view test-data/blastxml/blast-gene1.xml @ 16:b5c5470d7c09 draft

planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/jbrowse commit c306d242caf7e0447517c9749ca7656823f315e5
author iuc
date Wed, 13 Sep 2017 13:07:20 -0400
parents 7342f467507b
children
line wrap: on
line source

<?xml version="1.0"?>
<!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_BlastOutput.dtd">
<BlastOutput>
  <BlastOutput_program>blastp</BlastOutput_program>
  <BlastOutput_version>BLASTP 2.2.28+</BlastOutput_version>
  <BlastOutput_reference>Stephen F. Altschul, Thomas L. Madden, Alejandro A. Sch&amp;auml;ffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), &quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search programs&quot;, Nucleic Acids Res. 25:3389-3402.</BlastOutput_reference>
  <BlastOutput_db>/usr/local/syncdb/community/nr/nr</BlastOutput_db>
  <BlastOutput_query-ID>Query_1</BlastOutput_query-ID>
  <BlastOutput_query-def>Merlin_1</BlastOutput_query-def>
  <BlastOutput_query-len>229</BlastOutput_query-len>
  <BlastOutput_param>
    <Parameters>
      <Parameters_matrix>BLOSUM62</Parameters_matrix>
      <Parameters_expect>0.001</Parameters_expect>
      <Parameters_gap-open>11</Parameters_gap-open>
      <Parameters_gap-extend>1</Parameters_gap-extend>
      <Parameters_filter>F</Parameters_filter>
    </Parameters>
  </BlastOutput_param>
<BlastOutput_iterations>
<Iteration>
  <Iteration_iter-num>1</Iteration_iter-num>
  <Iteration_query-ID>Query_1</Iteration_query-ID>
  <Iteration_query-def>Merlin_1</Iteration_query-def>
  <Iteration_query-len>229</Iteration_query-len>
<Iteration_hits>
<Hit>
  <Hit_num>1</Hit_num>
  <Hit_id>gi|422934611|ref|YP_007004572.1|</Hit_id>
  <Hit_def>hypothetical protein [Enterobacteria phage ime09] &gt;gi|339791394|gb|AEK12451.1| hypothetical protein [Enterobacteria phage ime09]</Hit_def>
  <Hit_accession>YP_007004572</Hit_accession>
  <Hit_len>685</Hit_len>
  <Hit_hsps>
    <Hsp>
      <Hsp_num>1</Hsp_num>
      <Hsp_bit-score>197.593</Hsp_bit-score>
      <Hsp_score>501</Hsp_score>
      <Hsp_evalue>3.74548e-55</Hsp_evalue>
      <Hsp_query-from>2</Hsp_query-from>
      <Hsp_query-to>229</Hsp_query-to>
      <Hsp_hit-from>474</Hsp_hit-from>
      <Hsp_hit-to>684</Hsp_hit-to>
      <Hsp_query-frame>0</Hsp_query-frame>
      <Hsp_hit-frame>0</Hsp_hit-frame>
      <Hsp_identity>106</Hsp_identity>
      <Hsp_positive>154</Hsp_positive>
