Mercurial > repos > jay > pdaug_basic_plots
annotate PDAUG_Peptide_Global_Descriptors/test-data/test.fasta @ 7:d4da3192c324 draft
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit 32b9c48c81639a81be24bb3e2f48dc0a81c0deca"
| author | jay |
|---|---|
| date | Sun, 09 Jan 2022 03:44:17 +0000 |
| parents | 7d247e27ff11 |
| children |
| rev | line source |
|---|---|
|
0
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
1 >non-ACP0 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
2 MTISLIWGIAMVVCCCIWVIFDRRRRKAGEPPL |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
3 >non-ACP2 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
4 MFATPLRQPTNASGARPAVSMDGQETPFQYEITD |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
5 >non-ACP4 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
6 LLWRKVAGATVGPGPVPA |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
7 >non-ACP6 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
8 DSPDPMNGASSNALIAKMNSAKLLYQHY |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
9 >non-ACP8 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
10 NNQEVIDAISQAISQTPGCVL |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
11 >non-ACP10 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
12 KKVVEKNADPETTLLVYLRRKLGLCGTKLGCGEG |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
13 >non-ACP12 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
14 CSRLLPSLAQEEG |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
15 >non-ACP14 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
16 KNDFAALQAKLDADAAEIEKWWSDSR |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
17 >non-ACP16 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
18 VDREQLVQKARLAEQAERYDD |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
19 >non-ACP18 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
20 RPLRRVVLFYQGKLCSMAGNFWQSSHYLQW |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
21 >non-ACP20 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
22 GAAGERKLCLLSLLLIGA |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
23 >non-ACP22 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
24 MFRKLLKMWILLRPTHWLILIALCAVTCAGYWLLWSE |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
25 >non-ACP24 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
26 HLRGPADSGWMPQAAPCLSGAPQAS |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
27 >non-ACP26 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
28 NNPNNSNSHLRPHAYNNSRRDDSD |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
29 >non-ACP28 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
30 VVILASLSVMFLVSLWQQKIRERLPPGPTPLPFIGNY |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
31 >non-ACP30 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
32 ICLSCLISFFLWNQNRAKGKLPPG |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
33 >non-ACP32 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
34 VVMNSLRVILQAS |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
35 >non-ACP34 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
36 ARPRLDLQLVQRFVRIQKVF |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
37 >non-ACP36 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
38 MLAKGLSLRSVLAKGCQPFLSPTWQSSVLATGGGANIS |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
39 >non-ACP38 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
40 AAGLPGAALPLRKRPLRAPSPEPAAPRGAAGLVV |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
41 >non-ACP40 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
42 PPMPSAPPVHPPP |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
43 >non-ACP42 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
44 SCPIDKRRPLIAFLRRLRD |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
45 >non-ACP44 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
46 RLGLWASGLILILGFLKLLRLLLRRQRLARAMD |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
47 >non-ACP46 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
48 FSPQRDRFQAEGS |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
49 >non-ACP48 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
50 GTLWALVFLGILVGMVVPSPAGTRANNTLLDSRG |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
51 >non-ACP50 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
52 MNRLLQKGTSLVPSWRTR |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
53 >non-ACP52 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
54 MTTSLIWGIAIAACCCLWLILGIRRRQT |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
55 >non-ACP54 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
56 ATLANGMSLQPPLEEVS |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
57 >non-ACP56 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
58 PLTATNSGLAVNN |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
59 >non-ACP58 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
60 VRACHKVCRCLLSGFGGRVDAGQPELLTER |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
61 >non-ACP60 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
62 TAGILLLLLLGTLEGS |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
63 >non-ACP62 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
64 MEPSILLLLALLVGFLLLLVRGH |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
65 >non-ACP64 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
66 MKNCFQLLCNLKVPAAGFKNTVKS |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
67 >non-ACP66 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
68 SVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSK |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
69 >non-ACP68 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
70 KPLGLLKPSSLMKVSGRFKAHQDA |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
71 >non-ACP70 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
72 ARTLNNKLSLSKPKFSGFT |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
73 >non-ACP72 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
74 LLLVIIWTLFGPSGLGEELLSLSLASLLPAPASPGPP |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
75 >non-ACP74 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
76 WPGILVGGARVASCRYPALGPRLA |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
77 >non-ACP76 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
78 RSVKGLVALITGGASGL |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
79 >non-ACP78 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
80 AAAALRARILQVSSKVN |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
81 >non-ACP80 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
82 TGCCIAGRLANLDDQNLTVAL |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
83 >non-ACP82 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
84 GSILGFLQIATVLTVLLLLLK |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
85 >non-ACP84 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
86 AARQIGSCLMRCRTLDTTSP |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
87 >non-ACP86 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
88 WGCRGRRWAFARVDGGSCHRRGAPTGSTSNQIR |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
89 >non-ACP88 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
90 YAKPGAVRSPAQILQWQVLPNTVPAKS |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
