Mercurial > repos > peterjc > seq_select_by_id

view test-data/k12_hypothetical.fasta @ 4:6842c0c7bc70 draft

Find changesets by keywords (author, files, the commit message), revision number or hash, or revset expression.
Uploaded v0.0.7, depend on Biopython 1.62, tabs to spaces in XML
author peterjc
date Mon, 28 Oct 2013 05:21:45 -0400
parents 28d52478ace9
children
line wrap: on
line source

>gi|16127999|ref|NP_414546.1| hypothetical protein b0005 [Escherichia coli str. K-12 substr. MG1655]
MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDGGHWRDHGWWKQHYEWRGNRWHL
HGPPPPPRHHKKAPHDHHGGHGPGKHHR