      <Hsp_gaps>21</Hsp_gaps>
      <Hsp_align-len>230</Hsp_align-len>
      <Hsp_qseq>LDKGTLLYRGQKLDLPTFEHNAENKLFYFRNYVSTSLKPLIFGEFGRMFMALDDDTTIYTAETPDDYNRFANPEDIIDIGATQKDSFDDNNNDGTSINIGKQVNLGFVISGAENVRVIVPGSLTEYPEEAEVILPRGTLLKINKITTQVDKRS--NKFMVEGSIVPPSEQIDESVEIYDGDLFMETGEVVKLSGFMQFVNESAYDEEQNQMAAEILSGFLDIDDMPRKFR</Hsp_qseq>
      <Hsp_hseq>LPPGTTLYRGQEVTFKTLRHNIENKMFYFKNFVSTSLKPNIFGEHGKNYMALDDSGAVFSGEGEGS----VDAEDLMHMGSHSAYANED-----------AETSVGMVIKGAERIKVIVPGHLSGFPSEAEVILPRGILLKINKVSTYMMKETAYNKYLIEGTIVPPSEQLEESV--YDGDHLMETGEVRPMAGFNQFLVEES--KEEENEVSQILASLVNINGMSKKFK</Hsp_hseq>
      <Hsp_midline>L  GT LYRGQ++   T  HN ENK+FYF+N+VSTSLKP IFGE G+ +MALDD   +++ E         + ED++ +G+    + +D            + ++G VI GAE ++VIVPG L+ +P EAEVILPRG LLKINK++T + K +  NK+++EG+IVPPSEQ++ESV  YDGD  METGEV  ++GF QF+ E +  +E+    ++IL+  ++I+ M +KF+</Hsp_midline>
    </Hsp>
  </Hit_hsps>
</Hit>
<Hit>
  <Hit_num>2</Hit_num>
  <Hit_id>gi|330858714|ref|YP_004415089.1|</Hit_id>
  <Hit_def>hypothetical protein Shfl2p198 [Shigella phage Shfl2] &gt;gi|327397648|gb|AEA73150.1| hypothetical protein Shfl2p198 [Shigella phage Shfl2]</Hit_def>
  <Hit_accession>YP_004415089</Hit_accession>
  <Hit_len>685</Hit_len>
  <Hit_hsps>
    <Hsp>
      <Hsp_num>1</Hsp_num>
      <Hsp_bit-score>197.593</Hsp_bit-score>
      <Hsp_score>501</Hsp_score>
      <Hsp_evalue>4.31042e-55</Hsp_evalue>
      <Hsp_query-from>2</Hsp_query-from>
      <Hsp_query-to>229</Hsp_query-to>
      <Hsp_hit-from>474</Hsp_hit-from>
      <Hsp_hit-to>684</Hsp_hit-to>
      <Hsp_query-frame>0</Hsp_query-frame>
      <Hsp_hit-frame>0</Hsp_hit-frame>
      <Hsp_identity>106</Hsp_identity>
      <Hsp_positive>154</Hsp_positive>
      <Hsp_gaps>21</Hsp_gaps>
      <Hsp_align-len>230</Hsp_align-len>
      <Hsp_qseq>LDKGTLLYRGQKLDLPTFEHNAENKLFYFRNYVSTSLKPLIFGEFGRMFMALDDDTTIYTAETPDDYNRFANPEDIIDIGATQKDSFDDNNNDGTSINIGKQVNLGFVISGAENVRVIVPGSLTEYPEEAEVILPRGTLLKINKITTQVDKRS--NKFMVEGSIVPPSEQIDESVEIYDGDLFMETGEVVKLSGFMQFVNESAYDEEQNQMAAEILSGFLDIDDMPRKFR</Hsp_qseq>
      <Hsp_hseq>LPPGTTLYRGQEVTFKTLRHNIENKMFYFKNFVSTSLKPNIFGEHGKNYMALDDSGAVFSGEGEGS----VDAEDLMHMGSHSAYANED-----------AETSVGMVIKGAERIKVIVPGHLSGFPSEAEVILPRGILLKINKVSTYMMKETAYNKYLIEGTIVPPSEQLEESV--YDGDHLMETGEVRPMAGFNQFLVEES--KEEENEVSQILASLVNINGMSKKFK</Hsp_hseq>