91 >non-ACP90 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
92 RMAGPWLSLHEARLLGTRGAAAPKAV |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
93 >non-ACP92 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
94 SISNRAAVPEHGVAPDAERL |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
95 >non-ACP94 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
96 PNFSMETWLLLV |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
97 >non-ACP96 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
98 PRPPSKTYRGAFQN |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
99 >non-ACP98 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
100 SVLVKGCQPFLSAPRECPGHPRVGT |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
101 >non-ACP100 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
102 LVTPPKALLKPLSIPNQ |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
103 >non-ACP102 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
104 KMQGSRMDEQRCS |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
105 >non-ACP104 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
106 VIADDLPPTCIRP |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
107 >non-ACP106 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
108 LPGGLRVLVQTGH |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
109 >non-ACP108 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
110 GWIWRWGWGRRCLGRPGLPGPGPGPATPLFLLLL |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
111 >non-ACP110 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
112 RGIRGSSAARPSGRRRDPAGRTTETGFNIFTQHD |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
113 >non-ACP112 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
114 QQEKEFLESYPQNCPPDALPGTPGNLD |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
115 >non-ACP114 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
116 APARRVLQVKRVMQESSLSPAHL |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
117 >non-ACP116 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
118 KVAPGGPTGYPGNLTAEQEQKLGELKMILL |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
119 >non-ACP118 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
120 FLASYPQKCPAGSLPGTPGNTDE |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
121 >non-ACP120 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
122 MDAKARNCLLQHREALEKDIKTSY |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
123 >non-ACP122 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
124 ASRQLLVAPPEAL |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
125 >non-ACP124 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
126 MISNGIGTVTTGKRSMCLFPLLLIGLWGC |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
127 >non-ACP126 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
128 MTLRNFGMGKRSIEDRVQEEARCLVEELRKTNASPC |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
129 >non-ACP128 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
130 AVFGLGGVGLSVIMGCKAAGASRIIAVDIN |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
131 >non-ACP130 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
132 PNAKQSILQKNPDDVVIVAAYRTA |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
133 >non-ACP132 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
134 AMELLLTATIFYLVLWVVKAFRLQVPKGLKSPPGP |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
135 >non-ACP134 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
136 LLAAGFCPAVLCH |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
137 >non-ACP136 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
138 AASVNDEQHQRIIKYGRALVLDIVEQ |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
139 >non-ACP138 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
140 IARLREDGIQKRVIQEGRGELPDFQDG |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
141 >non-ACP140 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
142 FIVVMNILALTLPFLAAEVQN |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
143 >non-ACP142 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
144 CQNGRRANRTVRFARTA |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
145 >non-ACP144 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
146 WVTVRSQQRGLFPAI |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
147 >non-ACP146 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
148 LLRSCPLQGSPGRPRSV |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
149 >non-ACP148 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
150 LNDGHFMPVLGFGTYAPPEVPRNRAVEV |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
151 >non-ACP150 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
152 HLGRPSAPTIVAQPVSGLASPASFQPEQFQYTLDNNVLT |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
153 >non-ACP152 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
154 RPEPGGCCCRRTVRANGC |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
155 >non-ACP154 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
156 SWVEENRASFQPPVCNKLMHR |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
157 >non-ACP156 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
158 VFHRVRWAPELGASLG |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
159 >non-ACP158 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
160 RAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQ |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
161 >non-ACP160 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
162 LLQRARLAEQAERYDDMASAMKAVTELNEPLS |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
163 >non-ACP162 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
164 ALIQKLNSDPQFVLAQNVGTTHDLLDICLKRATVQRA |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
165 >non-ACP164 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
166 AALPMLWTGLVLLGLLGFPQTPAQGHDTVQPNFQQ |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
167 >non-ACP166 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
168 QRRQNDSSVFLAIMVAAAVES |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
169 >non-ACP168 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
170 CNAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARTDS |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
171 >non-ACP170 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
172 LVLLTVQNSALILTLNYSRIMPGYD |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
173 >non-ACP172 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
174 TVLSPPQRFKRILQAMMLAVAVV |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
175 >non-ACP174 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
176 ISRGLLLLAALCCLAPSFL |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
177 >non-ACP176 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
178 VAGTESAQGPPGPAASLELWLNKATDPS |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
179 >non-ACP178 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
180 QYLRIRTVQPEPDYGAAV |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
181 >non-ACP180 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
182 ASPTQTPPTTSTIRVARRSRVALVAM |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
183 >non-ACP182 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
