Mercurial > repos > iuc > jbrowse
comparison test-data/blastxml/blast-gene1.xml @ 3:7342f467507b draft
Uploaded v0.4 of JBrowse
author | iuc |
---|---|
date | Thu, 31 Dec 2015 13:58:43 -0500 |
parents | |
children |
comparison
equal
deleted
inserted
replaced
2:b6a0e126dbee | 3:7342f467507b |
---|---|
1 <?xml version="1.0"?> | |
2 <!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_BlastOutput.dtd"> | |
3 <BlastOutput> | |
4 <BlastOutput_program>blastp</BlastOutput_program> | |
5 <BlastOutput_version>BLASTP 2.2.28+</BlastOutput_version> | |
6 <BlastOutput_reference>Stephen F. Altschul, Thomas L. Madden, Alejandro A. Sch&auml;ffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.</BlastOutput_reference> | |
7 <BlastOutput_db>/usr/local/syncdb/community/nr/nr</BlastOutput_db> | |
8 <BlastOutput_query-ID>Query_1</BlastOutput_query-ID> | |
9 <BlastOutput_query-def>Merlin_1</BlastOutput_query-def> | |
10 <BlastOutput_query-len>229</BlastOutput_query-len> | |
11 <BlastOutput_param> | |
12 <Parameters> | |
13 <Parameters_matrix>BLOSUM62</Parameters_matrix> | |
14 <Parameters_expect>0.001</Parameters_expect> | |
15 <Parameters_gap-open>11</Parameters_gap-open> | |
16 <Parameters_gap-extend>1</Parameters_gap-extend> | |
17 <Parameters_filter>F</Parameters_filter> | |
18 </Parameters> | |
19 </BlastOutput_param> | |
20 <BlastOutput_iterations> | |
21 <Iteration> | |
22 <Iteration_iter-num>1</Iteration_iter-num> | |
23 <Iteration_query-ID>Query_1</Iteration_query-ID> | |
24 <Iteration_query-def>Merlin_1</Iteration_query-def> | |
25 <Iteration_query-len>229</Iteration_query-len> | |
26 <Iteration_hits> | |
27 <Hit> | |
28 <Hit_num>1</Hit_num> | |
29 <Hit_id>gi|422934611|ref|YP_007004572.1|</Hit_id> | |
30 <Hit_def>hypothetical protein [Enterobacteria phage ime09] >gi|339791394|gb|AEK12451.1| hypothetical protein [Enterobacteria phage ime09]</Hit_def> | |
31 <Hit_accession>YP_007004572</Hit_accession> | |
32 <Hit_len>685</Hit_len> | |
33 <Hit_hsps> | |
34 <Hsp> | |
35 <Hsp_num>1</Hsp_num> | |
36 <Hsp_bit-score>197.593</Hsp_bit-score> | |
37 <Hsp_score>501</Hsp_score> | |
38 <Hsp_evalue>3.74548e-55</Hsp_evalue> | |
39 <Hsp_query-from>2</Hsp_query-from> | |
40 <Hsp_query-to>229</Hsp_query-to> | |
41 <Hsp_hit-from>474</Hsp_hit-from> | |
42 <Hsp_hit-to>684</Hsp_hit-to> | |
43 <Hsp_query-frame>0</Hsp_query-frame> | |
44 <Hsp_hit-frame>0</Hsp_hit-frame> | |
45 <Hsp_identity>106</Hsp_identity> | |
46 <Hsp_positive>154</Hsp_positive> | |
