Mercurial > repos > iuc > snpeff

comparison test-data/pBR322.gbk @ 10:5b4ac70948d2 draft

Find changesets by keywords (author, files, the commit message), revision number or hash, or revset expression.
planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tool_collections/snpeff commit eea43430ff90fe6b13b295f6d5efb2208401a7ef
author iuc
date Tue, 27 Mar 2018 09:44:18 -0400
parents
children
comparison
equal deleted inserted replaced
9:68693743661e 10:5b4ac70948d2
1 LOCUS SYNPBR322 4361 bp DNA circular SYN 30-SEP-2008
2 DEFINITION Cloning vector pBR322, complete sequence.
3 ACCESSION J01749 K00005 L08654 M10282 M10283 M10286 M10356 M10784 M10785
4 M10786 M33694 V01119
5 VERSION J01749.1
6 KEYWORDS ampicillin resistance; beta-lactamase; cloning vector; drug
7 resistance protein; origin of replication; plasmid; tetracycline
8 resistance.
9 SOURCE Cloning vector pBR322
10 ORGANISM Cloning vector pBR322
11 other sequences; artificial sequences; vectors.
12 REFERENCE 1 (bases 1 to 3; 3259 to 4361)
13 AUTHORS Sutcliffe,J.G.
14 TITLE Nucleotide sequence of the ampicillin resistance gene of
15 Escherichia coli plasmid pBR322
16 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 75 (8), 3737-3741 (1978)
17 PUBMED 358200
18 REFERENCE 2 (bases 1 to 4361)
19 AUTHORS Sutcliffe,J.G.
20 TITLE Complete nucleotide sequence of the Escherichia coli plasmid pBR322
21 JOURNAL Cold Spring Harb. Symp. Quant. Biol. 43 (Pt 1), 77-90 (1979)
22 PUBMED 383387
23 REFERENCE 3 (bases 1500 to 2300)
24 AUTHORS Reed,R.R., Young,R.A., Steitz,J.A., Grindley,N.D. and Guyer,M.S.
25 TITLE Transposition of the Escherichia coli insertion element gamma
26 generates a five-base-pair repeat
27 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 76 (10), 4882-4886 (1979)
28 PUBMED 388421
29 REFERENCE 4 (bases 2207 to 2265)
30 AUTHORS Covarrubias,L., Cervantes,L., Covarrubias,A., Soberon,X.,
31 Vichido,I., Blanco,A., Kupersztoch-Portnoy,Y.M. and Bolivar,F.
32 TITLE Construction and characterization of new cloning vehicles. V.
33 Mobilization and coding properties of pBR322 and several deletion
34 derivatives including pBR327 and pBR328
35 JOURNAL Gene 13 (1), 25-35 (1981)
36 PUBMED 6263753
37 REFERENCE 5 (bases 2000 to 2500)
38 AUTHORS Marians,K.J., Soeller,W. and Zipursky,S.L.
39 TITLE Maximal limits of the Escherichia coli replication factor Y
40 effector site sequences in pBR322 DNA
41 JOURNAL J. Biol. Chem. 257 (10), 5656-5662 (1982)
42 PUBMED 6279609
43 REFERENCE 6 (bases 1 to 80; 4151 to 4229; 4349 to 4361)
44 AUTHORS Brosius,J., Cate,R.L. and Perlmutter,A.P.
45 TITLE Precise location of two promoters for the beta-lactamase gene of
46 pBR322. S1 mapping of ribonucleic acid isolated from Escherichia
47 coli or synthesized in vitro
48 JOURNAL J. Biol. Chem. 257 (15), 9205-9210 (1982)
49 PUBMED 6178738
50 REFERENCE 7 (bases 4241 to 4343)
51 AUTHORS Van Dyke,M.W., Hertzberg,R.P. and Dervan,P.B.
52 TITLE Map of distamycin, netropsin, and actinomycin binding sites on
53 heterogeneous DNA: DNA cleavage-inhibition patterns with
54 methidiumpropyl-EDTA.Fe(II)
55 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 79 (18), 5470-5474 (1982)
