Mercurial > repos > yating-l > gbtofasta
comparison test-data/Gallus_gallus_RefSeq.gb @ 0:9573618e2afe draft
planemo upload commit f3fb68f4faf6766eef195b8b36157035ab95e7b1
author | yating-l |
---|---|
date | Wed, 12 Apr 2017 17:43:55 -0400 |
parents | |
children |
comparison
equal
deleted
inserted
replaced
-1:000000000000 | 0:9573618e2afe |
---|---|
1 LOCUS NM_001199713 3613 bp mRNA linear VRT 27-JAN-2017 | |
2 DEFINITION Gallus gallus uncharacterized LOC423300 (NOVA1), transcript variant | |
3 2, mRNA. | |
4 ACCESSION NM_001199713 | |
5 VERSION NM_001199713.1 | |
6 KEYWORDS RefSeq. | |
7 SOURCE Gallus gallus (chicken) | |
8 ORGANISM Gallus gallus | |
9 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
10 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
11 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
12 Phasianidae; Phasianinae; Gallus. | |
13 REFERENCE 1 (bases 1 to 3613) | |
14 AUTHORS Savolainen P, Fitzsimmons C, Arvestad L, Andersson L and Lundeberg | |
15 J. | |
16 TITLE ESTs from brain and testis of White Leghorn and red junglefowl: | |
17 annotation, bioinformatic classification of unknown transcripts and | |
18 analysis of expression levels | |
19 JOURNAL Cytogenet. Genome Res. 111 (1), 79-87 (2005) | |
20 PUBMED 16093725 | |
21 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
22 preliminary review. The reference sequence was derived from | |
23 DN851166.1, CO420756.1 and AADN04000014.1. | |
24 | |
25 Transcript Variant: This variant (2) lacks an alternate in-frame | |
26 exon in the 3' coding region, compared to variant 1. The resulting | |
27 protein (isoform 2) is shorter, compared to isoform 1. | |
28 | |
29 Sequence Note: This RefSeq record was created from transcript and | |
30 genomic sequence data to make the sequence consistent with the | |
31 reference genome assembly. The genomic coordinates used for the | |
32 transcript record were based on transcript alignments. | |
33 | |
34 ##Evidence-Data-START## | |
35 Transcript exon combination :: CO420756.1, CD215801.1 [ECO:0000332] | |
36 RNAseq introns :: single sample supports all introns | |
37 SAMEA2201366, SAMEA2201377 | |
38 [ECO:0000348] | |
39 ##Evidence-Data-END## | |
40 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
41 1-95 DN851166.1 226-320 | |
42 96-706 CO420756.1 1-611 | |
43 707-3613 AADN04000014.1 5941293-5944199 c | |
44 FEATURES Location/Qualifiers | |
45 source 1..3613 | |
46 /organism="Gallus gallus" | |
47 /mol_type="mRNA" | |
48 /db_xref="taxon:9031" | |
49 /chromosome="5" | |
50 /map="5" | |
51 /breed="Leghorn" | |
52 gene 1..3613 | |
53 /gene="NOVA1" | |
54 /note="uncharacterized LOC423300" | |
55 /db_xref="CGNC:7484" | |
56 /db_xref="GeneID:423300" | |
57 CDS 95..1546 | |
58 /gene="NOVA1" | |
59 /note="isoform 2 is encoded by transcript variant 2; | |
60 RNA-binding protein Nova-1; neuro-oncological ventral | |
61 antigen 1; NOVA alternative splicing regulator 1" | |
62 /codon_start=1 | |
63 /product="RNA-binding protein Nova-1 isoform 2" | |
64 /protein_id="NP_001186642.1" | |
65 /db_xref="CGNC:7484" | |
66 /db_xref="GeneID:423300" | |
67 /translation="MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNT | |
68 GEDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLI | |
69 QGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRIKQVKIIVPNSTAG | |
70 LIIGKGGATVKAIMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIIQKIQ | |
71 EDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLPTAAAAAGLLGHANLAGVAAF | |
72 PAVLSGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAAAAASANPAAAA | |
73 ANLLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKS | |
74 TDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTI | |
75 TGTPAATQAAQYLITQRITYEQGVRAANPQKVG" | |
76 ORIGIN | |
77 1 cccttcctct tccttcctcc tcctcctccc ccttccctcc ctgccccccc aacaccgaag | |
78 61 ggaagagaca attctcctcc gagcagcagc aaacatgatg gcggcagctc ccatccagca | |
79 121 gaacgggact cacaccgggg ttcccataga cctggacccg ccggactccc ggaaaagacc | |
80 181 gctggaagcc ccccccgaag cgggcagcac caagaggacc aacacgggcg aggatggcca | |
81 241 atattttcta aaggtcctca tacctagtta tgctgctgga tctataattg ggaagggagg | |
82 301 acagacaatt gttcagttgc agaaagagac cggggccacc atcaagctgt ctaaatccaa | |
83 361 agatttttac ccaggtacta cggagcgcgt gtgtctgatc cagggaacag ttgaagcact | |
84 421 aaatgcagtt catggcttca ttgcagagaa gattcgagaa atgcctcaaa atgtggccaa | |
85 481 gacagagcct gtcagcatcc tacaacctca gaccactgtt aatccagacc gcatcaaaca | |
86 541 agtaaagatt atagttccca acagcacagc aggtctgata atagggaagg gaggtgctac | |
87 601 agtgaaggct ataatggagc agtcaggggc ttgggtgcag ctttcccaga aacctgatgg | |
88 661 gatcaacttg caagagaggg ttgtcactgt gagtggagaa cctgaacaaa accgaaaagc | |
89 721 tgtcgaactt atcatccaga agatacaaga ggatccacag agtggcagct gtctcaatat | |
90 781 cagttatgcc aatgtcacag gtccagtggc caattccaat ccaaccggat ctccttatgc | |
91 841 aaacactgct gaagtgttac caactgctgc agctgctgca gggctattag gacatgctaa | |
92 901 ccttgctgga gtggcagcct ttccagcagt tttatctggc tttacaggca atgacctggt | |
93 961 ggccatcacc tctgcactta atacattagc cagctatgga tataatctca atacattagg | |
94 1021 tttaggccta agtcaggcag cagctacagg ggctttggct gcagcagctg ccagtgccaa | |
95 1081 cccagcagca gcagcagcca acttgttggc cacctatgcg agtgaagcct cagccagtgg | |
96 1141 cagcactgct ggtggtacgg cggggacatt tgcattaggt agcctggctg ctgctactgc | |
97 1201 tgcaaccaat ggatattttg gagctgcttc tcccctagct gccagtgcca tcctaggaac | |
98 1261 agaaaaatcc acagatggat caaaggatgt agttgaaata gcagtgccag aaaacttagt | |
99 1321 tggtgcaata cttggaaaag gagggaaaac attagttgaa taccaggagt tgactggtgc | |
100 1381 aaggatacag atctctaaaa agggagaatt cgtacctggc acaagaaatc gcaaggtaac | |
101 1441 cattactgga acaccagctg caacccaggc cgcacagtat ttaattacac aacggatcac | |
102 1501 atatgagcaa ggagttcggg ctgccaatcc acagaaagtg ggttgagagc ccctgttaaa | |
103 1561 catgagattg ttttaacccc tccttaccct attttcaaga aggatgtact gtactttgca | |
104 1621 gaagtgaagt ttttctgtta ttaatatata attatgcaaa tgaatgcgac tatgttgaca | |
105 1681 atgtgtatat gtaaatataa tgtgttttac cagatgtttc atagagagaa ttttttcttg | |
106 1741 atctgttttg ttctctatac tttgcttgtg tatatttgtc agaggtgttt ctagtgtaag | |
107 1801 atttaagcct gccattttac cagcattatt gtagtttaat gattgaatgt agacagggat | |
108 1861 atgcgtatag ttttcagtat tagttctaga taacactaaa ttaactactg ttaggttggg | |
109 1921 tatggtgggg tcagtgacct aaaatggagt gaggccaaag cactgtcatg tcagtcttac | |
110 1981 ttcctgctta gggcacagtg aagtaggaaa caatattttg aaaataagtt ttaaaattta | |
111 2041 aaatgatcaa aaagcaatat agttgcataa aagcactgta aaatatttaa aaaggttaaa | |
112 2101 actgtggaaa attatattgg taagtttaca gatcaataaa agcacctgtt ctccatctga | |
113 2161 actagacaat ggaaataatg ctgcatgctg gccatggccc attcttcacc atttgtaagt | |
114 2221 tcaacaaaag ttctcacatg gagtcccacc tctaactgag gtttgtacat ttgtttttaa | |
115 2281 gcactgaaat cactactgat cccatcgcct ggccagtaga acagtcatta ctccattaac | |
116 2341 attctcactg tttagacaca taactgtggt acagtgtatt ggaaatttta tatacaaaaa | |
117 2401 gtgaaagtgc caacaaatta ttgatagctg ataatgtttc attatctgca actgcttgat | |
