Mercurial > repos > iuc > compleasm
comparison compleasm.xml @ 5:7109a27a11db draft default tip
planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/compleasm/ commit 0db08b58079fe83ce390bac19bcb056ed44932d3
author | iuc |
---|---|
date | Mon, 20 Jan 2025 09:55:04 +0000 |
parents | 8f20a5b9b282 |
children |
comparison
equal
deleted
inserted
replaced
4:8f20a5b9b282 | 5:7109a27a11db |
---|---|
9 <requirements> | 9 <requirements> |
10 <requirement type="package" version="@TOOL_VERSION@">compleasm</requirement> | 10 <requirement type="package" version="@TOOL_VERSION@">compleasm</requirement> |
11 </requirements> | 11 </requirements> |
12 <version_command>compleasm --version</version_command> | 12 <version_command>compleasm --version</version_command> |
13 <command><![CDATA[ | 13 <command><![CDATA[ |
14 | 14 mkdir -p 'galaxy_db/' && |
15 mkdir -p galaxy_db && | 15 ln -s '${busco_database.fields.path}/lineages/${lineage_dataset}/' 'galaxy_db/${lineage_dataset}' && |
16 cp -r '${busco_database.fields.path}/lineages/${lineage_dataset}/' 'galaxy_db/' && | 16 ## Create a compleasm-specific empty file to avoid redownloading the lineage data (https://github.com/huangnengCSU/compleasm/blob/0.2.6/compleasm.py#L165) |
17 touch 'galaxy_db/${lineage_dataset}.done' && | |
17 | 18 |
18 compleasm run | 19 compleasm run |
19 -a '$input' | 20 -a '$input' |
20 -o galaxy_output | 21 -o galaxy_output |
21 --mode $mode | 22 --mode $mode |
22 -L 'galaxy_db' | 23 -L 'galaxy_db' |
23 -l '$lineage_dataset' | 24 -l '$lineage_dataset' |
24 -t "\${GALAXY_SLOTS:-1}" | 25 -t "\${GALAXY_SLOTS:-1}" |
25 | 26 |
26 #if str($specified_contigs) != '': | 27 #if str($specified_contigs) != '': |
27 --specified_contigs '$specified_contigs' | 28 --specified_contigs '$specified_contigs' |
28 #end if | 29 #end if |
29 | 30 |
41 <add value="_" /> | 42 <add value="_" /> |
42 </valid> | 43 </valid> |
43 </sanitizer> | 44 </sanitizer> |
44 <validator type="regex">[0-9a-zA-Z_ ]+</validator> | 45 <validator type="regex">[0-9a-zA-Z_ ]+</validator> |
45 </param> | 46 </param> |
46 | 47 |
47 <param name="outputs" type="select" multiple="true" label="Which outputs should be generated"> | 48 <param name="outputs" type="select" multiple="true" label="Which outputs should be generated"> |
48 <option value="full_table_busco" selected="true">full busco table</option> | 49 <option value="full_table_busco" selected="true">full busco table</option> |
49 <option value="full_table">full table</option> | 50 <option value="full_table">full table</option> |
50 <option value="miniprot">miniprot</option> | 51 <option value="miniprot">miniprot</option> |
51 <option value="translated_protein">translated proteins</option> | 52 <option value="translated_protein">translated proteins</option> |
70 <data name='miniprot' format='gff3' label="${tool.name} on ${on_string}: Miniprot" from_work_dir="galaxy_output/*_odb10/miniprot_output.gff"> | 71 <data name='miniprot' format='gff3' label="${tool.name} on ${on_string}: Miniprot" from_work_dir="galaxy_output/*_odb10/miniprot_output.gff"> |
71 <filter>outputs and 'miniprot' in outputs</filter> | 72 <filter>outputs and 'miniprot' in outputs</filter> |
72 </data> | 73 </data> |
73 <data name='translated_protein' format='fasta' label="${tool.name} on ${on_string}: Translated protein" from_work_dir="galaxy_output/*_odb10/translated_protein.fasta"> | 74 <data name='translated_protein' format='fasta' label="${tool.name} on ${on_string}: Translated protein" from_work_dir="galaxy_output/*_odb10/translated_protein.fasta"> |