56 PUBMED 6291045
57 REFERENCE 8 (bases 584 to 709)
58 AUTHORS Peden,K.W. and Nathans,D.
59 TITLE Local mutagenesis within deletion loops of DNA heteroduplexes
60 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 79 (23), 7214-7217 (1982)
61 PUBMED 6760191
62 REFERENCE 9 (bases 373 to 649)
63 AUTHORS Peden,K.W.
64 TITLE Revised sequence of the tetracycline-resistance gene of pBR322
65 JOURNAL Gene 22 (2-3), 277-280 (1983)
66 PUBMED 6307828
67 REFERENCE 10 (bases 132 to 181)
68 AUTHORS Watabe,H., Iino,T., Kaneko,T., Shibata,T. and Ando,T.
69 TITLE A new class of site-specific endodeoxyribonucleases. Endo.Sce I
70 isolated from a eukaryote, Saccharomyces cerevisiae
71 JOURNAL J. Biol. Chem. 258 (8), 4663-4665 (1983)
72 PUBMED 6300094
73 REFERENCE 11 (bases 368 to 581)
74 AUTHORS Livneh,Z.
75 TITLE Directed mutagenesis method for analysis of mutagen specificity:
76 application to ultraviolet-induced mutagenesis
77 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 80 (1), 237-241 (1983)
78 PUBMED 6337373
79 REFERENCE 12 (bases 2627 to 2682; 2781 to 2828)
80 AUTHORS Mascharak,P.K., Sugiura,Y., Kuwahara,J., Suzuki,T. and Lippard,S.J.
81 TITLE Alteration and activation of sequence-specific cleavage of DNA by
82 bleomycin in the presence of the antitumor drug
83 cis-diamminedichloroplatinum(II)
84 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 80 (22), 6795-6798 (1983)
85 PUBMED 6196777
86 REFERENCE 13 (bases 4276 to 4336)
87 AUTHORS Schultz,P.G. and Dervan,P.B.
88 TITLE Sequence-specific double-strand cleavage of DNA by
89 penta-N-methylpyrrolecarboxamide-EDTA X Fe(II)
90 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 80 (22), 6834-6837 (1983)
