Mercurial > repos > iuc > hmmer3
comparison test-data/uniprot_globins_match.out @ 0:62479bdcc059 draft
planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4164b44c651bcbdac6637eccce61b2a802c9b569
author | iuc |
---|---|
date | Tue, 12 May 2015 15:04:26 -0400 |
parents | |
children |
comparison
equal
deleted
inserted
replaced
-1:000000000000 | 0:62479bdcc059 |
---|---|
1 # hmmsearch :: search profile(s) against a sequence database | |
2 # HMMER 3.1b1 (May 2013); http://hmmer.org/ | |
3 # Copyright (C) 2013 Howard Hughes Medical Institute. | |
4 # Freely distributed under the GNU General Public License (GPLv3). | |
5 # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - | |
6 # query HMM file: test-data/globins4.hmm | |
7 # target sequence database: test-data/uniprot_matches.fasta | |
8 # per-seq hits tabular output: test-data/globins.tblout | |
9 # per-dom hits tabular output: test-data/globins.domtblout | |
10 # pfam-style tabular hit output: test-data/globins.pfamtblout | |
11 # max ASCII text line length: unlimited | |
12 # sequence reporting threshold: E-value <= 10 | |
13 # domain reporting threshold: E-value <= 10 | |
14 # Vit filter P threshold: <= 0.001 | |
15 # Fwd filter P threshold: <= 1e-05 | |
16 # random number seed set to: 4 | |
17 # number of worker threads: 2 | |
18 # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - | |
19 | |
20 Query: globins4 [M=149] | |
21 Scores for complete sequences (score includes all domains): | |
22 --- full sequence --- --- best 1 domain --- -#dom- | |
23 E-value score bias E-value score bias exp N Sequence Description | |
24 ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- | |
25 1.8e-70 222.7 3.2 2e-70 222.6 3.2 1.0 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2 | |
26 9.2e-69 217.2 0.1 1e-68 217.0 0.1 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2 | |
27 | |
28 | |
29 Domain annotation for each sequence (and alignments): | |
30 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2 | |
31 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc | |
32 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- | |
33 1 ! 222.6 3.2 2e-70 2e-70 2 149 .] 2 148 .. 1 148 [. 0.99 | |
34 | |
35 Alignments for each domain: | |
36 == domain 1 score: 222.6 bits; conditional E-value: 2e-70 | |
37 globins4 2 vLseaektkvkavWakveadveesGadiLvrlfkstPatqefFekFkdLstedelkksadvkkHgkkvldAlsdalakldekleaklkdLselHakklkvdpkyfkllsevlvdvlaarlpkeftadvqaaleKllalvakllaskYk 149 | |
38 vLse+e++ v++vWakveadv+++G+diL+rlfks+P+t+e+F++Fk+L+te+e+k+s+d+kkHg++vl+Al+++l+k ++++ea+lk+L+++Ha+k+k+++ky++++se++++vl++r+p++f+ad+q+a++K+l+l++k++a+kYk | |
39 sp|P02185|MYG_PHYCD 2 VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKK-KGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYK 148 | |
40 8*****************************************************************************.99******************************************************************7 PP | |
41 | |
42 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2 | |
43 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc | |
44 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- | |
45 1 ! 217.0 0.1 1e-68 1e-68 1 149 [] 2 147 .] 2 147 .] 0.99 | |
46 | |
47 Alignments for each domain: | |
48 == domain 1 score: 217.0 bits; conditional E-value: 1e-68 | |
49 globins4 1 vvLseaektkvkavWakveadveesGadiLvrlfkstPatqefFekFkdLstedelkksadvkkHgkkvldAlsdalakldekleaklkdLselHakklkvdpkyfkllsevlvdvlaarlpkeftadvqaaleKllalvakllaskYk 149 | |
50 v+L+++ek++v+a+W+kv +v+e+G+++L rl++++P+tq+fFe+F+dLst+d+++++++vk+Hgkkvl+A+sd+la+ld +l++++++LselH++kl+vdp++fkll++vlv+vla++++keft++vqaa++K++a va++la+kY+ | |
51 sp|P02024|HBB_GORGO 2 VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLD-NLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147 | |
52 69****************..*************************************************************.******************************************************************7 PP | |
53 | |
54 | |
55 | |
56 Internal pipeline statistics summary: | |
57 ------------------------------------- | |
58 Query model(s): 1 (149 nodes) | |
59 Target sequences: 2 (301 residues searched) | |
60 Passed MSV filter: 2 (1); expected 0.0 (0.02) | |
61 Passed bias filter: 2 (1); expected 0.0 (0.02) | |
62 Passed Vit filter: 2 (1); expected 0.0 (0.001) | |
63 Passed Fwd filter: 2 (1); expected 0.0 (1e-05) | |
64 Initial search space (Z): 2 [actual number of targets] | |
65 Domain search space (domZ): 2 [number of targets reported over threshold] | |
66 # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 | |
67 # Mc/sec: inf | |
68 // | |
69 [ok] |