      <Hsp_midline>L  GT LYRGQ++   T  HN ENK+FYF+N+VSTSLKP IFGE G+ +MALDD   +++ E         + ED++ +G+    + +D            + ++G VI GAE ++VIVPG L+ +P EAEVILPRG LLKINK++T + K +  NK+++EG+IVPPSEQ++ESV  YDGD  METGEV  ++GF QF+ E +  +E+    ++IL+  ++I+ M +KF+</Hsp_midline>
    </Hsp>
  </Hit_hsps>
</Hit>
<Hit>
  <Hit_num>3</Hit_num>
  <Hit_id>gi|228861509|ref|YP_002854530.1|</Hit_id>
  <Hit_def>alt.-2 hypothetical protein [Enterobacteria phage RB14] &gt;gi|227438525|gb|ACP30838.1| alt.-2 hypothetical protein [Enterobacteria phage RB14]</Hit_def>
  <Hit_accession>YP_002854530</Hit_accession>
  <Hit_len>685</Hit_len>
  <Hit_hsps>
    <Hsp>
      <Hsp_num>1</Hsp_num>
      <Hsp_bit-score>197.593</Hsp_bit-score>
      <Hsp_score>501</Hsp_score>
      <Hsp_evalue>4.35388e-55</Hsp_evalue>
      <Hsp_query-from>2</Hsp_query-from>
      <Hsp_query-to>229</Hsp_query-to>
      <Hsp_hit-from>474</Hsp_hit-from>
      <Hsp_hit-to>684</Hsp_hit-to>
      <Hsp_query-frame>0</Hsp_query-frame>
      <Hsp_hit-frame>0</Hsp_hit-frame>
      <Hsp_identity>108</Hsp_identity>
      <Hsp_positive>152</Hsp_positive>
      <Hsp_gaps>21</Hsp_gaps>
      <Hsp_align-len>230</Hsp_align-len>
      <Hsp_qseq>LDKGTLLYRGQKLDLPTFEHNAENKLFYFRNYVSTSLKPLIFGEFGRMFMALDDDTTIYTAETPDDYNRFANPEDIIDIGATQKDSFDDNNNDGTSINIGKQVNLGFVISGAENVRVIVPGSLTEYPEEAEVILPRGTLLKINKITTQVDKRS--NKFMVEGSIVPPSEQIDESVEIYDGDLFMETGEVVKLSGFMQFVNESAYDEEQNQMAAEILSGFLDIDDMPRKFR</Hsp_qseq>
      <Hsp_hseq>LPPGTTLYRGQEVTFKTLRHNIENKMFYFKNFVSTSLKPNIFGEHGKNYMALDDSGAVFSGEGEGS----VDAEDLMHMGS-----------HSTYANEDAETSVGMVIKGAERVKVIVPGHLSGFPSEAEVILPRGILLKINKVSTYFMKETAYNKYLIEGTIVPPSEQLEESV--YDGDHLMETGEVRPMAGFNQFLVEES--KEEENEVSQILASLVNINGMSKKFK</Hsp_hseq>
      <Hsp_midline>L  GT LYRGQ++   T  HN ENK+FYF+N+VSTSLKP IFGE G+ +MALDD   +++ E         + ED++ +G+             T  N   + ++G VI GAE V+VIVPG L+ +P EAEVILPRG LLKINK++T   K +  NK+++EG+IVPPSEQ++ESV  YDGD  METGEV  ++GF QF+ E +  +E+    ++IL+  ++I+ M +KF+</Hsp_midline>
    </Hsp>
  </Hit_hsps>
</Hit>
</Iteration_hits>
  <Iteration_stat>
    <Statistics>
      <Statistics_db-num>48094830</Statistics_db-num>
      <Statistics_db-len>17186091396</Statistics_db-len>
      <Statistics_hsp-len>143</Statistics_hsp-len>
      <Statistics_eff-space>886533640716</Statistics_eff-space>
      <Statistics_kappa>0.041</Statistics_kappa>
      <Statistics_lambda>0.267</Statistics_lambda>
      <Statistics_entropy>0.14</Statistics_entropy>
    </Statistics>
  </Iteration_stat>
</Iteration>
</BlastOutput_iterations>
</BlastOutput>