118 2461 aagtatgttg cattttaaga gcttataatt gtgtataatt tgttaacact agaaacctat | |
119 2521 tagtattgtg aatgtagatt ttactgtgaa gctatctgtg atttagctgt ttgctcccat | |
120 2581 gaaggagtct ttgcagcatg gcgctagcag ccaatgcagt ttctaatact cagtaatttg | |
121 2641 catgttttgt ggagcatttt tatgtcacca accagacagt atttcctgca tgcttattta | |
122 2701 gaagaggcag ttttccttga gaggtagtgg tctacctttg ccaggctttt tgacaggtca | |
123 2761 tttcagagta agcctttgtt cccaagaccc aacaactgtc accctcttct gtacctctcc | |
124 2821 tgagtgccaa ctgcccaggc cattgaccca ccatctgtta acctctgagt ttgcccgctc | |
125 2881 aaggccactc ataggggcat ccataaccaa gcacctcctc atgctgtgca tgcagtctta | |
126 2941 aattcaatgg acaaaaataa aatgctggct acctctggat catctggctg agcaactgaa | |
127 3001 tttcaaaaga gaattacttc catctcaact tcaacccatt gattacgtcc atcctagcaa | |
128 3061 gctaaatggc atcccagctg ctcctttctg tgcaaccaat taaagaacaa tgagtgtgat | |
129 3121 gctccatgtc tgaatttcgt ccagcctctc tctgaactgt gatctttgtc ctcatgaact | |
130 3181 ttcccttttg ttcattgaac tatatggact cttcatttca tattgattta ctgtgcaatt | |
131 3241 tacttttgga cattgagaac ttgaaataat tccctgatcc cttccccctt cactattaat | |
132 3301 aactcatttc tgtcaaactg taagagtaga ctcatttttt ttagttttta acattggatt | |
133 3361 gttatttcat ttagagttct ctatctctaa atatttaatt tagagaatga ttaaaaaggg | |
134 3421 aatgatatgc ttgtttaaaa tgaaagagaa aagctgtagt aaactgtgtt acttggtaat | |
135 3481 gactatttat cgtcgatact ctgtagctgt gtaagttttg acaaatagtg tatctcgtga | |
136 3541 aatcagtggt tagcattgcc gctattatat ttactcattt tatcattata aatgtgctta | |
137 3601 gttcatcatg tag | |
138 // | |
139 | |
140 LOCUS NM_001199712 3685 bp mRNA linear VRT 27-JAN-2017 | |
141 DEFINITION Gallus gallus uncharacterized LOC423300 (NOVA1), transcript variant | |
142 1, mRNA. | |
143 ACCESSION NM_001199712 XM_001232692 XM_001232710 XM_421219 | |
144 VERSION NM_001199712.1 | |
145 KEYWORDS RefSeq. | |
146 SOURCE Gallus gallus (chicken) | |
147 ORGANISM Gallus gallus | |
148 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
149 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
150 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
151 Phasianidae; Phasianinae; Gallus. | |
152 REFERENCE 1 (bases 1 to 3685) | |
153 AUTHORS Savolainen P, Fitzsimmons C, Arvestad L, Andersson L and Lundeberg | |
154 J. | |
155 TITLE ESTs from brain and testis of White Leghorn and red junglefowl: | |
156 annotation, bioinformatic classification of unknown transcripts and | |
157 analysis of expression levels | |
158 JOURNAL Cytogenet. Genome Res. 111 (1), 79-87 (2005) | |
159 PUBMED 16093725 | |
160 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
161 preliminary review. The reference sequence was derived from | |
162 DN851166.1, CN222734.1 and AADN04000014.1. | |
163 On or before Dec 12, 2010 this sequence version replaced | |
164 gi:118091782, gi:118091783, gi:118091785. | |
165 | |
166 Transcript Variant: This variant (1) represents the longer | |
167 transcript and encodes the longer isoform (1). | |
168 | |
169 Sequence Note: This RefSeq record was created from transcript and | |
170 genomic sequence data to make the sequence consistent with the | |
171 reference genome assembly. The genomic coordinates used for the | |
172 transcript record were based on transcript alignments. | |
173 | |
174 ##Evidence-Data-START## | |
175 Transcript exon combination :: CN222734.1 [ECO:0000332] | |
176 RNAseq introns :: mixed/partial sample support | |
177 SAMEA2201357, SAMEA2201358 | |
178 [ECO:0000350] | |
179 ##Evidence-Data-END## | |
180 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
181 1-122 DN851166.1 226-347 | |
182 123-749 CN222734.1 47-673 | |
183 750-3685 AADN04000014.1 5941293-5944228 c | |
184 FEATURES Location/Qualifiers | |
185 source 1..3685 | |
186 /organism="Gallus gallus" | |
187 /mol_type="mRNA" | |
188 /db_xref="taxon:9031" | |
189 /chromosome="5" | |
190 /map="5" | |
191 /breed="Leghorn" | |
192 gene 1..3685 | |
193 /gene="NOVA1" | |
194 /note="uncharacterized LOC423300" | |
195 /db_xref="CGNC:7484" | |
196 /db_xref="GeneID:423300" | |
197 CDS 95..1618 | |
198 /gene="NOVA1" | |
199 /note="isoform 1 is encoded by transcript variant 1; | |
200 RNA-binding protein Nova-1; neuro-oncological ventral | |
201 antigen 1; NOVA alternative splicing regulator 1" | |
202 /codon_start=1 | |
203 /product="RNA-binding protein Nova-1 isoform 1" | |
204 /protein_id="NP_001186641.1" | |
205 /db_xref="CGNC:7484" | |
206 /db_xref="GeneID:423300" | |
207 /translation="MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNT | |
208 GEDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLI | |
209 QGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKS | |
210 SPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQLSQKPDGINLQE | |
211 RVVTVSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTA | |
212 EVLPTAAAAAGLLGHANLAGVAAFPAVLSGFTGNDLVAITSALNTLASYGYNLNTLGL | |
213 GLSQAAATGALAAAAASANPAAAAANLLATYASEASASGSTAGGTAGTFALGSLAAAT | |
214 AATNGYFGAASPLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQEL | |
215 TGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG" | |
216 ORIGIN | |
217 1 cccttcctct tccttcctcc tcctcctccc ccttccctcc ctgccccccc aacaccgaag | |
218 61 ggaagagaca attctcctcc gagcagcagc aaacatgatg gcggcagctc ccatccagca | |
219 121 gaacgggact cacaccgggg ttcccataga cctggacccg ccggactccc ggaaaagacc | |
220 181 gctggaagcc ccccccgaag cgggcagcac caagaggacc aacacgggcg aggatggcca | |
221 241 atattttcta aaggtcctca tacctagtta tgctgctgga tctataattg ggaagggagg | |
222 301 acagacaatt gttcagttgc agaaagagac cggggccacc atcaagctgt ctaaatccaa | |
223 361 agatttttac ccaggtacta cggagcgcgt gtgtctgatc cagggaacag ttgaagcact | |
224 421 aaatgcagtt catggcttca ttgcagagaa gattcgagaa atgcctcaaa atgtggccaa | |
225 481 gacagagcct gtcagcatcc tacaacctca gaccactgtt aatccagacc gcatcaaaca | |
226 541 aacattgcca tcttccccaa ctaccaccaa gtcctctcca tctgatccca tgaccacctc | |
227 601 cagagccaat caggtaaaga ttatagttcc caacagcaca gcaggtctga taatagggaa | |
228 661 gggaggtgct acagtgaagg ctataatgga gcagtcaggg gcttgggtgc agctttccca | |
229 721 gaaacctgat gggatcaact tgcaagagag ggttgtcact gtgagtggag aacctgaaca | |
230 781 aaaccgaaaa gctgtcgaac ttatcatcca gaagatacaa gaggatccac agagtggcag | |
231 841 ctgtctcaat atcagttatg ccaatgtcac aggtccagtg gccaattcca atccaaccgg | |
232 901 atctccttat gcaaacactg ctgaagtgtt accaactgct gcagctgctg cagggctatt | |
233 961 aggacatgct aaccttgctg gagtggcagc ctttccagca gttttatctg gctttacagg | |
234 1021 caatgacctg gtggccatca cctctgcact taatacatta gccagctatg gatataatct | |
235 1081 caatacatta ggtttaggcc taagtcaggc agcagctaca ggggctttgg ctgcagcagc | |
236 1141 tgccagtgcc aacccagcag cagcagcagc caacttgttg gccacctatg cgagtgaagc | |
237 1201 ctcagccagt ggcagcactg ctggtggtac ggcggggaca tttgcattag gtagcctggc | |
238 1261 tgctgctact gctgcaacca atggatattt tggagctgct tctcccctag ctgccagtgc | |
239 1321 catcctagga acagaaaaat ccacagatgg atcaaaggat gtagttgaaa tagcagtgcc | |
240 1381 agaaaactta gttggtgcaa tacttggaaa aggagggaaa acattagttg aataccagga | |