47 <Hsp_gaps>21</Hsp_gaps> | |
48 <Hsp_align-len>230</Hsp_align-len> | |
49 <Hsp_qseq>LDKGTLLYRGQKLDLPTFEHNAENKLFYFRNYVSTSLKPLIFGEFGRMFMALDDDTTIYTAETPDDYNRFANPEDIIDIGATQKDSFDDNNNDGTSINIGKQVNLGFVISGAENVRVIVPGSLTEYPEEAEVILPRGTLLKINKITTQVDKRS--NKFMVEGSIVPPSEQIDESVEIYDGDLFMETGEVVKLSGFMQFVNESAYDEEQNQMAAEILSGFLDIDDMPRKFR</Hsp_qseq> | |
50 <Hsp_hseq>LPPGTTLYRGQEVTFKTLRHNIENKMFYFKNFVSTSLKPNIFGEHGKNYMALDDSGAVFSGEGEGS----VDAEDLMHMGSHSAYANED-----------AETSVGMVIKGAERIKVIVPGHLSGFPSEAEVILPRGILLKINKVSTYMMKETAYNKYLIEGTIVPPSEQLEESV--YDGDHLMETGEVRPMAGFNQFLVEES--KEEENEVSQILASLVNINGMSKKFK</Hsp_hseq> | |
51 <Hsp_midline>L GT LYRGQ++ T HN ENK+FYF+N+VSTSLKP IFGE G+ +MALDD +++ E + ED++ +G+ + +D + ++G VI GAE ++VIVPG L+ +P EAEVILPRG LLKINK++T + K + NK+++EG+IVPPSEQ++ESV YDGD METGEV ++GF QF+ E + +E+ ++IL+ ++I+ M +KF+</Hsp_midline> | |
52 </Hsp> | |
53 </Hit_hsps> | |
54 </Hit> | |
55 <Hit> | |
56 <Hit_num>2</Hit_num> | |
57 <Hit_id>gi|330858714|ref|YP_004415089.1|</Hit_id> | |
58 <Hit_def>hypothetical protein Shfl2p198 [Shigella phage Shfl2] >gi|327397648|gb|AEA73150.1| hypothetical protein Shfl2p198 [Shigella phage Shfl2]</Hit_def> | |
59 <Hit_accession>YP_004415089</Hit_accession> | |
60 <Hit_len>685</Hit_len> | |
61 <Hit_hsps> | |
62 <Hsp> | |
63 <Hsp_num>1</Hsp_num> | |
64 <Hsp_bit-score>197.593</Hsp_bit-score> | |
65 <Hsp_score>501</Hsp_score> | |
66 <Hsp_evalue>4.31042e-55</Hsp_evalue> | |
67 <Hsp_query-from>2</Hsp_query-from> | |
68 <Hsp_query-to>229</Hsp_query-to> | |
69 <Hsp_hit-from>474</Hsp_hit-from> | |
70 <Hsp_hit-to>684</Hsp_hit-to> | |
71 <Hsp_query-frame>0</Hsp_query-frame> | |
72 <Hsp_hit-frame>0</Hsp_hit-frame> | |
73 <Hsp_identity>106</Hsp_identity> | |
74 <Hsp_positive>154</Hsp_positive> | |
75 <Hsp_gaps>21</Hsp_gaps> | |
76 <Hsp_align-len>230</Hsp_align-len> | |
77 <Hsp_qseq>LDKGTLLYRGQKLDLPTFEHNAENKLFYFRNYVSTSLKPLIFGEFGRMFMALDDDTTIYTAETPDDYNRFANPEDIIDIGATQKDSFDDNNNDGTSINIGKQVNLGFVISGAENVRVIVPGSLTEYPEEAEVILPRGTLLKINKITTQVDKRS--NKFMVEGSIVPPSEQIDESVEIYDGDLFMETGEVVKLSGFMQFVNESAYDEEQNQMAAEILSGFLDIDDMPRKFR</Hsp_qseq> | |
78 <Hsp_hseq>LPPGTTLYRGQEVTFKTLRHNIENKMFYFKNFVSTSLKPNIFGEHGKNYMALDDSGAVFSGEGEGS----VDAEDLMHMGSHSAYANED-----------AETSVGMVIKGAERIKVIVPGHLSGFPSEAEVILPRGILLKINKVSTYMMKETAYNKYLIEGTIVPPSEQLEESV--YDGDHLMETGEVRPMAGFNQFLVEES--KEEENEVSQILASLVNINGMSKKFK</Hsp_hseq> | |
79 <Hsp_midline>L GT LYRGQ++ T HN ENK+FYF+N+VSTSLKP IFGE G+ +MALDD +++ E + ED++ +G+ + +D + ++G VI GAE ++VIVPG L+ +P EAEVILPRG LLKINK++T + K + NK+++EG+IVPPSEQ++ESV YDGD METGEV ++GF QF+ E + +E+ ++IL+ ++I+ M +KF+</Hsp_midline> | |
