3
+ − 1 <?xml version="1.0"?>
+ − 2 <!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_BlastOutput.dtd">
+ − 3 <BlastOutput>
+ − 4 <BlastOutput_program>blastp</BlastOutput_program>
+ − 5 <BlastOutput_version>BLASTP 2.2.28+</BlastOutput_version>
+ − 6 <BlastOutput_reference>Stephen F. Altschul, Thomas L. Madden, Alejandro A. Sch&auml;ffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.</BlastOutput_reference>
+ − 7 <BlastOutput_db>/usr/local/syncdb/community/nr/nr</BlastOutput_db>
+ − 8 <BlastOutput_query-ID>Query_1</BlastOutput_query-ID>
+ − 9 <BlastOutput_query-def>Merlin_1</BlastOutput_query-def>
+ − 10 <BlastOutput_query-len>229</BlastOutput_query-len>
+ − 11 <BlastOutput_param>
+ − 12 <Parameters>
+ − 13 <Parameters_matrix>BLOSUM62</Parameters_matrix>
+ − 14 <Parameters_expect>0.001</Parameters_expect>
+ − 15 <Parameters_gap-open>11</Parameters_gap-open>
+ − 16 <Parameters_gap-extend>1</Parameters_gap-extend>
+ − 17 <Parameters_filter>F</Parameters_filter>
+ − 18 </Parameters>
+ − 19 </BlastOutput_param>
+ − 20 <BlastOutput_iterations>
+ − 21 <Iteration>
+ − 22 <Iteration_iter-num>1</Iteration_iter-num>
+ − 23 <Iteration_query-ID>Query_1</Iteration_query-ID>
+ − 24 <Iteration_query-def>Merlin_1</Iteration_query-def>
+ − 25 <Iteration_query-len>229</Iteration_query-len>
+ − 26 <Iteration_hits>
+ − 27 <Hit>
+ − 28 <Hit_num>1</Hit_num>
+ − 29 <Hit_id>gi|422934611|ref|YP_007004572.1|</Hit_id>
+ − 30 <Hit_def>hypothetical protein [Enterobacteria phage ime09] >gi|339791394|gb|AEK12451.1| hypothetical protein [Enterobacteria phage ime09]</Hit_def>
+ − 31 <Hit_accession>YP_007004572</Hit_accession>
+ − 32 <Hit_len>685</Hit_len>
+ − 33 <Hit_hsps>
+ − 34 <Hsp>
+ − 35 <Hsp_num>1</Hsp_num>
+ − 36 <Hsp_bit-score>197.593</Hsp_bit-score>
+ − 37 <Hsp_score>501</Hsp_score>
+ − 38 <Hsp_evalue>3.74548e-55</Hsp_evalue>
+ − 39 <Hsp_query-from>2</Hsp_query-from>
+ − 40 <Hsp_query-to>229</Hsp_query-to>
+ − 41 <Hsp_hit-from>474</Hsp_hit-from>
+ − 42 <Hsp_hit-to>684</Hsp_hit-to>
+ − 43 <Hsp_query-frame>0</Hsp_query-frame>
+ − 44 <Hsp_hit-frame>0</Hsp_hit-frame>
+ − 45 <Hsp_identity>106</Hsp_identity>
+ − 46 <Hsp_positive>154</Hsp_positive>
+ − 47 <Hsp_gaps>21</Hsp_gaps>
+ − 48 <Hsp_align-len>230</Hsp_align-len>