241 1441 gttgactggt gcaaggatac agatctctaa aaagggagaa ttcgtacctg gcacaagaaa | |
242 1501 tcgcaaggta accattactg gaacaccagc tgcaacccag gccgcacagt atttaattac | |
243 1561 acaacggatc acatatgagc aaggagttcg ggctgccaat ccacagaaag tgggttgaga | |
244 1621 gcccctgtta aacatgagat tgttttaacc cctccttacc ctattttcaa gaaggatgta | |
245 1681 ctgtactttg cagaagtgaa gtttttctgt tattaatata taattatgca aatgaatgcg | |
246 1741 actatgttga caatgtgtat atgtaaatat aatgtgtttt accagatgtt tcatagagag | |
247 1801 aattttttct tgatctgttt tgttctctat actttgcttg tgtatatttg tcagaggtgt | |
248 1861 ttctagtgta agatttaagc ctgccatttt accagcatta ttgtagttta atgattgaat | |
249 1921 gtagacaggg atatgcgtat agttttcagt attagttcta gataacacta aattaactac | |
250 1981 tgttaggttg ggtatggtgg ggtcagtgac ctaaaatgga gtgaggccaa agcactgtca | |
251 2041 tgtcagtctt acttcctgct tagggcacag tgaagtagga aacaatattt tgaaaataag | |
252 2101 ttttaaaatt taaaatgatc aaaaagcaat atagttgcat aaaagcactg taaaatattt | |
253 2161 aaaaaggtta aaactgtgga aaattatatt ggtaagttta cagatcaata aaagcacctg | |
254 2221 ttctccatct gaactagaca atggaaataa tgctgcatgc tggccatggc ccattcttca | |
255 2281 ccatttgtaa gttcaacaaa agttctcaca tggagtccca cctctaactg aggtttgtac | |
256 2341 atttgttttt aagcactgaa atcactactg atcccatcgc ctggccagta gaacagtcat | |
257 2401 tactccatta acattctcac tgtttagaca cataactgtg gtacagtgta ttggaaattt | |
258 2461 tatatacaaa aagtgaaagt gccaacaaat tattgatagc tgataatgtt tcattatctg | |
259 2521 caactgcttg ataagtatgt tgcattttaa gagcttataa ttgtgtataa tttgttaaca | |
260 2581 ctagaaacct attagtattg tgaatgtaga ttttactgtg aagctatctg tgatttagct | |
261 2641 gtttgctccc atgaaggagt ctttgcagca tggcgctagc agccaatgca gtttctaata | |
262 2701 ctcagtaatt tgcatgtttt gtggagcatt tttatgtcac caaccagaca gtatttcctg | |
263 2761 catgcttatt tagaagaggc agttttcctt gagaggtagt ggtctacctt tgccaggctt | |
264 2821 tttgacaggt catttcagag taagcctttg ttcccaagac ccaacaactg tcaccctctt | |
265 2881 ctgtacctct cctgagtgcc aactgcccag gccattgacc caccatctgt taacctctga | |
266 2941 gtttgcccgc tcaaggccac tcataggggc atccataacc aagcacctcc tcatgctgtg | |
267 3001 catgcagtct taaattcaat ggacaaaaat aaaatgctgg ctacctctgg atcatctggc | |
268 3061 tgagcaactg aatttcaaaa gagaattact tccatctcaa cttcaaccca ttgattacgt | |
269 3121 ccatcctagc aagctaaatg gcatcccagc tgctcctttc tgtgcaacca attaaagaac | |
270 3181 aatgagtgtg atgctccatg tctgaatttc gtccagcctc tctctgaact gtgatctttg | |
271 3241 tcctcatgaa ctttcccttt tgttcattga actatatgga ctcttcattt catattgatt | |
272 3301 tactgtgcaa tttacttttg gacattgaga acttgaaata attccctgat cccttccccc | |
273 3361 ttcactatta ataactcatt tctgtcaaac tgtaagagta gactcatttt ttttagtttt | |
274 3421 taacattgga ttgttatttc atttagagtt ctctatctct aaatatttaa tttagagaat | |
275 3481 gattaaaaag ggaatgatat gcttgtttaa aatgaaagag aaaagctgta gtaaactgtg | |
276 3541 ttacttggta atgactattt atcgtcgata ctctgtagct gtgtaagttt tgacaaatag | |
277 3601 tgtatctcgt gaaatcagtg gttagcattg ccgctattat atttactcat tttatcatta | |
278 3661 taaatgtgct tagttcatca tgtag | |
279 // | |
280 | |
281 LOCUS NM_001030697 4759 bp mRNA linear VRT 24-JAN-2017 | |
282 DEFINITION Gallus gallus phosphoinositide-3-kinase regulatory subunit 5 | |
283 (PIK3R5), mRNA. | |
284 ACCESSION NM_001030697 XM_415588 | |
285 VERSION NM_001030697.1 | |
286 KEYWORDS RefSeq. | |
287 SOURCE Gallus gallus (chicken) | |
288 ORGANISM Gallus gallus | |
289 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
290 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
291 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
292 Phasianidae; Phasianinae; Gallus. | |
293 REFERENCE 1 (bases 1 to 4759) | |
294 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
295 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
296 P, Hayashizaki Y and Buerstedde JM. | |
297 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
298 gene function analysis | |
299 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
300 PUBMED 15642098 | |
301 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
302 NCBI review. The reference sequence was derived from AJ720866.1. | |
303 On Aug 8, 2005 this sequence version replaced gi:50757638. | |
304 | |
305 ##Evidence-Data-START## | |
306 Transcript exon combination :: AJ720866.1 [ECO:0000332] | |
307 RNAseq introns :: mixed/partial sample support | |
308 SAMEA2201357, SAMEA2201358 | |
309 [ECO:0000350] | |
310 ##Evidence-Data-END## | |
311 FEATURES Location/Qualifiers | |
312 source 1..4759 | |
313 /organism="Gallus gallus" | |
314 /mol_type="mRNA" | |
315 /db_xref="taxon:9031" | |
316 /chromosome="18" | |
317 /map="18" | |
318 /breed="Leghorn" | |
319 gene 1..4759 | |
320 /gene="PIK3R5" | |
321 /note="phosphoinositide-3-kinase regulatory subunit 5" | |
322 /db_xref="CGNC:14629" | |
323 /db_xref="GeneID:417319" | |
324 misc_feature 91..93 | |
325 /gene="PIK3R5" | |
326 /note="upstream in-frame stop codon" | |
327 CDS 100..2745 | |
328 /gene="PIK3R5" | |
329 /note="PI3-kinase regulatory subunit 5; | |
330 phosphoinositide-3-kinase, regulatory subunit 5, p101" | |
331 /codon_start=1 | |
332 /product="phosphoinositide 3-kinase regulatory subunit 5" | |
333 /protein_id="NP_001025868.1" | |
334 /db_xref="CGNC:14629" | |
335 /db_xref="GeneID:417319" | |
336 /translation="MQHTTCTEDRIYHALERCLHGLSRDAVSSRWAAGLCLNCWSLQE | |
337 LVSRDAGNYLILVEKILGKAREVQEKCDYDLVMPLALLFYYAVLYAPHIPPDSELLLK | |
338 AASIYHSFLTWPVPYCDVFRELLTFISDELKAPGISFQRLVRTEQGLPVKNYQSSTVT | |
339 VLLLNRSEVQSEFLSIAEKLSSTEPPRHATLVLLLEHLYQVTFGTRCDLGSLHHLLKA | |
340 KTLEELSEIYTSAAEAQEIAAASSDPVLARERLQSALRDIAGAAALPTIAGDAQPRRL | |
341 QPIPIPTSRCYTYSWDQDNFDVLNDVLSKECSVVEPVASENEEDEEEEEEDVETDGCS | |
342 PERDSLLSPISSISKDSVYSALSEDGPKHSCVSLFSSSKDSISELTVVSKKSLRSFVS | |
343 SLKDCMDSGYAEDSDESSLDTLGRPELKVEKTHHKYRHTLTNKIYKLFKSKSQLVLRR | |
344 DLKDCVDTGSLPLRRAESLCHPQAKPRIPARSRRAHSLPQHGLGQKLQTPQTPQLLSL | |
345 PRRPFLSYDEDAKVATMRVVVFGSDRISGKVARAYSNLRLKESTCPTLTRYFKLQFFY | |
346 VPVKRSCLLPAALLMHPPPSPSDLQLRALAQAEPTLAGAESSTNDISHYIGMLDPWYE | |
347 RNVLGLMNLPMDVLCQSAKPEAEPQEDSREQLPILADMILYYCRFATRPVLLQLYQTE | |
348 LTFIGGEKMTEVFIHSLELGHSAATRAIKASGPGSKRLGIDGDREAIPLTLQIAYSKT | |
349 AISGRSQWNDVEKVCTSVNLSKACKKYEELASKTECLNLTMTEVVKRQNSKSKKSFNQ | |
350 LSVSQIKVDKVQIIGVQSSFAVCLDQDEQKILQSVTRCEISVCYRPRDSDPLALRRSS | |
351 LTPQDPSEFHSLLCLPISTFSGALP" | |
352 misc_feature 166..396 | |
353 /gene="PIK3R5" | |
354 /experiment="experimental evidence, no additional details | |
355 recorded" | |
356 /note="propagated from UniProtKB/Swiss-Prot (Q5ZIB8.1); | |
357 Region: Heterodimerization. {ECO:0000250}" | |
358 misc_feature 2068..2370 | |
359 /gene="PIK3R5" | |
360 /experiment="experimental evidence, no additional details | |
361 recorded" | |
362 /note="propagated from UniProtKB/Swiss-Prot (Q5ZIB8.1); | |
363 Region: Interaction with G beta gamma proteins. | |
364 {ECO:0000250}" | |
365 ORIGIN | |
366 1 gccgcccggc ggggagcggc gcggagcgga gcccggcggg gcgcggcgag gatgggcagg | |
367 61 gggccccggc ggctgccgcc ctccaggaga tgaattaaaa tgcagcacac cacgtgcaca | |
