAAEQgAAMEIAAChDAACmQgAA4EEAAJBDAADGQgAA1EIAAHhCAAAEQwAAHEMAAKpCAAAcQgAAgUMAALRCAIDuQwAADEIAAJxCAMCERAAAOEIAADlDAAAAQgAA3kIAAPxCAICfQwAASUMAAAtDAADoQQAA00MAgMNDAADoQQAA+UMAAOBBAABUQgAAH0MAAExCAICFQwAA+EEAABxCAACMQgAAIEIAAKhCAIDVQwAAKEMAAFpEAAAIQgAABEIAAOBBAAAMQgAA4EEAAIpCAAA1QwAA+EIAAFBCAADoQQAAEEIAACRCAIC8QwAAFUQAAKRDAAAkQgAAgUMAAAhCAIDFQwAA9kIAAOhBAADEQgAAFEMAAAxCAADUQgAAO0MAAApDAADgQQAA8EEAAANDAEAmRAAACEIAAL5CAAASRAAAAEIAABFDAEBQRA==
-
-
-
-
-
-
-
-
- 2685
-
-
- 7058
- b76171188a63cfad075d3738a172b15f1f9e0c4c
-
diff -r 50eb60757ca5 -r ffd1d25b8080 test-data/bsa.pepXML
--- a/test-data/bsa.pepXML Sun Jun 09 08:19:31 2013 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,133 +0,0 @@
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
diff -r 50eb60757ca5 -r ffd1d25b8080 tool-data/pepxml_databases.loc.sample
--- a/tool-data/pepxml_databases.loc.sample Sun Jun 09 08:19:31 2013 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,13 +0,0 @@
-#This file lists the names of protein databases installed locally in protk.
-# These are used by omssa and x!tandem as well as the "mascot to pepxml" tool
-# In order to combine search results with Interprophet searches must be run against an identical database
-#
-# Entries should follow the be structured as follows
-# Display_name omssa_tandem_dbname dbkey
-#
-#
-Swissprot spall_ spall spall_
-Combined PlasmboDB (falciparum) and Swissprot Human plasmodb_pfalciparum_sphuman_ plasmodb_pfalciparum_sphuman plasmodb_pfalciparum_sphuman_
-Swissprot Human sphuman_ sphuman sphuman_
-Combined Swissprot/TRembl Human sptrhuman_ sptrhuman sptrhuman_
-Swissprot Mouse spmouse_ spmouse spmouse_
diff -r 50eb60757ca5 -r ffd1d25b8080 tool-data/tandem_mods.loc.sample
--- a/tool-data/tandem_mods.loc.sample Sun Jun 09 08:19:31 2013 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,6 +0,0 @@
-#This file lists the names of inbuilt chemical modifications accepted by X!Tandem
-#
-#
-Carbamidomethyl C carbamidomethyl_c_ 57.021464@C carbamidomethyl_c_
-Glycocapture-N glycocapture_n_ 0.998@N!{P}[ST] glycocapture_n_
-Oxidation M oxidation_m_ 15.994915@M oxidation_m_
\ No newline at end of file
diff -r 50eb60757ca5 -r ffd1d25b8080 tool_dependencies.xml
--- a/tool_dependencies.xml Sun Jun 09 08:19:31 2013 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,10 +0,0 @@
-
-
-
-
-
-
-
-
-
-