91 PUBMED 6417654
92 REFERENCE 14 (bases 518 to 528)
93 AUTHORS Sutcliffe,J.G.
94 JOURNAL Unpublished
95 REFERENCE 15 (bases 2395 to 2495)
96 AUTHORS Fuller,R.S., Funnell,B.E. and Kornberg,A.
97 TITLE The dnaA protein complex with the E. coli chromosomal replication
98 origin (oriC) and other DNA sites
99 JOURNAL Cell 38 (3), 889-900 (1984)
100 PUBMED 6091903
101 REFERENCE 16 (bases 2729 to 2731)
102 AUTHORS Lathe,R., Kieny,M.P., Skory,S. and Lecocq,J.P.
103 TITLE Linker tailing: unphosphorylated linker oligonucleotides for
104 joining DNA termini
105 JOURNAL DNA 3 (2), 173-182 (1984)
106 PUBMED 6327214
107 REFERENCE 17 (bases 2729 to 2730)
108 AUTHORS Heusterspreute,M. and Davison,J.
109 TITLE Restriction site bank vectors. II. DNA sequence analysis of plasmid
110 pJRD158
111 JOURNAL DNA 3 (3), 259-268 (1984)
112 PUBMED 6086259
113 REFERENCE 18 (bases 2113 to 2186; 2348 to 2415)
114 AUTHORS Abarzua,P., Soeller,W. and Marians,K.J.
115 TITLE Mutational analysis of primosome assembly sites. I. Distinct
116 classes of mutants in the pBR322 Escherichia coli factor Y DNA
117 effector sequences
118 JOURNAL J. Biol. Chem. 259 (22), 14286-14292 (1984)
119 PUBMED 6209275
120 REFERENCE 19 (bases 2348 to 2415)
121 AUTHORS Soeller,W., Abarzua,P. and Marians,K.J.
122 TITLE Mutational analysis of primosome assembly sites. II. Role of
123 secondary structure in the formation of active sites
124 JOURNAL J. Biol. Chem. 259 (22), 14293-14300 (1984)
125 PUBMED 6150042
126 REFERENCE 20 (bases 1 to 4361)
127 AUTHORS Van Dyke,M.M. and Dervan,P.B.
128 TITLE Echinomycin binding sites on DNA
129 JOURNAL Science 225 (4667), 1122-1127 (1984)
130 PUBMED 6089341
131 REFERENCE 21 (sites)
132 AUTHORS Pouwels,P.H., Enger-Valk,B.E. and Brammar,W.J.
133 JOURNAL (in) CLONING VECTORS. Elsevier Scientific Publishing, Amsterdam
134 (1985)
135 REMARK Vector I-A-iv-1
136 REFERENCE 22 (bases 1 to 4361)
137 AUTHORS Watson,N.
138 TITLE A new revision of the sequence of plasmid pBR322
139 JOURNAL Gene 70 (2), 399-403 (1988)
140 PUBMED 3063608
141 REFERENCE 23 (sites)
142 AUTHORS Gilbert,W.
143 TITLE Obtained from VecBase 3.0
144 JOURNAL Unpublished
145 COMMENT On or before Apr 4, 2002 this sequence version replaced L08654.1,
146 gi:58257.
147 The circular sequence is numbered such that 0 is the middle of the
148 unique EcoRI site and the count increases first through the tet
149 genes, the pMB1 material, and finally through the Tn3 region.
150 Plasmid pBR322 contains ampicillin and tetracycline resistance
151 genes. The ampicillin resistance gene (amp-r) is a penicillin
152 beta-lactamase. Promoters P1 and P3 are for the beta-lactamase
153 gene. P3 is the natural promoter, and P1 is artificially created by
154 the ligation of two different DNA fragments to create pBR322. P2 is
155 in the same region as P1, but it is on the opposite strand and
156 initiates transcription in the direction of the tetracycline
157 resistance gene.
158 Mutational studies in the primosome assembly sites indicate four
159 types of mutations: Class I having no effect on the activities
160 elicited by the DNA site and the bases involved are probably
161 spacers; Class II requiring higher Mg-2+ concentrations than the
162 wild-type to be fully activated as factor Y ATPase effectors; Class
163 III co-inactivating both the ATPase effector and DNA replication
164 template activity of the site, indicating that they probably
165 represent essential contact points between factor Y and the DNA;
166 Class IV having a replication template activity intermediate that
167 of class III and class II mutant DNAs.
168 Specific sites within or near the origins of replication are
169 recognized by dnaA protein. Without dnaA binding to the origin of
170 replication chromosomal replication is not possible (15). pBR322
171 DNA contains two separate regions on opposite strands and close to
172 the origin of replication which, when in single-stranded form, can
173 act as effectors for the ATPase activity of E.coli replication
174 factor Y (5). Small fragments of DNA containing these sites when
175 cloned in an f1 phage vector act as origins of DNA replication
176 allowing the formation of complementary double-stranded DNA in
177 rifampicin-resistant, dna(B,G,C)-dependent fashion in vitro (5).
178 The biological activity of echinomycin is thought to be related to
179 the formation of complexes by intercalating with cellular DNA (20).
180 Complete source information:
181 Plasmid pBR322 from E.coli (2),(1),(3),(6),(11),(8),(5),(7),(12),
182 (13),(10),(9),(14),(18),(19),(15),(20),(16); pBR322 DNA in pXf3
183 (4).