368 121 gaggacagga tctatcatgc actggagaga tgtctgcacg ggcttagcag agatgctgtc | |
369 181 tccagcagat gggctgcagg gctgtgcctg aactgctgga gcctgcagga gctggtgagc | |
370 241 agggatgcag gtaactacct catcctggtg gagaaaatcc tcggcaaggc cagggaggtg | |
371 301 caggagaagt gtgactacga cctggtgatg cccctggccc tgcttttcta ctacgcggtc | |
372 361 ctctatgctc cccacatccc accagactcc gagctgctcc tgaaagctgc cagcatctac | |
373 421 cacagcttcc tcacctggcc cgtgccctac tgcgacgtct tccgtgagct gctcaccttc | |
374 481 atcagtgatg agctcaaggc gccagggatt tccttccaga ggttggtgag gacggagcag | |
375 541 gggctgcctg tgaagaacta ccagagctcc actgtgacgg tgctgctgct gaaccgctcc | |
376 601 gaggtgcaga gtgagttcct ctccatcgca gagaagctga gcagcactga gcccccccgg | |
377 661 cacgccacgc tcgtcctgct gctggagcac ctctaccagg tcaccttcgg cacccgctgc | |
378 721 gacctgggca gcctgcacca cctcctgaag gccaagacac tggaagagct ctctgagatc | |
379 781 tacaccagcg ctgctgaagc gcaggagatc gcagccgcca gcagtgaccc tgtgttggcc | |
380 841 cgggagcggc tgcagagcgc tctgcgggac attgccgggg cagcagcact tcctaccatt | |
381 901 gcaggagatg cgcagccccg caggctgcag cccatcccca tccctacttc gcgctgctac | |
382 961 acctacagct gggaccagga taactttgat gtcctcaatg atgtcctcag caaggagtgc | |
383 1021 agtgttgttg agcctgtggc ctcagagaat gaggaggacg aggaagagga ggaggaggat | |
384 1081 gtggaaacag acggctgttc cccagagagg gactcgctgc tgtcccccat ctcctccatt | |
385 1141 tccaaggact ccgtgtactc agcgctgtca gaggatggac ccaagcactc ctgcgtgtcc | |
386 1201 ctcttcagca gctccaagga ctccatctca gagctgacgg tggtctccaa gaagtccttg | |
387 1261 aggtcttttg tctccagcct gaaggactgc atggacagcg ggtacgcaga ggacagcgac | |
388 1321 gagagctccc tggacacgct tgggcggccg gagctgaagg tggagaagac ccaccacaaa | |
389 1381 tacagacaca cgctgaccaa caagatctac aagctcttca agagcaaaag ccagctggtc | |
390 1441 ctgaggagag acctgaagga ctgtgtggat acaggctcgc tcccactgcg ccgtgctgag | |
391 1501 agcctgtgcc acccccaggc caagccccgc atcccggcac gctcccggcg cgctcactca | |
392 1561 ttgccacagc acgggctggg ccagaagctg cagaccccgc agaccccgca gctgctcagc | |
393 1621 ctgccccgcc ggcccttcct cagctacgac gaggatgcca aagtggccac catgcgcgtg | |
394 1681 gtggtcttcg gctccgaccg catctcaggg aaagtagccc gagcctacag caacctgagg | |
395 1741 ctgaaggaga gcacctgccc tacactgaca aggtacttca agctgcagtt tttctacgtc | |
396 1801 cccgtgaaga ggagctgcct gctgccagca gccctgctga tgcatcctcc tccatcccca | |
397 1861 agcgacctgc agctccgcgc cttggcacag gcggagccca ccttggctgg ggcggagagc | |
398 1921 agcaccaatg acatctccca ctacatcggc atgttggacc catggtacga gcggaacgtt | |
399 1981 ctggggctga tgaacctgcc catggatgtc ctgtgtcagt ctgccaagcc tgaggctgag | |
400 2041 ccccaggagg actcccggga gcagctgccc atcctggccg acatgatcct ctactactgc | |
401 2101 cgctttgcca cacgccccgt cctgctgcag ctctaccaga ccgagctcac cttcataggg | |
402 2161 ggggagaaga tgaccgaagt cttcatccac tccctggagc tgggccactc ggcggccacg | |
403 2221 cgggccatca aggcgtcagg tccgggcagc aaaaggctgg gcatagatgg agacagagaa | |
404 2281 gcaatcccac taacactaca gatcgcctac agcaagacag ccatcagtgg aaggagtcag | |
405 2341 tggaacgatg ttgagaaggt ctgcacatct gttaacctca gcaaagcctg caagaagtac | |
406 2401 gaagagctgg cctcgaagac agagtgtctc aacttgacca tgacagaggt ggttaaaagg | |
407 2461 caaaactcca aatccaaaaa aagtttcaat cagctcagtg tgtcccagat caaggtagac | |
408 2521 aaagtccaga ttattggtgt ccagtcctcc tttgccgtgt gcctggatca ggatgagcag | |
409 2581 aagatcctgc agagtgtaac caggtgtgag atctccgtgt gctacagacc cagggacagc | |
410 2641 gatccccttg cactgagaag gtcctctttg actccccagg acccctccga gtttcattct | |
411 2701 ctcctgtgtt tacccatttc caccttcagt ggagcactgc catagaagaa ccctgtgccc | |
412 2761 tcatcggacc aggcatgcat tcaacgccaa aatgaagctg tcctgctgga ggccagccac | |
413 2821 gcttgtccaa gacatcctgt gatctgaagc catagtgtgg tgattgaact gctcctgttg | |
414 2881 tgagcttagc ccgtccttgg ggaatgctgt tagtgtcagg ctctggtaca gctcaagatt | |
415 2941 ccctgggagg aaagtgagat ctccacctgg ttcagtaggc tgccaacacc taactgagag | |
416 3001 gacaaggcaa agacagcgac gttttcctgc cagcaaatgg tgctgtggcc gtacttagtg | |
417 3061 actgcaaagc ccatgtgatg ctggggagaa tgcattctgg aaagtgaatg tctttggctg | |
418 3121 agtggtggca ggtggagctg aaaaccaccc aaccaatgtt ctgatgacat ttcacttgca | |
419 3181 agaagccagg gatgctgggg atggttctct ggggataggg acaggctttc tcaggatttg | |
420 3241 ctttaaatta tgagagatgg gtgtcttgca gagaaacagc acaatgcaga atgacccaac | |
421 3301 tggggcccag aaagagccca gcatgagtta cagactgctc tttgtgttcc agtgaatcca | |
422 3361 gtgcaatagg ccataccagg gcatgggcag ctcatcacac gtatgtgttg gctgtaaatg | |
423 3421 caggacctgc aggagataac cttccacttc ctgcagagtt tcagggttca tccaggaggg | |
424 3481 agatggagtt gctgttcagc tggtgttctt gcatcctgct caccagtgca cgagtgctag | |
425 3541 agacatccca gaggctgaat gctcaatagt tgcttgagat agagcaggaa ccatgctcac | |
426 3601 actcagagga gggagggaag tactgggtaa agtgctagca ttgccttgcc tcacctcagg | |
427 3661 gtgtggcttt ggtagagaag gacccagcag caataacact agtgatgctt gcaggcaatg | |
428 3721 atagattctg agatcccctt tccactgcaa agagaggttc cccccccgac tctttcttct | |
429 3781 ctctgtgagg ccttaggtac agaaatctgc aatagttggg agcttttaga agtattttga | |
430 3841 cctcaggaac aataagtgag gctggaagtg ccttgcttgg tttcacagcc ctcaggttgt | |
431 3901 ttctcattag ctggtggttg cactaacgat agctggcaga agagcacgct gcctgttgca | |
432 3961 ggctaggagt atgccaacac caaggatgtg ctccctggga tgcatctgga agggacctcc | |
433 4021 atcctgcagg gctcggccac ggtgagctca gctccatctg aatccatggg tcctccagca | |
434 4081 gatggggctt gggcagcttt ggcactcatt ggagtgagac tgggctccgt cccaagggct | |
435 4141 gcgggcacag cagctgtgtt ccccttggtg gtgacattgg aggaagcact tcagcatttt | |
436 4201 aagtccagca ggctccaagg accgggagca gattttcaac gagttttccc attgactttt | |
437 4261 cacatttccc agacaggttt gtgtgcgtcg tctcaaatgg ggctgaaatt tgacagctgt | |
438 4321 tttttttttt ttctctttag ttgttgttcg atccattaaa atagcacctt atcctgtcaa | |
439 4381 aacagtgcta tttgtgatcc ctgtatccgt ggctaaatat atccctgccg ctgtcggggg | |
440 4441 cgcaaagctc tttggtctca gctggcccca tagaactgca ggagaagagt ttccatgctg | |
441 4501 gggaggaaaa acaagcacac cctctgggga ctcgtaatcc tggctcattt tctgacctct | |
442 4561 gatgctttct ggaaatgaaa agaaggaagt ggaaggttcc ttcaggccgt ccttgtacat | |
443 4621 atgtgcagcc ttaccaaacc tgtgtcacgt ctgtgctgat ctgtaaaata gcattcaaag | |
444 4681 gactttttat gtcactgcga ggtattaaag gaggatttat ttcgagtaaa aaaaaaaaaa | |
445 4741 aagaaaaaaa aaaaaaaaa | |
446 // | |
447 | |
448 LOCUS NM_001277797 2943 bp mRNA linear VRT 16-JAN-2017 | |
449 DEFINITION Gallus gallus family with sequence similarity 179 member A | |
450 (FAM179A), mRNA. | |
451 ACCESSION NM_001277797 XR_140068 | |
452 VERSION NM_001277797.1 | |
453 KEYWORDS RefSeq. | |
454 SOURCE Gallus gallus (chicken) | |
455 ORGANISM Gallus gallus | |
456 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
457 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
458 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
459 Phasianidae; Phasianinae; Gallus. | |
460 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
461 NCBI review. The reference sequence was derived from | |
462 AADN04000127.1. | |
463 On Apr 20, 2013 this sequence version replaced gi:363731307. | |
464 | |
465 Sequence Note: The RefSeq transcript and protein were derived from | |
