Mercurial > repos > iuc > hmmer_hmmfetch
view test-data/uniprot_globins_match.out @ 5:fb459c8fb2ba draft
"planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
author | iuc |
---|---|
date | Tue, 16 Jun 2020 05:37:02 -0400 |
parents | 74089c182a50 |
children | a28fd001de59 |
line wrap: on
line source
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3 (Nov 2019); http://hmmer.org/ # Copyright (C) 2019 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: /tmp/tmpqydies2m/files/1/e/c/dataset_1eca2f81-02d4-4cd0-9081-3ea0f7eb36d7.dat # target sequence database: /tmp/tmpqydies2m/files/a/4/d/dataset_a4d3f992-2c56-4231-9590-fe0ab1f6413b.dat # max ASCII text line length: unlimited # Vit filter P threshold: <= 0.001 # Fwd filter P threshold: <= 1e-05 # random number seed set to: 4 # number of worker threads: 1 # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: dataset_a435d3bd-3e95-4c54-859f-736e9bc413b2 [M=149] Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-70 223.2 0.1 1.4e-70 223.0 0.1 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2 5.8e-70 221.1 3.3 6.4e-70 220.9 3.3 1.0 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2 Domain annotation for each sequence (and alignments): >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 223.0 0.1 1.4e-70 1.4e-70 1 149 [] 2 147 .] 2 147 .] 0.99 Alignments for each domain: == domain 1 score: 223.0 bits; conditional E-value: 1.4e-70 dataset_a435d3bd-3e95-4c54-859f-736e9bc413b2 1 vvLseaektkvkavWakveadveevGadiLvrlfvsyPetqefFekFkdLstedelkgsadvkkHgkkvldAlsdalakldekleaelkaLselHakklkvdpkyfkllsevlvvvlaarlpkeftadvqaaleKllalvakalaskYk 149 v+L+++ek++v+a+W+kv +v+evG+++L rl+v+yP+tq+fFe+F+dLst+d+++g+++vk+Hgkkvl+A+sd+la+ld +l++++++LselH++kl+vdp++fkll++vlv+vla++++keft++vqaa++K++a+va+ala+kY+ sp|P02024|HBB_GORGO 2 VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLD-NLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147 69****************..*************************************************************.******************************************************************7 PP >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 220.9 3.3 6.4e-70 6.4e-70 2 149 .] 2 148 .. 1 148 [. 0.99 Alignments for each domain: == domain 1 score: 220.9 bits; conditional E-value: 6.4e-70 dataset_a435d3bd-3e95-4c54-859f-736e9bc413b2 2 vLseaektkvkavWakveadveevGadiLvrlfvsyPetqefFekFkdLstedelkgsadvkkHgkkvldAlsdalakldekleaelkaLselHakklkvdpkyfkllsevlvvvlaarlpkeftadvqaaleKllalvakalaskYk 149 vLse+e++ v++vWakveadv+++G+diL+rlf+s+Pet+e+F++Fk+L+te+e+k+s+d+kkHg++vl+Al+++l+k ++++eaelk+L+++Ha+k+k+++ky++++se++++vl++r+p++f+ad+q+a++K+l+l++k++a+kYk sp|P02185|MYG_PHYCD 2 VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKK-KGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYK 148 8*****************************************************************************.99******************************************************************7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (149 nodes) Target sequences: 2 (301 residues searched) Passed MSV filter: 2 (1); expected 0.0 (0.02) Passed bias filter: 2 (1); expected 0.0 (0.02) Passed Vit filter: 2 (1); expected 0.0 (0.001) Passed Fwd filter: 2 (1); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 18.86 // [ok]