184 The following data and their annotation were supplied by Will
185 Gilbert under the auspices of the Curator Program.
186 CROSSREFERENCE
187 #parent
188 GenBank(50):pSC101C, GenBank(50):Trn3
189 #offspring
190 VecBase(3):pBR325, VecBase(3):pBR327,
191 VecBase(3):pBR328,
192 VecBase(3):pAT153, VecBase(3):pUC7,
193 VecBase(3):pJRD158,
194 VecBase(3):PiVX, VecBase(3):PiAN7,
195 VecBase(3):pSP64,
196 VecBase(3):pSP65, VecBase(3):pGEM1,
197 VecBase(3):pGEM2,
198 VecBase(3):pGEM3, VecBase(3):pGEM4,
199 VecBase(3):pKK223,
200 VecBase(3):pLBU3, VecBase(3):pTrS3,
201 VecBase(3):pRSVNeo,
202 VecBase(3):pSV2Cat, VecBase(3):M13mp9,
203 VecBase(3):pHC79,
204 VecBase(3):pV34, VecBase(3):pKTH601,
205 VecBase(3):pKTH604,
206 VecBase(3):pKTH605, VecBase(3):pKTH606,
207 VecBase(3):YEp24,
208 VecBase(3):YIp5, VecBase(3):YRp17,
209 VecBase(3):pSP18,
210 VecBase(3):pSP19,
211 VecBase(3):pSP6T3, VecBase(3):pSP6T719,
212 VecBase(3):pT712,
213 VecBase(3):pT713, VecBase(3):pT7T318,
214 VecBase(3):pT7T319,
215 VecBase(3):pT7T3A18, VecBase(3):pT7T3A19,
216 VecBase(3):pEX1,
217 VecBase(3):pEX2, VecBase(3):pEX3,
218 VecBase(3):pCKSP6,
219 VecBase(3):pACYC177, VecBase(3):pKO1,
220 VecBase(3):pKO2,
221 VecBase(3):pKM1,
222 VecBase(3):pKM2, VecBase(3):pMBL1,
223 VecBase(3):pMBL604,
224 VecBase(3):pMC1511, VecBase(3):pMC1871,
225 VecBase(3):pAA37X,
226 VecBase(3):pUR278, VecBase(3):pUR288,
227 VecBase(3):pUR289,
228 VecBase(3):pUR290, VecBase(3):pUR291,
229 VecBase(3):pUR292,
230 VecBase(3):pUR222.
231 FEATURES Location/Qualifiers
232 source 1..4361
233 /organism="Cloning vector pBR322"
234 /mol_type="other DNA"
235 /db_xref="taxon:47470"
236 /tissue_lib="ATCC 31344, ATCC 37017"
237 /focus
238 source 1..1762
239 /organism="Plasmid pSC101"
240 /mol_type="other DNA"
241 /db_xref="taxon:2625"
242 misc_binding 24..27
243 /bound_moiety="echinomycin"
244 regulatory complement(27..33)
245 /regulatory_class="promoter"
246 /note="promoter P1 (6)"
247 misc_binding 39..42
248 /bound_moiety="echinomycin"
249 regulatory 43..49
250 /regulatory_class="promoter"
251 /note="promoter P2 (6)"
252 misc_binding 53..56
253 /bound_moiety="echinomycin"
254 misc_binding 67..70
255 /bound_moiety="echinomycin"
256 misc_binding 80..83
257 /bound_moiety="echinomycin"
258 gene 86..1276
259 /gene="tet"
260 CDS 86..1276
261 /gene="tet"
262 /codon_start=1
263 /transl_table=11
264 /product="tetracycline resistance protein"
265 /protein_id="AAB59735.1"
266 /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASH
267 YGVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAG
268 RIVAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLH
269 APFLAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTV
270 FFIMQLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGE
271 KQAIIAGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQG
272 QLQGSLAALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSR
273 ATST"
274 misc_feature complement(141..142)
275 /note="Endo.Sce I cleavage site coordinated with site at
276 base 146 (10)"
277 misc_feature 146..147