466 genomic sequence to make the sequence consistent with the reference | |
467 genome assembly. The genomic coordinates used for the transcript | |
468 record were based on alignments. | |
469 | |
470 ##Evidence-Data-START## | |
471 RNAseq introns :: single sample supports all introns SAMEA2201368, | |
472 SAMEA2201377 [ECO:0000348] | |
473 ##Evidence-Data-END## | |
474 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
475 1-28 AADN04000127.1 3133910-3133937 | |
476 29-163 AADN04000127.1 3134765-3134899 | |
477 164-358 AADN04000127.1 3135468-3135662 | |
478 359-582 AADN04000127.1 3135946-3136169 | |
479 583-755 AADN04000127.1 3137685-3137857 | |
480 756-802 AADN04000127.1 3139096-3139142 | |
481 803-993 AADN04000127.1 3140932-3141122 | |
482 994-1153 AADN04000127.1 3141956-3142115 | |
483 1154-1318 AADN04000127.1 3143062-3143226 | |
484 1319-1460 AADN04000127.1 3145135-3145276 | |
485 1461-1566 AADN04000127.1 3146497-3146602 | |
486 1567-1802 AADN04000127.1 3148273-3148508 | |
487 1803-1961 AADN04000127.1 3149677-3149835 | |
488 1962-2079 AADN04000127.1 3150800-3150917 | |
489 2080-2183 AADN04000127.1 3151823-3151926 | |
490 2184-2382 AADN04000127.1 3153262-3153460 | |
491 2383-2599 AADN04000127.1 3154431-3154647 | |
492 2600-2686 AADN04000127.1 3159686-3159772 | |
493 2687-2943 AADN04000127.1 3162103-3162359 | |
494 FEATURES Location/Qualifiers | |
495 source 1..2943 | |
496 /organism="Gallus gallus" | |
497 /mol_type="mRNA" | |
498 /db_xref="taxon:9031" | |
499 /chromosome="3" | |
500 /map="3" | |
501 /breed="Red Jungle Fowl" | |
502 gene 1..2943 | |
503 /gene="FAM179A" | |
504 /note="family with sequence similarity 179 member A" | |
505 /db_xref="CGNC:51462" | |
506 /db_xref="GeneID:421296" | |
507 CDS 1..2943 | |
508 /gene="FAM179A" | |
509 /codon_start=1 | |
510 /product="crescerin-2" | |
511 /protein_id="NP_001264726.1" | |
512 /db_xref="CGNC:51462" | |
513 /db_xref="GeneID:421296" | |
514 /translation="MATEDNFAAAKYDAPVAVYCGSVPKVKPRCRALRGGSIDSNLQL | |
515 CGSRWITEEGGAISSLEGWGSKACVQDLDAGARGDLSPLPHPQEREVSSAALETAQIK | |
516 DKLKKRRMSEGLLAPLRGLTESSDLKGVALKPAISRSASQRLLVTSKPVPPIQNSLPP | |
517 PEPSWMSNGEQELREDGTTDHGGSEGNHKELTSEASLQPLYCGDEERKKSLGVALIPP | |
518 IPKSARPSDGDPGSTEIPLPSSQQLISQEPLEMRPRSGSRTEEKTPASLELRTLEPIL | |
519 PIPQHRVACSMKSVRHVYEPVPPLADLPLSQAKETDHLSSPCLLKDDDWKDSNGRIHI | |
520 TISKSAQEKMRQKQTREMELLLREREKERAKEKSLQFSTWSADPGGVAGEDFGSPHIN | |
521 GALSISSSTSNACRSSIGATLRKRVNRPSLPSIPVISQDTSFPRHSSANSLPAIALGC | |
522 PEWGEEPECGDAGETRPFSHPEQGLLDALAWLNSSDWQLKGKGLFSIRRLAICHSEIL | |
523 LSRLHDVTLAVTKEVNNLRSKVSRFAINTLGELFRIMKKHMDQEVEEVARALLQKTGD | |
524 SSEFIQKAADRSLGIMVGSVTPARAMAALLAGGVNHRNVLVRRYTAEHLLTVMEQIGA | |
525 EKLLSGTRDSVELLVHMLVKLAQDCNQDTRFYGRKMLNILMSHPKFDGHLKQFLPSRD | |
526 LQVVMATIKQKGVEDHMPEPPSAKGRRESRNSGLMMSQENLPSHEGSSSDVLLLPHQT | |
527 VRRTSLRTVEEIEQLKELNNLLSAKEFQTRIEGVMLLLDHCKSNPQLISANIVQIFDV | |
528 FVLRLQDSNKKVKQQSLEALASVIPILRDTLHPVLVSLVAAVTDNLNSKHTGIYAAAV | |
529 KVLEASIAHLDNALLLQALAHRVRFLSGRAMQDVTEHLSVLVASVYPRKAHVVERYAL | |
530 PVLWFFLSNMIGNGVLPGRSSNVRAAVTKLAKSLHQEMGSSLKELAASQPPHVAKHLW | |
531 HVLDLDGQ" | |
532 ORIGIN | |
533 1 atggcaacag aagataattt tgcagcagct aagtatgatg ctccagttgc tgtctactgt | |
534 61 gggagcgtcc caaaagtcaa acccagatgc agagctctgc ggggtggaag cattgattca | |
535 121 aacttgcagc tttgtggcag cagatggatt actgaagaag gaggggccat ctcttccctg | |
536 181 gagggctggg gcagcaaggc ttgtgtgcag gacctcgatg ctggggctag aggtgatctc | |
537 241 tccccccttc ctcaccccca ggaaagggag gtgagcagtg ctgccctgga aactgctcag | |
538 301 atcaaggaca agctgaagaa gaggaggatg tctgagggcc tgttagcccc actgagaggc | |
539 361 ctgactgaaa gcagtgacct gaagggggtt gccctgaagc ctgcaatttc taggtcagcc | |
540 421 tcccagaggc tcctggtaac ctccaagcct gtgcccccca tccagaacag ccttcctccc | |
541 481 ccagagccca gctggatgag caacggggag caggagctca gggaggacgg aacaacagat | |
542 541 catggtggca gtgaaggcaa ccacaaagaa ctgacatcag aggcttcatt gcagcctctg | |
543 601 tactgtggtg acgaggaaag gaagaagtca ctgggggtgg ctttgattcc tcccatcccc | |
544 661 aagtcagcaa gaccatctga cggggatcct ggcagcactg aaattcctct tccaagctca | |
545 721 cagcagctga tttctcaaga gcccctggag atgaggccaa gatcaggcag caggacagaa | |
546 781 gagaagaccc ctgcgtctct ggaactccgg actctggaac ccatcttgcc tattccccag | |
547 841 catcgtgttg cctgtagcat gaagtctgtg aggcatgtgt atgaacccgt gcccccattg | |
548 901 gcagatctgc ccctcagcca ggccaaagag acggatcacc tttcaagtcc ttgccttctg | |
549 961 aaggacgatg actggaagga cagcaatgga aggatccata tcaccatatc caagtctgct | |
550 1021 caggagaaaa tgcgccagaa gcaaacaaga gagatggagc ttttgctcag agagagggag | |
551 1081 aaagagagag caaaggagaa gtcattgcag ttctccactt ggagcgctga ccctgggggt | |
552 1141 gtggctggag aagactttgg ctcaccgcac atcaatgggg cactctccat ctcctccagc | |
553 1201 accagcaatg cgtgcaggtc aagcattggt gccacgctga ggaagcgggt caacaggccc | |
554 1261 tccttgccca gcatccctgt catcagccag gacaccagct tcccacggca ctcttcagca | |
555 1321 aactcactgc cagccattgc tttgggctgc ccggaatggg gagaggagcc tgagtgtggg | |
556 1381 gatgccgggg aaaccagacc cttctctcat ccagagcagg ggctgctgga tgcacttgcg | |
557 1441 tggctcaaca gcagtgactg gcagctgaag gggaaaggac tcttcagcat cagacgcttg | |
558 1501 gccatctgcc attcggaaat cctcctcagt agacttcatg atgttacctt ggcagttacc | |
559 1561 aaagaggtga acaacctccg ctcgaaggtg tctcgctttg caatcaacac tcttggagag | |
560 1621 ctcttcagga tcatgaagaa acacatggac caggaggtag aggaggtcgc tcgggccttg | |
561 1681 ctgcagaaga cgggggactc cagcgagttc attcaaaaag cagctgatcg atccctgggg | |
562 1741 attatggtgg ggagtgtgac tcctgcaaga gcaatggctg ctctcctggc tggtggggtc | |
563 1801 aatcaccgca atgtcctggt gcggaggtac acagcagagc acctactgac tgtgatggag | |
564 1861 cagattggag ctgaaaagct cctgtcaggc acgcgtgaca gcgtcgagct tctcgttcac | |
565 1921 atgctggtca agcttgctca ggactgcaat caggatacaa ggttttatgg aaggaagatg | |
566 1981 ctgaatatat tgatgagtca tccaaaattt gatggacatt tgaaacaatt tctcccctcg | |
567 2041 cgtgacttgc aagttgttat ggcaacaatt aagcagaaag gggtagaaga ccatatgcct | |
568 2101 gaacctccat ctgccaaagg ccgcagggag tccaggaaca gtggtttgat gatgtcccag | |
569 2161 gaaaacttgc cttctcatga agggtccagc tctgatgtcc tcctcttacc ccatcagaca | |
570 2221 gttcggcgca catcgcttcg cactgtggaa gagattgaac aactcaaaga gcttaacaat | |
571 2281 ctcctgtcag caaaggagtt tcagacacga atagagggag tcatgctcct cctagatcac | |
572 2341 tgcaaaagca acccccagct catctcagcg aatattgtcc agatttttga tgtttttgtc | |
573 2401 ctgagacttc aggattccaa taagaaagtg aagcagcagt cactggaagc tctggcttca | |
574 2461 gttataccca ttctcagaga caccttacac ccagtgctgg tctctttggt agcagcagtc | |
575 2521 acagacaacc tgaactcaaa gcatacaggg atttatgctg cggctgtgaa ggtgttggaa | |
576 2581 gcatccattg ctcacctaga caacgcatta ctgctgcaag cgttggccca ccgcgtgcgt | |
577 2641 ttcctcagcg gccgagccat gcaggacgtc acggagcacc tctcagtgct tgtggcatct | |
578 2701 gtttatcccc ggaaagccca cgtggtcgaa cgctacgccc tgcccgtgct ctggttcttc | |
579 2761 ctgagcaaca tgatcggaaa tggtgtcctg cccgggcgaa gcagcaatgt cagggctgca | |
580 2821 gtcaccaagc ttgccaagag cctccaccaa gagatgggct ccagcctcaa ggagctcgct | |
581 2881 gccagccagc ctccgcacgt ggcaaaacac ctctggcacg ttttggacct ggatggtcag | |
