Mercurial > repos > iuc > hmmer_hmmconvert

comparison test-data/uniprot_globins_match.out @ 4:f92edeb5e4c4 draft

Find changesets by keywords (author, files, the commit message), revision number or hash, or revset expression.
planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
author iuc
date Mon, 11 Jun 2018 15:52:53 -0400
parents dca536c5cca5
children 8d5ec58d2172
comparison
equal deleted inserted replaced
3:b03487ad64c8 4:f92edeb5e4c4
1 # hmmsearch :: search profile(s) against a sequence database 1 # hmmsearch :: search profile(s) against a sequence database
2 # HMMER 3.1b2 (February 2015); http://hmmer.org/ 2 # HMMER 3.2 (June 2018); http://hmmer.org/
3 # Copyright (C) 2015 Howard Hughes Medical Institute. 3 # Copyright (C) 2018 Howard Hughes Medical Institute.
4 # Freely distributed under the GNU General Public License (GPLv3). 4 # Freely distributed under the BSD open source license.
5 # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 5 # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
6 # query HMM file: /tmp/tmpJW6ntL/files/000/dataset_1.dat 6 # query HMM file: /tmp/tmpp4O0Ju/files/000/dataset_25.dat
7 # target sequence database: /tmp/tmpJW6ntL/files/000/dataset_2.dat 7 # target sequence database: /tmp/tmpp4O0Ju/files/000/dataset_26.dat
8 # per-seq hits tabular output: /tmp/tmpJW6ntL/files/000/dataset_4.dat 8 # per-seq hits tabular output: /tmp/tmpp4O0Ju/files/000/dataset_28.dat
9 # per-dom hits tabular output: /tmp/tmpJW6ntL/files/000/dataset_5.dat 9 # per-dom hits tabular output: /tmp/tmpp4O0Ju/files/000/dataset_29.dat
10 # pfam-style tabular hit output: /tmp/tmpJW6ntL/files/000/dataset_6.dat 10 # pfam-style tabular hit output: /tmp/tmpp4O0Ju/files/000/dataset_30.dat
11 # max ASCII text line length: unlimited 11 # max ASCII text line length: unlimited
12 # Vit filter P threshold: <= 0.001 12 # Vit filter P threshold: <= 0.001
13 # Fwd filter P threshold: <= 1e-05 13 # Fwd filter P threshold: <= 1e-05
14 # random number seed set to: 4 14 # random number seed set to: 4
15 # number of worker threads: 1 15 # number of worker threads: 1
16 # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 16 # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
17 17
18 Query: globins4 [M=149] 18 Query: dataset_x [M=149]
19 Scores for complete sequences (score includes all domains): 19 Scores for complete sequences (score includes all domains):
20 --- full sequence --- --- best 1 domain --- -#dom- 20 --- full sequence --- --- best 1 domain --- -#dom-
21 E-value score bias E-value score bias exp N Sequence Description 21 E-value score bias E-value score bias exp N Sequence Description
22 ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 22 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
23 1.8e-70 222.7 3.2 2e-70 222.6 3.2 1.0 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2 23 1.8e-70 222.7 3.2 2e-70 222.6 3.2 1.0 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
30 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 30 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
31 1 ! 222.6 3.2 2e-70 2e-70 2 149 .] 2 148 .. 1 148 [. 0.99 31 1 ! 222.6 3.2 2e-70 2e-70 2 149 .] 2 148 .. 1 148 [. 0.99
32 32
33 Alignments for each domain: 33 Alignments for each domain:
34 == domain 1 score: 222.6 bits; conditional E-value: 2e-70 34 == domain 1 score: 222.6 bits; conditional E-value: 2e-70
35 globins4 2 vLseaektkvkavWakveadveesGadiLvrlfkstPatqefFekFkdLstedelkksadvkkHgkkvldAlsdalakldekleaklkdLselHakklkvdpkyfkllsevlvdvlaarlpkeftadvqaaleKllalvakllaskYk 149 35 dataset_x 2 vLseaektkvkavWakveadveesGadiLvrlfkstPatqefFekFkdLstedelkksadvkkHgkkvldAlsdalakldekleaklkdLselHakklkvdpkyfkllsevlvdvlaarlpkeftadvqaaleKllalvakllaskYk 149