278 /gene="tet"
279 /note="Endo.Sce I cleavage site coordinated with site at
280 base 142 (10)"
281 misc_binding 411..414
282 /gene="tet"
283 /bound_moiety="echinomycin"
284 misc_difference 426
285 /gene="tet"
286 /note="conflict"
287 /citation=[11]
288 /replace=""
289 misc_binding 469..472
290 /gene="tet"
291 /bound_moiety="echinomycin"
292 old_sequence 526..528
293 /gene="tet"
294 /citation=[17]
295 repeat_region complement(1515..1519)
296 /note="gamma-delta insertion target sequence"
297 /rpt_type=direct
298 misc_feature 1636..1762
299 /note="from pSC101 (bp 1860-1986)"
300 repeat_region complement(1788..1792)
301 /note="gamma-delta insertion target sequence"
302 /rpt_type=direct
303 misc_difference 1891..1892
304 /note="conflict"
305 /citation=[23]
306 /replace="att"
307 old_sequence 1892..1893
308 /citation=[2]
309 /citation=[22]
310 regulatory 1905..1910
311 /regulatory_class="ribosome_binding_site"
312 regulatory 1905..1909
313 /regulatory_class="ribosome_binding_site"
314 /note="Shine-Dalgarno sequence"
315 misc_difference 1913..1914
316 /note="conflict"
317 /citation=[23]
318 /replace="caa"
319 old_sequence 1914..1915
320 /citation=[17]
321 CDS 1915..2106
322 /codon_start=1
323 /transl_table=11
324 /product="ROP protein"
325 /protein_id="AAB59736.1"
326 /translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDH
327 ADELYRSCLARFGDDGENL"
328 misc_feature 2011..2167
329 /note="H-strand Y effector site"
330 /citation=[5]
331 repeat_region complement(2245..2249)
332 /note="gamma-delta insertion target sequence"
333 /rpt_type=direct
334 misc_feature complement(2351..2414)
335 /note="L-strand Y effector site"
336 /citation=[5]
337 misc_binding 2439..2447
338 /bound_moiety="dnaA"
339 rep_origin 2535
340 old_sequence 2729..2730
341 /note="revision according to (17)"
342 /citation=[2]
343 /citation=[17]
344 /replace="at"
345 old_sequence 2729
346 /citation=[17]
347 old_sequence 2730
348 /note="revision according to (16)"
349 /citation=[2]
350 /citation=[16]
351 /citation=[17]
352 /replace="t"
353 mobile_element 3148..4361
354 /mobile_element_type="transposon:Tn3"
355 repeat_region 3148..3185
356 /note="corresponds to one of the 38bp repeats found in Tn3
357 (bp 1-38 and complement (4920-4957))"
358 /rpt_type=inverted
359 gene complement(3293..4153)
360 /gene="bla"
361 CDS complement(3293..4153)
362 /gene="bla"
363 /note="E-286"
364 /codon_start=1
365 /transl_table=11
366 /product="beta-lactamase"
367 /protein_id="AAB59737.1"
368 /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY
369 IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVE
370 YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL
371 DRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL
372 LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA
373 EIGASLIKHW"
374 sig_peptide complement(4085..4153)
375 /gene="bla"
376 mat_peptide complement(3296..4084)
377 /gene="bla"
378 /product="beta-lactamase"
379 regulatory complement(4161..4165)
380 /regulatory_class="ribosome_binding_site"
381 /note="Shine-Dalgarno sequence"