+ − 49 <Hsp_qseq>LDKGTLLYRGQKLDLPTFEHNAENKLFYFRNYVSTSLKPLIFGEFGRMFMALDDDTTIYTAETPDDYNRFANPEDIIDIGATQKDSFDDNNNDGTSINIGKQVNLGFVISGAENVRVIVPGSLTEYPEEAEVILPRGTLLKINKITTQVDKRS--NKFMVEGSIVPPSEQIDESVEIYDGDLFMETGEVVKLSGFMQFVNESAYDEEQNQMAAEILSGFLDIDDMPRKFR</Hsp_qseq>
+ − 50 <Hsp_hseq>LPPGTTLYRGQEVTFKTLRHNIENKMFYFKNFVSTSLKPNIFGEHGKNYMALDDSGAVFSGEGEGS----VDAEDLMHMGSHSAYANED-----------AETSVGMVIKGAERIKVIVPGHLSGFPSEAEVILPRGILLKINKVSTYMMKETAYNKYLIEGTIVPPSEQLEESV--YDGDHLMETGEVRPMAGFNQFLVEES--KEEENEVSQILASLVNINGMSKKFK</Hsp_hseq>
+ − 51 <Hsp_midline>L GT LYRGQ++ T HN ENK+FYF+N+VSTSLKP IFGE G+ +MALDD +++ E + ED++ +G+ + +D + ++G VI GAE ++VIVPG L+ +P EAEVILPRG LLKINK++T + K + NK+++EG+IVPPSEQ++ESV YDGD METGEV ++GF QF+ E + +E+ ++IL+ ++I+ M +KF+</Hsp_midline>
+ − 52 </Hsp>
+ − 53 </Hit_hsps>
+ − 54 </Hit>
+ − 55 <Hit>
+ − 56 <Hit_num>2</Hit_num>
+ − 57 <Hit_id>gi|330858714|ref|YP_004415089.1|</Hit_id>
+ − 58 <Hit_def>hypothetical protein Shfl2p198 [Shigella phage Shfl2] >gi|327397648|gb|AEA73150.1| hypothetical protein Shfl2p198 [Shigella phage Shfl2]</Hit_def>
+ − 59 <Hit_accession>YP_004415089</Hit_accession>
+ − 60 <Hit_len>685</Hit_len>
+ − 61 <Hit_hsps>
+ − 62 <Hsp>
+ − 63 <Hsp_num>1</Hsp_num>
+ − 64 <Hsp_bit-score>197.593</Hsp_bit-score>
+ − 65 <Hsp_score>501</Hsp_score>
+ − 66 <Hsp_evalue>4.31042e-55</Hsp_evalue>
+ − 67 <Hsp_query-from>2</Hsp_query-from>
+ − 68 <Hsp_query-to>229</Hsp_query-to>
+ − 69 <Hsp_hit-from>474</Hsp_hit-from>
+ − 70 <Hsp_hit-to>684</Hsp_hit-to>
+ − 71 <Hsp_query-frame>0</Hsp_query-frame>
+ − 72 <Hsp_hit-frame>0</Hsp_hit-frame>
+ − 73 <Hsp_identity>106</Hsp_identity>
+ − 74 <Hsp_positive>154</Hsp_positive>
+ − 75 <Hsp_gaps>21</Hsp_gaps>
+ − 76 <Hsp_align-len>230</Hsp_align-len>
+ − 77 <Hsp_qseq>LDKGTLLYRGQKLDLPTFEHNAENKLFYFRNYVSTSLKPLIFGEFGRMFMALDDDTTIYTAETPDDYNRFANPEDIIDIGATQKDSFDDNNNDGTSINIGKQVNLGFVISGAENVRVIVPGSLTEYPEEAEVILPRGTLLKINKITTQVDKRS--NKFMVEGSIVPPSEQIDESVEIYDGDLFMETGEVVKLSGFMQFVNESAYDEEQNQMAAEILSGFLDIDDMPRKFR</Hsp_qseq>
+ − 78 <Hsp_hseq>LPPGTTLYRGQEVTFKTLRHNIENKMFYFKNFVSTSLKPNIFGEHGKNYMALDDSGAVFSGEGEGS----VDAEDLMHMGSHSAYANED-----------AETSVGMVIKGAERIKVIVPGHLSGFPSEAEVILPRGILLKINKVSTYMMKETAYNKYLIEGTIVPPSEQLEESV--YDGDHLMETGEVRPMAGFNQFLVEES--KEEENEVSQILASLVNINGMSKKFK</Hsp_hseq>
+ − 79 <Hsp_midline>L GT LYRGQ++ T HN ENK+FYF+N+VSTSLKP IFGE G+ +MALDD +++ E + ED++ +G+ + +D + ++G VI GAE ++VIVPG L+ +P EAEVILPRG LLKINK++T + K + NK+++EG+IVPPSEQ++ESV YDGD METGEV ++GF QF+ E + +E+ ++IL+ ++I+ M +KF+</Hsp_midline>
+ − 80 </Hsp>