184 TIWRNQHTYKMATSASANLSKIVKKNYMELPQDGKVQ |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
185 >non-ACP184 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
186 LSITRGLLLLAALCCLAPIS |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
187 >non-ACP186 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
188 ILLSIWRQSSGRGKLPPGPIPLPIIGNIFQ |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
189 >non-ACP188 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
190 LLLLSWVALGPRSLEGADPGTPGEAEGPACP |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
191 >non-ACP190 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
192 LRVKRAMQEASFMPPLLPPAAHQRFSTVPAVP |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
193 >non-ACP192 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
194 GLLLLAGLCCLVFGIMAEDAQVAQGPSQQI |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
195 >non-ACP194 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
196 RHVGLLCATGPQRWRF |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
197 >non-ACP196 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
198 AAVALARPKPPLRHQEHLQNEPDS |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
199 >non-ACP198 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
200 SRVNDQSQASRNGLKGKVLTLDTMNPCV |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
201 >non-ACP200 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
202 AAALGPGVLQATRAFHTGQPRLAPLPPLPEYGGK |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
203 >non-ACP202 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
204 LCTSGLWTAQASTNESSNSHRGLAPTNV |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
205 >non-ACP204 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
206 PAIQPVLSGLSRIVNGEEA |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
207 >non-ACP206 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
208 GCQASLSTAQERLGHPGVPTREGVR |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
209 >non-ACP208 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
210 RKVLILTLVVAACGFVLWSSNGR |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
211 >non-ACP210 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
212 GRVRSRCPGPALLLLLALAARPALAGPPAAALQ |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
213 >non-ACP212 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
214 CRITKPALLVLNQETAKVVQT |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
215 >non-ACP214 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
216 KAEVCMAVPWLSLQ |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
217 >non-ACP216 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
218 SHLELNNGTKMPTLGLGT |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
219 >non-ACP218 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
220 LLLPEAAAERDAREKLALWDRRPDTTAPL |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
221 >non-ACP220 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
222 LLALSLVLLYRYATYSHGFFKKLGIPGPKPLPLFGNVLS |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
223 >non-ACP222 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
224 LLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKD |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
225 >non-ACP224 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
226 AFKSMEVANFYYEADCLAAAYGGKAAPAAPPADRPGPR |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
227 >non-ACP226 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
228 SLFWAARPLQRCGQLVRMAIRAQH |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
229 >non-ACP228 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
230 MRPPRTLTSTATMSALSTSMPMEIDDVMDEDAVNGQA |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
231 >non-ACP230 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
232 LLSLIGFCWAQYDP |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
233 >non-ACP232 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
234 LWARSKNDQLRISFPPGLCWG |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
235 >non-ACP234 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
236 PQGFDVDRDAKKLNKACKGMGTNEAAIIEILSG |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
237 >non-ACP236 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
238 IFCLILWVVKAWQPRLPKGLKSPPGPWGWPLLG |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
239 >non-ACP238 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
240 LDAASPGPLALLGLLFAATLLLSALFLL |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
241 >non-ACP240 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
242 VTLLFKLYCLA |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
243 >non-ACP242 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
244 ATRAAAARLVGTAASRTPAAARH |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
245 >non-ACP244 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
246 RNKLDLETLTDILEHQIR |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
247 >non-ACP246 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
248 RRLVLQARTYAQAAASPAPAAGPGQMSFTFASPTQVFF |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
249 >non-ACP248 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
250 PGRSRSAADDINPAPANM |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
251 >non-ACP250 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
252 LLSALTLETWVLLAVILVLLYRLG |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
253 >non-ACP252 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
254 VMGHGLCPQGARAKAAIPAALRDHEST |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
255 >non-ACP254 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
256 FLVSIAGLLYALVQLGQPCDCLPPLRAAA |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
257 >non-ACP256 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
258 VRSVRAAVGGLRAISAPSAPCLPRPWGLRAG |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
259 >non-ACP258 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
260 RGGCWPRGLQQLLVPGG |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
261 >non-ACP260 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
262 APATPPRPLKRKKLQFTDVTPESSP |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
263 >non-ACP262 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
264 EQAERYDDMAAAMKAVTEQGHELSNEERNL |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
265 >non-ACP264 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
266 MPNDPSDNQLK |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
267 >non-ACP266 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
268 TELLLAITVFCLGFWVVRALRTQVP |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
269 >non-ACP268 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
270 LTADLLGAPFFTLPKELQLALLERQTVFL |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
271 >non-ACP270 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
272 GHGRLVEIQGRLGVRIER |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
273 >non-ACP272 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
274 LPFKLLLFVLLDGWTRLTH |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
275 >non-ACP274 |
|
7d247e27ff11
"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
jay
parents:
diff
changeset
|
276 QALWLVLVLSMPPVLVAAVVGTLVSLVQ |