382 regulatory complement(4188..4194)
383 /regulatory_class="promoter"
384 /note="promoter P3 (6)"
385 misc_binding complement(4268..4271)
386 /bound_moiety="echinomycin"
387 misc_binding complement(4280..4283)
388 /bound_moiety="echinomycin"
389 misc_binding complement(4285..4288)
390 /bound_moiety="echinomycin"
391 misc_binding complement(4296..4299)
392 /bound_moiety="echinomycin"
393 misc_binding complement(4311..4314)
394 /bound_moiety="echinomycin"
395 misc_binding complement(4317..4320)
396 /bound_moiety="echinomycin"
397 misc_binding complement(4331..4334)
398 /bound_moiety="echinomycin"
399 ORIGIN
400 1 ttctcatgtt tgacagctta tcatcgataa gctttaatgc ggtagtttat cacagttaaa
401 61 ttgctaacgc agtcaggcac cgtgtatgaa atctaacaat gcgctcatcg tcatcctcgg
402 121 caccgtcacc ctggatgctg taggcatagg cttggttatg ccggtactgc cgggcctctt
403 181 gcgggatatc gtccattccg acagcatcgc cagtcactat ggcgtgctgc tagcgctata
404 241 tgcgttgatg caatttctat gcgcacccgt tctcggagca ctgtccgacc gctttggccg
405 301 ccgcccagtc ctgctcgctt cgctacttgg agccactatc gactacgcga tcatggcgac
406 361 cacacccgtc ctgtggatcc tctacgccgg acgcatcgtg gccggcatca ccggcgccac
407 421 aggtgcggtt gctggcgcct atatcgccga catcaccgat ggggaagatc gggctcgcca
408 481 cttcgggctc atgagcgctt gtttcggcgt gggtatggtg gcaggccccg tggccggggg
409 541 actgttgggc gccatctcct tgcatgcacc attccttgcg gcggcggtgc tcaacggcct
410 601 caacctacta ctgggctgct tcctaatgca ggagtcgcat aagggagagc gtcgaccgat
411 661 gcccttgaga gccttcaacc cagtcagctc cttccggtgg gcgcggggca tgactatcgt
412 721 cgccgcactt atgactgtct tctttatcat gcaactcgta ggacaggtgc cggcagcgct
413 781 ctgggtcatt ttcggcgagg accgctttcg ctggagcgcg acgatgatcg gcctgtcgct
414 841 tgcggtattc ggaatcttgc acgccctcgc tcaagccttc gtcactggtc ccgccaccaa
415 901 acgtttcggc gagaagcagg ccattatcgc cggcatggcg gccgacgcgc tgggctacgt
416 961 cttgctggcg ttcgcgacgc gaggctggat ggccttcccc attatgattc ttctcgcttc
417 1021 cggcggcatc gggatgcccg cgttgcaggc catgctgtcc aggcaggtag atgacgacca
418 1081 tcagggacag cttcaaggat cgctcgcggc tcttaccagc ctaacttcga tcactggacc
419 1141 gctgatcgtc acggcgattt atgccgcctc ggcgagcaca tggaacgggt tggcatggat
420 1201 tgtaggcgcc gccctatacc ttgtctgcct ccccgcgttg cgtcgcggtg catggagccg
421 1261 ggccacctcg acctgaatgg aagccggcgg cacctcgcta acggattcac cactccaaga
422 1321 attggagcca atcaattctt gcggagaact gtgaatgcgc aaaccaaccc ttggcagaac
423 1381 atatccatcg cgtccgccat ctccagcagc cgcacgcggc gcatctcggg cagcgttggg
424 1441 tcctggccac gggtgcgcat gatcgtgctc ctgtcgttga ggacccggct aggctggcgg
425 1501 ggttgcctta ctggttagca gaatgaatca ccgatacgcg agcgaacgtg aagcgactgc
426 1561 tgctgcaaaa cgtctgcgac ctgagcaaca acatgaatgg tcttcggttt ccgtgtttcg
427 1621 taaagtctgg aaacgcggaa gtcagcgccc tgcaccatta tgttccggat ctgcatcgca
428 1681 ggatgctgct ggctaccctg tggaacacct acatctgtat taacgaagcg ctggcattga
429 1741 ccctgagtga tttttctctg gtcccgccgc atccataccg ccagttgttt accctcacaa
430 1801 cgttccagta accgggcatg ttcatcatca gtaacccgta tcgtgagcat cctctctcgt
431 1861 ttcatcggta tcattacccc catgaacaga aatccccctt acacggaggc atcagtgacc
