view test-data/uniprot_globins_match.out @ 5:5113c71c7031 draft

"planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
author iuc
date Tue, 16 Jun 2020 05:32:33 -0400
parents 793967b6ae8a
children 6e27bb3f0fa6
line wrap: on
line source

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3 (Nov 2019); http://hmmer.org/
# Copyright (C) 2019 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  /tmp/tmpqydies2m/files/1/e/c/dataset_1eca2f81-02d4-4cd0-9081-3ea0f7eb36d7.dat
# target sequence database:        /tmp/tmpqydies2m/files/a/4/d/dataset_a4d3f992-2c56-4231-9590-fe0ab1f6413b.dat
# max ASCII text line length:      unlimited
# Vit filter P threshold:       <= 0.001
# Fwd filter P threshold:       <= 1e-05
# random number seed set to:       4
# number of worker threads:        1
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       dataset_a435d3bd-3e95-4c54-859f-736e9bc413b2  [M=149]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    1.3e-70  223.2   0.1    1.4e-70  223.0   0.1    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    5.8e-70  221.1   3.3    6.4e-70  220.9   3.3    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  223.0   0.1   1.4e-70   1.4e-70       1     149 []       2     147 .]       2     147 .] 0.99

  Alignments for each domain:
  == domain 1  score: 223.0 bits;  conditional E-value: 1.4e-70
  dataset_a435d3bd-3e95-4c54-859f-736e9bc413b2   1 vvLseaektkvkavWakveadveevGadiLvrlfvsyPetqefFekFkdLstedelkgsadvkkHgkkvldAlsdalakldekleaelkaLselHakklkvdpkyfkllsevlvvvlaarlpkeftadvqaaleKllalvakalaskYk 149
                                                   v+L+++ek++v+a+W+kv  +v+evG+++L rl+v+yP+tq+fFe+F+dLst+d+++g+++vk+Hgkkvl+A+sd+la+ld +l++++++LselH++kl+vdp++fkll++vlv+vla++++keft++vqaa++K++a+va+ala+kY+
                           sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLD-NLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                                                   69****************..*************************************************************.******************************************************************7 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  220.9   3.3   6.4e-70   6.4e-70       2     149 .]       2     148 ..       1     148 [. 0.99

  Alignments for each domain:
  == domain 1  score: 220.9 bits;  conditional E-value: 6.4e-70
  dataset_a435d3bd-3e95-4c54-859f-736e9bc413b2   2 vLseaektkvkavWakveadveevGadiLvrlfvsyPetqefFekFkdLstedelkgsadvkkHgkkvldAlsdalakldekleaelkaLselHakklkvdpkyfkllsevlvvvlaarlpkeftadvqaaleKllalvakalaskYk 149
                                                   vLse+e++ v++vWakveadv+++G+diL+rlf+s+Pet+e+F++Fk+L+te+e+k+s+d+kkHg++vl+Al+++l+k ++++eaelk+L+++Ha+k+k+++ky++++se++++vl++r+p++f+ad+q+a++K+l+l++k++a+kYk
                           sp|P02185|MYG_PHYCD   2 VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKK-KGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYK 148
                                                   8*****************************************************************************.99******************************************************************7 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (149 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 18.86
//
[ok]