582 2941 tga | |
583 // | |
584 | |
585 LOCUS NM_001184757 468 bp mRNA linear VRT 13-JAN-2017 | |
586 DEFINITION Gallus gallus phospholipase A2 group X (PLA2G10), mRNA. | |
587 ACCESSION NM_001184757 XM_414738 | |
588 VERSION NM_001184757.1 | |
589 KEYWORDS RefSeq. | |
590 SOURCE Gallus gallus (chicken) | |
591 ORGANISM Gallus gallus | |
592 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
593 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
594 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
595 Phasianidae; Phasianinae; Gallus. | |
596 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
597 NCBI review. The reference sequence was derived from GU474518.1. | |
598 On May 18, 2010 this sequence version replaced gi:118097684. | |
599 | |
600 ##Evidence-Data-START## | |
601 Transcript exon combination :: GU474518.1 [ECO:0000332] | |
602 RNAseq introns :: mixed/partial sample support | |
603 SAMEA2201357, SAMEA2201359 | |
604 [ECO:0000350] | |
605 ##Evidence-Data-END## | |
606 FEATURES Location/Qualifiers | |
607 source 1..468 | |
608 /organism="Gallus gallus" | |
609 /mol_type="mRNA" | |
610 /db_xref="taxon:9031" | |
611 /chromosome="14" | |
612 /map="14" | |
613 gene 1..468 | |
614 /gene="PLA2G10" | |
615 /note="phospholipase A2 group X" | |
616 /db_xref="CGNC:50254" | |
617 /db_xref="GeneID:416425" | |
618 CDS 1..468 | |
619 /gene="PLA2G10" | |
620 /EC_number="3.1.1.4" | |
621 /note="group 10 secretory phospholipase A2" | |
622 /codon_start=1 | |
623 /product="group 10 secretory phospholipase A2 precursor" | |
624 /protein_id="NP_001171686.1" | |
625 /db_xref="CGNC:50254" | |
626 /db_xref="GeneID:416425" | |
627 /translation="MKNPCQLPLVLLLLAAVYRGTLGEAHVRNRRGILELAGAIRCTT | |
628 GRSPFAYLRYGCYCGLGGRGWPKDRVDWCCFNHDCCYGKAEQAGCHPKIESYHWECED | |
629 NTAVCESLEDKCQKMACECDREAAKCFSKAPYHTKYLLWPDMMCGEVQPLCRY" | |
630 sig_peptide 1..69 | |
631 /gene="PLA2G10" | |
632 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
633 ORIGIN | |
634 1 atgaaaaatc cttgtcagct gccgctcgtg ctgctgctgc tcgccgccgt ttatagaggc | |
635 61 accttggggg aagctcatgt taggaaccga agaggaattc ttgaattagc tggagccatt | |
636 121 agatgcacta cagggcggtc tccttttgcc tacctacgtt acggatgcta ctgcggcctg | |
637 181 ggaggaaggg gatggcccaa ggacagagtg gactggtgct gctttaacca cgactgttgc | |
638 241 tatggtaagg cagagcaagc aggctgtcac cccaagatag aaagttacca ctgggaatgc | |
639 301 gaggacaaca ctgctgtatg tgaatcacta gaagacaaat gtcaaaaaat ggcatgtgaa | |
640 361 tgtgatcgtg aagctgccaa atgtttttct aaagctccct accataccaa gtacctcctg | |
641 421 tggccagata tgatgtgtgg tgaggttcaa cctttgtgta gatattaa | |
642 // | |
643 | |
644 LOCUS NM_205038 2046 bp mRNA linear VRT 13-JAN-2017 | |
645 DEFINITION Gallus gallus peripherin 2 (PRPH2), mRNA. | |
646 ACCESSION NM_205038 | |
647 VERSION NM_205038.1 | |
648 KEYWORDS RefSeq. | |
649 SOURCE Gallus gallus (chicken) | |
650 ORGANISM Gallus gallus | |
651 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
652 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
653 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
654 Phasianidae; Phasianinae; Gallus. | |
655 REFERENCE 1 (bases 1 to 2046) | |
656 AUTHORS Weng J, Belecky-Adams T, Adler R and Travis GH. | |
657 TITLE Identification of two rds/peripherin homologs in the chick retina | |
658 JOURNAL Invest. Ophthalmol. Vis. Sci. 39 (2), 440-443 (1998) | |
659 PUBMED 9478005 | |
660 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
661 NCBI review. The reference sequence was derived from AF031238.1. | |
662 | |
663 ##Evidence-Data-START## | |
664 Transcript exon combination :: AF031238.1 [ECO:0000332] | |
665 RNAseq introns :: mixed/partial sample support | |
666 SAMEA2201381, SAMEA2812695 | |
667 [ECO:0000350] | |
668 ##Evidence-Data-END## | |
669 FEATURES Location/Qualifiers | |
670 source 1..2046 | |
671 /organism="Gallus gallus" | |
672 /mol_type="mRNA" | |
673 /db_xref="taxon:9031" | |
674 /chromosome="3" | |
675 /map="3" | |
676 gene 1..2046 | |
677 /gene="PRPH2" | |
678 /gene_synonym="CRDS1; peripherin-2; RDS" | |
679 /note="peripherin 2" | |
680 /db_xref="CGNC:49540" | |
681 /db_xref="GeneID:395899" | |
682 misc_feature 182..184 | |
683 /gene="PRPH2" | |
684 /gene_synonym="CRDS1; peripherin-2; RDS" | |
685 /note="upstream in-frame stop codon" | |
686 CDS 272..1336 | |
687 /gene="PRPH2" | |
688 /gene_synonym="CRDS1; peripherin-2; RDS" | |
689 /note="retinal degeneration, slow; retinal degeneration | |
690 slow protein; photoreceptor outer segment membrane | |
691 glycoprotein 1; peripherin 2 (retinal degeneration, slow)" | |
692 /codon_start=1 | |
693 /product="peripherin-2" | |
694 /protein_id="NP_990369.1" | |
695 /db_xref="CGNC:49540" | |
696 /db_xref="GeneID:395899" | |
697 /translation="MALLKVKFNQKKRVKLAQGLWLMNWFSVFAGIIVFSMGLFLKIE | |
698 LRKRSEVMDNSESHFVPNSLILMGILSCAFNGFAGKICYDSLDPAKFAKWKPLLKPYL | |
699 ALCFFFNILLFFVALICFLMRGSLESTLAQGLKNSMKFYRDTDTPGRCFMKKTIDMLQ | |
700 IEFKCCGNNGFKDWFEIQWISNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPSS | |
701 PRPCIQYQVTNNSAHYSYDYQTEELNLWGRGCREALLHYYSSMMSSMGAVVLLVWLFE | |
702 MSVMVGLRLLHTSLESIANPEDPECESEGWILENSLKDTLKSALESLKKIGKFNQVEA | |
703 GAEGAEGEEAGKTPAITTVS" | |
704 misc_feature 344..400 | |
705 /gene="PRPH2" | |
706 /gene_synonym="CRDS1; peripherin-2; RDS" | |
707 /experiment="experimental evidence, no additional details | |
708 recorded" | |
709 /note="propagated from UniProtKB/Swiss-Prot (O42281.1); | |
710 transmembrane region" | |
711 misc_feature 455..511 | |
712 /gene="PRPH2" | |
713 /gene_synonym="CRDS1; peripherin-2; RDS" | |
714 /experiment="experimental evidence, no additional details | |
715 recorded" | |
716 /note="propagated from UniProtKB/Swiss-Prot (O42281.1); | |
717 transmembrane region" | |
718 misc_feature 569..640 | |
719 /gene="PRPH2" | |
720 /gene_synonym="CRDS1; peripherin-2; RDS" | |
721 /experiment="experimental evidence, no additional details | |
722 recorded" | |
723 /note="propagated from UniProtKB/Swiss-Prot (O42281.1); | |
724 transmembrane region" | |
725 misc_feature 1064..1141 | |
726 /gene="PRPH2" | |
727 /gene_synonym="CRDS1; peripherin-2; RDS" | |
728 /experiment="experimental evidence, no additional details | |
729 recorded" | |
730 /note="propagated from UniProtKB/Swiss-Prot (O42281.1); | |
731 transmembrane region" | |
732 ORIGIN | |
733 1 tcctttgctt ggaaggaacc accagaaata gttgtaggtg ctaattgccc actattctta | |
734 61 ctaatgtgaa tttgtgaatt tggacctttg aatatctact tgcttgaacc gaagcgtggg | |
735 121 gagctcaaga tggagggacc gtgcagcact tcgcttcggg ctgcatcagc cggagctttt | |
736 181 ctaaacgcct gaatggttct ttctcgaatc gcttacacgg agaagagggg ttcaggctgc | |
737 241 aaaagctttc agcgtctcac gtattgcgac gatggcactg ctgaaagtca aattcaacca | |
738 301 gaagaaacgg gtaaaactag cccaggggct atggctcatg aactggtttt cagtctttgc | |
739 361 tggaatcatc gtttttagca tggggttgtt cctcaagatt gagctccgga agcgaagcga | |
740 421 agtgatggac aattctgaaa gccattttgt gcccaattct ttgatattga tgggtatatt | |