80 </Hsp> | |
81 </Hit_hsps> | |
82 </Hit> | |
83 <Hit> | |
84 <Hit_num>3</Hit_num> | |
85 <Hit_id>gi|228861509|ref|YP_002854530.1|</Hit_id> | |
86 <Hit_def>alt.-2 hypothetical protein [Enterobacteria phage RB14] >gi|227438525|gb|ACP30838.1| alt.-2 hypothetical protein [Enterobacteria phage RB14]</Hit_def> | |
87 <Hit_accession>YP_002854530</Hit_accession> | |
88 <Hit_len>685</Hit_len> | |
89 <Hit_hsps> | |
90 <Hsp> | |
91 <Hsp_num>1</Hsp_num> | |
92 <Hsp_bit-score>197.593</Hsp_bit-score> | |
93 <Hsp_score>501</Hsp_score> | |
94 <Hsp_evalue>4.35388e-55</Hsp_evalue> | |
95 <Hsp_query-from>2</Hsp_query-from> | |
96 <Hsp_query-to>229</Hsp_query-to> | |
97 <Hsp_hit-from>474</Hsp_hit-from> | |
98 <Hsp_hit-to>684</Hsp_hit-to> | |
99 <Hsp_query-frame>0</Hsp_query-frame> | |
100 <Hsp_hit-frame>0</Hsp_hit-frame> | |
101 <Hsp_identity>108</Hsp_identity> | |
102 <Hsp_positive>152</Hsp_positive> | |
103 <Hsp_gaps>21</Hsp_gaps> | |
104 <Hsp_align-len>230</Hsp_align-len> | |
105 <Hsp_qseq>LDKGTLLYRGQKLDLPTFEHNAENKLFYFRNYVSTSLKPLIFGEFGRMFMALDDDTTIYTAETPDDYNRFANPEDIIDIGATQKDSFDDNNNDGTSINIGKQVNLGFVISGAENVRVIVPGSLTEYPEEAEVILPRGTLLKINKITTQVDKRS--NKFMVEGSIVPPSEQIDESVEIYDGDLFMETGEVVKLSGFMQFVNESAYDEEQNQMAAEILSGFLDIDDMPRKFR</Hsp_qseq> | |
106 <Hsp_hseq>LPPGTTLYRGQEVTFKTLRHNIENKMFYFKNFVSTSLKPNIFGEHGKNYMALDDSGAVFSGEGEGS----VDAEDLMHMGS-----------HSTYANEDAETSVGMVIKGAERVKVIVPGHLSGFPSEAEVILPRGILLKINKVSTYFMKETAYNKYLIEGTIVPPSEQLEESV--YDGDHLMETGEVRPMAGFNQFLVEES--KEEENEVSQILASLVNINGMSKKFK</Hsp_hseq> | |
107 <Hsp_midline>L GT LYRGQ++ T HN ENK+FYF+N+VSTSLKP IFGE G+ +MALDD +++ E + ED++ +G+ T N + ++G VI GAE V+VIVPG L+ +P EAEVILPRG LLKINK++T K + NK+++EG+IVPPSEQ++ESV YDGD METGEV ++GF QF+ E + +E+ ++IL+ ++I+ M +KF+</Hsp_midline> | |
108 </Hsp> | |
109 </Hit_hsps> | |
110 </Hit> | |
111 </Iteration_hits> | |
112 <Iteration_stat> | |
113 <Statistics> | |
114 <Statistics_db-num>48094830</Statistics_db-num> | |
115 <Statistics_db-len>17186091396</Statistics_db-len> | |
116 <Statistics_hsp-len>143</Statistics_hsp-len> | |
117 <Statistics_eff-space>886533640716</Statistics_eff-space> | |
118 <Statistics_kappa>0.041</Statistics_kappa> | |
119 <Statistics_lambda>0.267</Statistics_lambda> | |
120 <Statistics_entropy>0.14</Statistics_entropy> | |
121 </Statistics> | |
122 </Iteration_stat> | |
123 </Iteration> | |
124 </BlastOutput_iterations> | |
125 </BlastOutput> | |
126 |