36 vLse+e++ v++vWakveadv+++G+diL+rlfks+P+t+e+F++Fk+L+te+e+k+s+d+kkHg++vl+Al+++l+k ++++ea+lk+L+++Ha+k+k+++ky++++se++++vl++r+p++f+ad+q+a++K+l+l++k++a+kYk 36 vLse+e++ v++vWakveadv+++G+diL+rlfks+P+t+e+F++Fk+L+te+e+k+s+d+kkHg++vl+Al+++l+k ++++ea+lk+L+++Ha+k+k+++ky++++se++++vl++r+p++f+ad+q+a++K+l+l++k++a+kYk
37 sp|P02185|MYG_PHYCD 2 VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKK-KGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYK 148 37 sp|P02185|MYG_PHYCD 2 VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKK-KGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYK 148
38 8*****************************************************************************.99******************************************************************7 PP 38 8*****************************************************************************.99******************************************************************7 PP
39 39
40 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2 40 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
42 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 42 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
43 1 ! 217.0 0.1 1e-68 1e-68 1 149 [] 2 147 .] 2 147 .] 0.99 43 1 ! 217.0 0.1 1e-68 1e-68 1 149 [] 2 147 .] 2 147 .] 0.99
44 44
45 Alignments for each domain: 45 Alignments for each domain:
46 == domain 1 score: 217.0 bits; conditional E-value: 1e-68 46 == domain 1 score: 217.0 bits; conditional E-value: 1e-68
47 globins4 1 vvLseaektkvkavWakveadveesGadiLvrlfkstPatqefFekFkdLstedelkksadvkkHgkkvldAlsdalakldekleaklkdLselHakklkvdpkyfkllsevlvdvlaarlpkeftadvqaaleKllalvakllaskYk 149 47 dataset_x 1 vvLseaektkvkavWakveadveesGadiLvrlfkstPatqefFekFkdLstedelkksadvkkHgkkvldAlsdalakldekleaklkdLselHakklkvdpkyfkllsevlvdvlaarlpkeftadvqaaleKllalvakllaskYk 149
48 v+L+++ek++v+a+W+kv +v+e+G+++L rl++++P+tq+fFe+F+dLst+d+++++++vk+Hgkkvl+A+sd+la+ld +l++++++LselH++kl+vdp++fkll++vlv+vla++++keft++vqaa++K++a va++la+kY+ 48 v+L+++ek++v+a+W+kv +v+e+G+++L rl++++P+tq+fFe+F+dLst+d+++++++vk+Hgkkvl+A+sd+la+ld +l++++++LselH++kl+vdp++fkll++vlv+vla++++keft++vqaa++K++a va++la+kY+
49 sp|P02024|HBB_GORGO 2 VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLD-NLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147 49 sp|P02024|HBB_GORGO 2 VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLD-NLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
50 69****************..*************************************************************.******************************************************************7 PP 50 69****************..*************************************************************.******************************************************************7 PP
51 51
52 52
53 53
54 Internal pipeline statistics summary: 54 Internal pipeline statistics summary:
55 ------------------------------------- 55 -------------------------------------
56 Query model(s): 1 (149 nodes) 56 Query model(s): 1 (149 nodes)
57 Target sequences: 2 (301 residues searched) 57 Target sequences: 2 (301 residues searched)
58 Passed MSV filter: 2 (1); expected 0.0 (0.02) 58 Passed MSV filter: 2 (1); expected 0.0 (0.02)
59 Passed bias filter: 2 (1); expected 0.0 (0.02) 59 Passed bias filter: 2 (1); expected 0.0 (0.02)
60 Passed Vit filter: 2 (1); expected 0.0 (0.001) 60 Passed Vit filter: 2 (1); expected 0.0 (0.001)
61 Passed Fwd filter: 2 (1); expected 0.0 (1e-05) 61 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
62 Initial search space (Z): 2 [actual number of targets] 62 Initial search space (Z): 2 [actual number of targets]
63 Domain search space (domZ): 2 [number of targets reported over threshold] 63 Domain search space (domZ): 2 [number of targets reported over threshold]
64 # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 64 # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
65 # Mc/sec: inf 65 # Mc/sec: 20.02
66 // 66 //
67 [ok] 67 [ok]