+ − 81 </Hit_hsps>
+ − 82 </Hit>
+ − 83 <Hit>
+ − 84 <Hit_num>3</Hit_num>
+ − 85 <Hit_id>gi|228861509|ref|YP_002854530.1|</Hit_id>
+ − 86 <Hit_def>alt.-2 hypothetical protein [Enterobacteria phage RB14] >gi|227438525|gb|ACP30838.1| alt.-2 hypothetical protein [Enterobacteria phage RB14]</Hit_def>
+ − 87 <Hit_accession>YP_002854530</Hit_accession>
+ − 88 <Hit_len>685</Hit_len>
+ − 89 <Hit_hsps>
+ − 90 <Hsp>
+ − 91 <Hsp_num>1</Hsp_num>
+ − 92 <Hsp_bit-score>197.593</Hsp_bit-score>
+ − 93 <Hsp_score>501</Hsp_score>
+ − 94 <Hsp_evalue>4.35388e-55</Hsp_evalue>
+ − 95 <Hsp_query-from>2</Hsp_query-from>
+ − 96 <Hsp_query-to>229</Hsp_query-to>
+ − 97 <Hsp_hit-from>474</Hsp_hit-from>
+ − 98 <Hsp_hit-to>684</Hsp_hit-to>
+ − 99 <Hsp_query-frame>0</Hsp_query-frame>
+ − 100 <Hsp_hit-frame>0</Hsp_hit-frame>
+ − 101 <Hsp_identity>108</Hsp_identity>
+ − 102 <Hsp_positive>152</Hsp_positive>
+ − 103 <Hsp_gaps>21</Hsp_gaps>
+ − 104 <Hsp_align-len>230</Hsp_align-len>
+ − 105 <Hsp_qseq>LDKGTLLYRGQKLDLPTFEHNAENKLFYFRNYVSTSLKPLIFGEFGRMFMALDDDTTIYTAETPDDYNRFANPEDIIDIGATQKDSFDDNNNDGTSINIGKQVNLGFVISGAENVRVIVPGSLTEYPEEAEVILPRGTLLKINKITTQVDKRS--NKFMVEGSIVPPSEQIDESVEIYDGDLFMETGEVVKLSGFMQFVNESAYDEEQNQMAAEILSGFLDIDDMPRKFR</Hsp_qseq>
+ − 106 <Hsp_hseq>LPPGTTLYRGQEVTFKTLRHNIENKMFYFKNFVSTSLKPNIFGEHGKNYMALDDSGAVFSGEGEGS----VDAEDLMHMGS-----------HSTYANEDAETSVGMVIKGAERVKVIVPGHLSGFPSEAEVILPRGILLKINKVSTYFMKETAYNKYLIEGTIVPPSEQLEESV--YDGDHLMETGEVRPMAGFNQFLVEES--KEEENEVSQILASLVNINGMSKKFK</Hsp_hseq>
+ − 107 <Hsp_midline>L GT LYRGQ++ T HN ENK+FYF+N+VSTSLKP IFGE G+ +MALDD +++ E + ED++ +G+ T N + ++G VI GAE V+VIVPG L+ +P EAEVILPRG LLKINK++T K + NK+++EG+IVPPSEQ++ESV YDGD METGEV ++GF QF+ E + +E+ ++IL+ ++I+ M +KF+</Hsp_midline>
+ − 108 </Hsp>
+ − 109 </Hit_hsps>
+ − 110 </Hit>
+ − 111 </Iteration_hits>
+ − 112 <Iteration_stat>
+ − 113 <Statistics>
+ − 114 <Statistics_db-num>48094830</Statistics_db-num>
+ − 115 <Statistics_db-len>17186091396</Statistics_db-len>
+ − 116 <Statistics_hsp-len>143</Statistics_hsp-len>
+ − 117 <Statistics_eff-space>886533640716</Statistics_eff-space>
+ − 118 <Statistics_kappa>0.041</Statistics_kappa>
+ − 119 <Statistics_lambda>0.267</Statistics_lambda>
+ − 120 <Statistics_entropy>0.14</Statistics_entropy>
+ − 121 </Statistics>
+ − 122 </Iteration_stat>
+ − 123 </Iteration>
+ − 124 </BlastOutput_iterations>
+ − 125 </BlastOutput>
+ − 126