741 481 atcctgcgcc ttcaatggtt ttgctggcaa aatttgttac gattctctgg atcccgctaa | |
742 541 atttgccaag tggaagcctt tgctgaaacc ttacctggca ctatgtttct tcttcaacat | |
743 601 actcctcttc tttgtcgctc tgatttgctt tctcatgcgg ggctccctgg agagcacgct | |
744 661 ggctcagggg ctgaagaaca gcatgaagtt ctaccgggac acagacaccc ctggaaggtg | |
745 721 cttcatgaag aagacaatcg acatgctcca aatcgagttc aagtgctgtg ggaacaatgg | |
746 781 cttcaaagac tggtttgaaa ttcagtggat cagcaacaga tacctggact tcagctccaa | |
747 841 agaagtgaaa gatcgaatca aaagcaacgt tgatggacgg tacctggttg atggtgtccc | |
748 901 cttcagctgc tgcaacccca gctccccgag gccctgcatc cagtaccagg tcaccaacaa | |
749 961 ctcggctcac tacagctacg actaccagac ggaggagctc aacctctggg gccgtggctg | |
750 1021 ccgggaagcc ctcctgcact actacagcag catgatgagc tccatgggtg ccgttgtcct | |
751 1081 ccttgtctgg ctttttgaga tgtctgtgat ggttggcttg cgtcttttgc acacctctct | |
752 1141 ggaaagcatc gcaaatcctg aagaccctga gtgtgaaagt gaagggtgga ttctagagaa | |
753 1201 cagcctgaaa gacactctga agtctgcgct ggagagcttg aaaaagattg gtaagttcaa | |
754 1261 tcaggtggaa gcaggtgccg aaggggctga aggagaagaa gctgggaaga ctccagccat | |
755 1321 cacaacagtc agttgagctt ctaaatgatg cgaactctga tcagaggaat gaaaaaactg | |
756 1381 aggattgtga atacctactt tttaaaagct acgtatcaac catcagaata cacgtttcta | |
757 1441 cacacgctat cttttttatt attattatac atgcatacgg aaggatacag catagcgcac | |
758 1501 cttgggataa tgcatttatc ctctcagtga gtacaccaga ttcataactt ctgggggaaa | |
759 1561 atgaccccac taggactttc aatacttacg tgttccctta ccagggactg ctagcattaa | |
760 1621 aaagaaatca tcataattgt tggcatcaca ctgatccgtt ccatcttatc ttgaaattaa | |
761 1681 aagtggaatt tgaaatgtta gtattttttc tcaagttggc ttgccatcat acttgatgta | |
762 1741 cgttaaccta caaagacaaa tgtcttggtt ttctggagag taacgtgtta aaagtcaaag | |
763 1801 gaagaataat ttccagaagt gtatataata acctagtgtt tcgacaaacc tctcatataa | |
764 1861 tgtgtttttt ttttttttgt tgatgtgcta agcagtggta tttcctgctg tattcttaag | |
765 1921 atgtacttaa tagaacaaaa caaaaagtta ttctgagaac ttcagtacta aacaaaaatt | |
766 1981 gtaacttaag aacagagcaa gcatgaaaac aacaccaagg taagatttat gggttttgtt | |
767 2041 cttggg | |
768 // | |
769 | |
770 LOCUS NM_204727 1598 bp mRNA linear VRT 13-JAN-2017 | |
771 DEFINITION Gallus gallus protein phosphatase 1 regulatory subunit 12B | |
772 (PPP1R12B), mRNA. | |
773 ACCESSION NM_204727 | |
774 VERSION NM_204727.1 | |
775 KEYWORDS RefSeq. | |
776 SOURCE Gallus gallus (chicken) | |
777 ORGANISM Gallus gallus | |
778 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
779 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
780 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
781 Phasianidae; Phasianinae; Gallus. | |
782 REFERENCE 1 (bases 1 to 1598) | |
783 AUTHORS Zhang Y, Mabuchi K and Tao T. | |
784 TITLE Expression in insect cells and characterization of the 110 kDa | |
785 anchoring subunit of myosin light chain phosphatase | |
786 JOURNAL Biochim. Biophys. Acta 1343 (1), 51-58 (1997) | |
787 PUBMED 9428658 | |
788 REFERENCE 2 (bases 1 to 1598) | |
789 AUTHORS Chen YH, Chen MX, Alessi DR, Campbell DG, Shanahan C, Cohen P and | |
790 Cohen PT. | |
791 TITLE Molecular cloning of cDNA encoding the 110 kDa and 21 kDa | |
792 regulatory subunits of smooth muscle protein phosphatase 1M | |
793 JOURNAL FEBS Lett. 356 (1), 51-55 (1994) | |
794 PUBMED 7988720 | |
795 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
796 NCBI review. The reference sequence was derived from S74622.1. | |
797 | |
798 ##Evidence-Data-START## | |
799 Transcript exon combination :: S74622.1 [ECO:0000332] | |
800 RNAseq introns :: mixed/partial sample support | |
801 SAMEA2201357, SAMEA2201358 | |
802 [ECO:0000350] | |
803 ##Evidence-Data-END## | |
804 FEATURES Location/Qualifiers | |
805 source 1..1598 | |
806 /organism="Gallus gallus" | |
807 /mol_type="mRNA" | |
808 /db_xref="taxon:9031" | |
809 /chromosome="26" | |
810 /map="26" | |
811 gene 1..1598 | |
812 /gene="PPP1R12B" | |
813 /note="protein phosphatase 1 regulatory subunit 12B" | |
814 /db_xref="CGNC:195" | |
815 /db_xref="GeneID:395478" | |
816 misc_feature 391..393 | |
817 /gene="PPP1R12B" | |
818 /note="upstream in-frame stop codon" | |
819 CDS 406..966 | |
820 /gene="PPP1R12B" | |
821 /EC_number="3.1.3.53" | |
822 /note="21 kDa; protein phosphatase 1M regulatory subunit; | |
823 PP1M M21 subunit; protein phosphatase 1, regulatory | |
824 (inhibitor) subunit 12B" | |
825 /codon_start=1 | |
826 /product="protein phosphatase 1 regulatory subunit 12B" | |
827 /protein_id="NP_990058.1" | |
828 /db_xref="CGNC:195" | |
829 /db_xref="GeneID:395478" | |
830 /translation="MSSLFTRSKEYTRSRKSQSDSPPSSPSPIAKTLRHERLSRLEAA | |
831 TTPATSDSYSDRASSRSSAYSRRENRLAALSSRAEEESNRDYKKLYESALSENQKLKS | |
832 KLQEAQLELADIKSKLEKAAQQKHEKTSDRSSMLEMEKREKRALERKLSEMEEEMKIL | |
833 TELKSDNQRLKDENGALIRVISKLSK" | |
834 ORIGIN | |
835 1 gtggtttggg tttgtttttt gactctttgg agagtcatct agtctagagg cactcagctg | |
836 61 ttcccccggc tcttcccatt gagctgggag tcctttcctc gtgcagcttt ttgggagtcc | |
837 121 tttcctcgtg cagctttggg aaggagcccc tggtcctgcg gctccggata ggagatgtcc | |
838 181 ctgcgtgggc actgcggaca ccacctcttc tgctcagacg aggaaccttt cagagcctca | |
839 241 gctccctctg cagcagatta atgcctaaaa tcatacacct gaactggcag ggtttaatta | |
840 301 ccagagctgc gaatagttta attagtttgt tctgaccttg gaaggaggac ctgcccagca | |
841 361 acgggagggc gcagctgtat tgctctgcgg tgacccagca gggccatgtc gtcgctgttc | |
842 421 accaggagca aggagtacac gcggagcagg aagtcccagt cagattcacc cccgtcctct | |
843 481 ccttccccga ttgcaaagac gctcagacat gaacgacttt ccaggttgga agcagctaca | |
844 541 acccctgcca ccagtgactc ctacagtgac cgtgcctcca gccgctccag tgcctacagc | |
845 601 cgcagagaga accgcctagc agccctcagc agcagggcag aagaggagag caacagggac | |
846 661 tataaaaagt tgtacgaaag cgccctgtct gaaaatcaga agctgaagtc aaaactgcaa | |
847 721 gaagcacagc tcgagctggc agacatcaaa tccaagttgg aaaaggcagc ccagcagaaa | |
848 781 cacgagaaaa cttctgaccg gtctagcatg ctggagatgg agaaaaggga gaagcgagct | |
849 841 ctggagcgga aactctctga aatggaggag gagatgaaga tactgacgga gctgaaatcg | |
850 901 gacaatcaaa ggctgaagga cgaaaacggg gctctcattc gtgtcatcag caaactctcc | |
851 961 aagtagggag ccgagctgca ggatgagggg cgcaccgctg agccctgccc cttcctcctg | |
852 1021 ccccacgcac agcaccgctg cagccggggg tcagcagcgc tcctccctgc ctggctggac | |
853 1081 gttccctttc tgccctttcc cccccgcatc gcacaccccg gccgttctgg tttcatttca | |
854 1141 gcatgttgtg gtatctcgga catttggctc gggggagatg aggaggatgc agagcggtgc | |
855 1201 cgagctgcca aaacttctcc ttccagcagc ccgcggtgtg cagcagggag ctgttctgtg | |
856 1261 caaagcgacg cccacggagc tggtgcagca aatccgtgcc ctctgcaggt gggagatgtg | |
857 1321 actgtgggct ggaactccgt ggacgtgcat cagcccatgt gcactgtgcg acttcggtac | |
858 1381 gatgcgatgc tacgaggaat ggcagcagag ctgattcctt cagcaggcgg ggacggctgc | |
859 1441 tctgcacaga gacctgcctg ctttttattt aatgtaacat agcagatctg gtgggtaagt | |
860 1501 gcccctcgtg tgcggctggt ggtggggtgc cgtgctacaa acccccgggg ctccctccaa | |
861 1561 gctcactgca ctcagcagca cctccccgaa ttcctaca | |
862 // | |
863 | |
864 LOCUS NM_001031150 2596 bp mRNA linear VRT 11-JAN-2017 | |