74 <filter>outputs and 'translated_protein' in outputs</filter> | 75 <filter>outputs and 'translated_protein' in outputs</filter> |
75 </data> | 76 </data> |
76 </outputs> | 77 </outputs> |
77 | 78 |
78 <tests> | 79 <tests> |
79 <test expect_num_outputs="4"> | 80 <test expect_num_outputs="4"> |
80 <param name="input" value="small_genome.fasta"/> | 81 <param name="input" value="small_genome.fasta"/> |
81 <param name="mode" value="busco"/> | 82 <param name="mode" value="busco"/> |
82 <param name="outputs" value="full_table_busco,full_table,miniprot,translated_protein"/> | 83 <param name="outputs" value="full_table_busco,full_table,miniprot,translated_protein"/> |
83 <param name="busco_database" value="eukaryota_odb10"/> | 84 <param name="busco_database" value="entomoplasmatales_odb10"/> |
84 <param name="lineage_dataset" value="eukaryota_odb10"/> | 85 <param name="lineage_dataset" value="entomoplasmatales_odb10"/> |
85 <output name="full_table_busco"> | 86 <output name="full_table_busco"> |
86 <assert_contents> | 87 <assert_contents> |
87 <has_text text="Busco id"/> | 88 <has_text text="Busco id"/> |
88 <has_text text="Missing"/> | 89 <has_text text="496at186328	Missing"/> |
90 <has_text text="165at186328	Complete"/> | |
91 <has_text text="421at186328	Complete"/> | |
92 <has_text text="90at186328	Complete"/> | |
89 </assert_contents> | 93 </assert_contents> |
90 </output> | 94 </output> |
91 <output name="full_table"> | 95 <output name="full_table"> |
92 <assert_contents> | 96 <assert_contents> |
93 <has_text text="Gene"/> | 97 <has_text text="Gene	Status"/> |
94 <has_text text="Missing"/> | 98 <has_text text="496at186328	Missing"/> |
99 <has_text text="165at186328	Single"/> | |
100 <has_text text="421at186328	Single"/> | |
101 <has_text text="90at186328	Single"/> | |
95 </assert_contents> | 102 </assert_contents> |
96 </output> | 103 </output> |
97 <output name="miniprot"> | 104 <output name="miniprot"> |
98 <assert_contents> | 105 <assert_contents> |
99 <has_text text="##gff-version 3"/> | 106 <has_text text="##gff-version 3"/> |
100 </assert_contents> | 107 </assert_contents> |
101 </output> | 108 </output> |
102 <output name="translated_protein"> | 109 <output name="translated_protein"> |
103 <assert_contents> | 110 <assert_contents> |
104 <has_text text="GGWLIGNGGAGGSGAAGVNGGAGGNGGAGGNGGAGG"/> | 111 <has_text text="EKDFYQELGVSSDASPEEIKRAYRKLARDLHPDANPGNPAA"/> |
105 <has_text text="AAVFADRGAHVVLAVRNLEKGNAARARIMAARPGAHVTLQQLDLCSLDSVRAAADALRTAYPRIDVLINNAGVMW"/> | 112 <has_text text="AASITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVVD"/> |
106 </assert_contents> | 113 </assert_contents> |
107 </output> | 114 </output> |
115 <assert_stdout> | |
116 <has_text text="S:1.20%, 4"/> | |
117 </assert_stdout> | |
108 </test> | 118 </test> |
109 </tests> | 119 </tests> |
110 <help><![CDATA[ | 120 <help><![CDATA[ |
111 | 121 |
112 compleasm_ assesses genome completeness based on genome assembly. | 122 compleasm_ assesses genome completeness based on genome assembly. |
113 | 123 |
114 .. _compleasm: https://github.com/huangnengCSU/compleasm | 124 .. _compleasm: https://github.com/huangnengCSU/compleasm |
115 | 125 |
116 ]]> | 126 ]]> |
117 </help> | 127 </help> |
118 <expand macro="citation"/> | 128 <expand macro="citation"/> |
119 </tool> | 129 </tool> |