432 1921 aaacaggaaa aaaccgccct taacatggcc cgctttatca gaagccagac attaacgctt
433 1981 ctggagaaac tcaacgagct ggacgcggat gaacaggcag acatctgtga atcgcttcac
434 2041 gaccacgctg atgagcttta ccgcagctgc ctcgcgcgtt tcggtgatga cggtgaaaac
435 2101 ctctgacaca tgcagctccc ggagacggtc acagcttgtc tgtaagcgga tgccgggagc
436 2161 agacaagccc gtcagggcgc gtcagcgggt gttggcgggt gtcggggcgc agccatgacc
437 2221 cagtcacgta gcgatagcgg agtgtatact ggcttaacta tgcggcatca gagcagattg
438 2281 tactgagagt gcaccatatg cggtgtgaaa taccgcacag atgcgtaagg agaaaatacc
439 2341 gcatcaggcg ctcttccgct tcctcgctca ctgactcgct gcgctcggtc gttcggctgc
440 2401 ggcgagcggt atcagctcac tcaaaggcgg taatacggtt atccacagaa tcaggggata
441 2461 acgcaggaaa gaacatgtga gcaaaaggcc agcaaaaggc caggaaccgt aaaaaggccg
442 2521 cgttgctggc gtttttccat aggctccgcc cccctgacga gcatcacaaa aatcgacgct
443 2581 caagtcagag gtggcgaaac ccgacaggac tataaagata ccaggcgttt ccccctggaa
444 2641 gctccctcgt gcgctctcct gttccgaccc tgccgcttac cggatacctg tccgcctttc
445 2701 tcccttcggg aagcgtggcg ctttctcata gctcacgctg taggtatctc agttcggtgt
446 2761 aggtcgttcg ctccaagctg ggctgtgtgc acgaaccccc cgttcagccc gaccgctgcg
447 2821 ccttatccgg taactatcgt cttgagtcca acccggtaag acacgactta tcgccactgg
448 2881 cagcagccac tggtaacagg attagcagag cgaggtatgt aggcggtgct acagagttct
449 2941 tgaagtggtg gcctaactac ggctacacta gaaggacagt atttggtatc tgcgctctgc
450 3001 tgaagccagt taccttcgga aaaagagttg gtagctcttg atccggcaaa caaaccaccg
451 3061 ctggtagcgg tggttttttt gtttgcaagc agcagattac gcgcagaaaa aaaggatctc
452 3121 aagaagatcc tttgatcttt tctacggggt ctgacgctca gtggaacgaa aactcacgtt
453 3181 aagggatttt ggtcatgaga ttatcaaaaa ggatcttcac ctagatcctt ttaaattaaa
454 3241 aatgaagttt taaatcaatc taaagtatat atgagtaaac ttggtctgac agttaccaat
455 3301 gcttaatcag tgaggcacct atctcagcga tctgtctatt tcgttcatcc atagttgcct
456 3361 gactccccgt cgtgtagata actacgatac gggagggctt accatctggc cccagtgctg
457 3421 caatgatacc gcgagaccca cgctcaccgg ctccagattt atcagcaata aaccagccag
458 3481 ccggaagggc cgagcgcaga agtggtcctg caactttatc cgcctccatc cagtctatta
459 3541 attgttgccg ggaagctaga gtaagtagtt cgccagttaa tagtttgcgc aacgttgttg
460 3601 ccattgctgc aggcatcgtg gtgtcacgct cgtcgtttgg tatggcttca ttcagctccg
461 3661 gttcccaacg atcaaggcga gttacatgat cccccatgtt gtgcaaaaaa gcggttagct
462 3721 ccttcggtcc tccgatcgtt gtcagaagta agttggccgc agtgttatca ctcatggtta
463 3781 tggcagcact gcataattct cttactgtca tgccatccgt aagatgcttt tctgtgactg
464 3841 gtgagtactc aaccaagtca ttctgagaat agtgtatgcg gcgaccgagt tgctcttgcc
465 3901 cggcgtcaac acgggataat accgcgccac atagcagaac tttaaaagtg ctcatcattg
466 3961 gaaaacgttc ttcggggcga aaactctcaa ggatcttacc gctgttgaga tccagttcga
467 4021 tgtaacccac tcgtgcaccc aactgatctt cagcatcttt tactttcacc agcgtttctg
468 4081 ggtgagcaaa aacaggaagg caaaatgccg caaaaaaggg aataagggcg acacggaaat
469 4141 gttgaatact catactcttc ctttttcaat attattgaag catttatcag ggttattgtc
470 4201 tcatgagcgg atacatattt gaatgtattt agaaaaataa acaaataggg gttccgcgca
471 4261 catttccccg aaaagtgcca cctgacgtct aagaaaccat tattatcatg acattaacct
472 4321 ataaaaatag gcgtatcacg aggccctttc gtcttcaaga a
473 //
474