865 DEFINITION Gallus gallus rap1 GTPase-GDP dissociation stimulator 1 (RAP1GDS1), | |
866 mRNA. | |
867 ACCESSION NM_001031150 XM_420653 | |
868 VERSION NM_001031150.2 | |
869 KEYWORDS RefSeq. | |
870 SOURCE Gallus gallus (chicken) | |
871 ORGANISM Gallus gallus | |
872 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
873 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
874 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
875 Phasianidae; Phasianinae; Gallus. | |
876 REFERENCE 1 (bases 1 to 2596) | |
877 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
878 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
879 P, Hayashizaki Y and Buerstedde JM. | |
880 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
881 gene function analysis | |
882 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
883 PUBMED 15642098 | |
884 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
885 NCBI review. The reference sequence was derived from AJ719848.1. | |
886 On Jan 11, 2017 this sequence version replaced gi:71896682. | |
887 | |
888 ##Evidence-Data-START## | |
889 Transcript exon combination :: AJ719848.1 [ECO:0000332] | |
890 RNAseq introns :: single sample supports all introns | |
891 SAMEA2201361, SAMEA2201363 | |
892 [ECO:0000348] | |
893 ##Evidence-Data-END## | |
894 COMPLETENESS: complete on the 3' end. | |
895 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
896 1-2596 AJ719848.1 3-2598 | |
897 FEATURES Location/Qualifiers | |
898 source 1..2596 | |
899 /organism="Gallus gallus" | |
900 /mol_type="mRNA" | |
901 /db_xref="taxon:9031" | |
902 /chromosome="4" | |
903 /map="4" | |
904 /breed="Leghorn" | |
905 gene 1..2596 | |
906 /gene="RAP1GDS1" | |
907 /note="rap1 GTPase-GDP dissociation stimulator 1" | |
908 /db_xref="CGNC:9282" | |
909 /db_xref="GeneID:422701" | |
910 misc_feature 79..81 | |
911 /gene="RAP1GDS1" | |
912 /note="upstream in-frame stop codon" | |
913 CDS 220..2043 | |
914 /gene="RAP1GDS1" | |
915 /note="RAP1, GTP-GDP dissociation stimulator 1" | |
916 /codon_start=1 | |
917 /product="rap1 GTPase-GDP dissociation stimulator 1" | |
918 /protein_id="NP_001026321.1" | |
919 /db_xref="CGNC:9282" | |
920 /db_xref="GeneID:422701" | |
921 /translation="MDNLSDALKKLKITATDSTADSLEGCLDCLLQALAQNNMETSEK | |
922 IQKSGVLQVFASLLMPQSSCTAKVANIIAEVARNEFMRNPCVDAGLIPPLVQMLNCKD | |
923 QEVLLQTGRALGNICYDSHEGRSAVDHAGGAHIVVDLIRSLCSKTDPASEKLLTVFCG | |
924 MLMNYSNENDTLQSQLINMGVIPTLVKLLGIHCQNAALTEMCLVAFGNLAELESSKEQ | |
925 FAYTNIAEELVKLFKKQVEHDKKEMIFEVLAPLAENDVIKLQLVEAGLVECLLEIVQK | |
926 TVDSDKEDDVAELKTASDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNSHQLQL | |
927 AGALAIANFARNDGNCTHMVDNGIVQKLMDLLDRHVEDGNVTVQHAALSALRNLAIPV | |
928 VNKAKMLSAGVAEAVLKFLRSEMPPVQFKLLGTLRMLIDAQAEAAEQLGKNAKLVERL | |
929 VEWCEAKDHAGVMGESNRLLSALIRHSKSKDVIRTIVQSGGIKHLVTMATSEHVIMQN | |
930 EALVALALIAALELVTAEKDLENAQLVQILHRLLSDDRSAPEIKYNSIVLVCALIGSE | |
931 SLQKEVQNMAFLEVVSKLRSHENKTVAQQASLTEQRLAVES" | |
932 ORIGIN | |
933 1 gcggcggcac ggcagggtgc cgccgggcgg gcggggtgtc tcccaggcgg ccttgcccgg | |
934 61 atgtgctacc ctgactcata gccgcgccgc acgcagcctc cgcgccgctg ccgcgctcgc | |
935 121 cccgctccgc tccgttccgc gcacagctct cccgcgcctc cccgagaggc ggcggtggct | |
936 181 ccgggaggag gggaaggagg aggaggccgc ggcgccacca tggataatct aagtgatgcc | |
937 241 ctgaaaaagc tgaagataac agccactgac agcacagcag atagcttgga gggatgcttg | |
938 301 gactgcctgc ttcaagctct ggcacaaaac aatatggaga caagtgaaaa aatccagaaa | |
939 361 agtggagttc ttcaggtgtt tgcgagtctg ttgatgccac agtcttcctg cacagcaaaa | |
940 421 gtagctaaca tcatagcaga agtagccaga aatgaattta tgcggaaccc atgtgtggat | |
941 481 gctgggttga tccctccttt ggtgcagatg ttaaactgca aagatcagga agtattgctg | |
942 541 caaacaggac gtgccctggg caatatatgc tacgatagcc atgagggcag gagcgcagtt | |
943 601 gaccatgcag gtggtgcaca tattgtagta gaccttataa ggtcgctgtg cagtaaaaca | |
944 661 gatccagcca gtgagaagct cttgactgtc ttttgtggca tgctgatgaa ctatagcaat | |
945 721 gagaatgata ccctgcaatc acagcttatc aatatgggtg ttattcctac actagtgaaa | |
946 781 ttgttgggta ttcattgcca aaatgcagct ctgacagaga tgtgccttgt tgcttttggc | |
947 841 aatttagcag aacttgagtc aagcaaagaa cagtttgcct acacaaacat tgctgaagag | |
948 901 cttgtgaaac tgttcaagaa gcaagtagag catgataaaa aagagatgat ctttgaagtt | |
949 961 ttggctcccc tagcagaaaa cgatgtcatt aagctgcagc tggttgaagc aggcttggtg | |
950 1021 gagtgcttac ttgagattgt ccagaagact gttgacagtg acaaagagga tgacgttgca | |
951 1081 gagcttaaaa cagcttctga tcttatggtt ttgttactgc tcggagatga atccatgcag | |
952 1141 aagttatttg aaggaggaaa aggcagtgtg ttccaaagag tactttcatg gattccttcc | |
953 1201 aacagccatc agctacaact tgcaggagca ttggctattg caaattttgc cagaaacgac | |
954 1261 ggaaactgca cccatatggt ggataacggc atagttcaaa agctgatgga tctgctagac | |
955 1321 agacatgtgg aggatgggaa tgtaactgtg cagcacgcag ctctgagcgc gctcagaaac | |
956 1381 ctggctattc ctgttgtaaa taaggctaag atgctatcag ctggtgttgc agaagcagta | |
957 1441 ttgaaatttc tcagatcgga gatgccccct gttcagttca agctgctggg aacattacga | |
958 1501 atgttaatag atgcacaagc agaagcagct gaacaactgg gaaaaaatgc aaaactggtg | |
959 1561 gaacgattgg tggagtggtg tgaagccaag gatcacgcag gtgtgatggg agaatcaaac | |
960 1621 agactacttt ctgcacttat acgacacagc aaatctaaag atgtaattag gacgattgta | |
961 1681 cagagcggtg gcatcaagca tttagtaacc atggcaacca gcgaacacgt aataatgcaa | |
962 1741 aacgaagctc tcgttgcact ggcattaata gcagctttag agttagtcac tgctgaaaag | |
963 1801 gatcttgaaa atgctcagct tgttcagatt ctacacagac tgctatcaga cgacaggagc | |
964 1861 gctccagaaa taaaatacaa ctccatagtg ctggtctgtg cccttattgg atctgaatct | |
965 1921 ctccaaaagg aagtgcagaa catggcgttc ctagaagtcg tatcaaaact ccgcagccat | |
966 1981 gagaacaaaa ctgttgccca gcaggcctcg ctaacagagc agagacttgc tgtagaaagc | |
967 2041 tgaggaaggt cttgttttca ttgcatccat cacagattcc accttcatcc tttgtcctgc | |
968 2101 tgtcgctcct gctatgtttt ccactgtatc acttgtgcat gcgtgtaatg tccccacaca | |
969 2161 aattgataaa ctgctgtagg tacccatcca aaaaggtttc taaaaattca taggtggtgt | |
970 2221 taacatgaat ttgtctccgc ccgtaactgt tctacttgta ttcttgttgc ttgggccaca | |
971 2281 tagtagaatg tgcatgttgt agtcctatga tgatgtaaaa gtggtactac acaatgactc | |
972 2341 tttcctcaca cccccctaac tgcataacaa tgtactacta aattagggac agtacaagat | |
973 2401 gcagcaagtc caggctagtg cactgactgt aggattaaga agtaaatcta gctccatttt | |
974 2461 tggtgctctg aagaggcagg tttgaatgca ttgtactgct gctcattcac tggtcttgcc | |
975 2521 tattaatgtc aaactcgtgg tacctagagg taaacaaata aaaatttcag tgctttcact | |
976 2581 taaaaaaaaa aaaaaa | |
977 // | |
978 | |
979 LOCUS NM_204996 3595 bp mRNA linear VRT 06-JAN-2017 | |
980 DEFINITION Gallus gallus Janus kinase 3 (JAK3), mRNA. | |
981 ACCESSION NM_204996 XM_424229 | |
982 VERSION NM_204996.3 | |
983 KEYWORDS RefSeq. | |
984 SOURCE Gallus gallus (chicken) | |
985 ORGANISM Gallus gallus | |
986 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
987 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
988 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
989 Phasianidae; Phasianinae; Gallus. | |
990 REFERENCE 1 (bases 1 to 3595) | |
991 AUTHORS Abdrakhmanov I, Lodygin D, Geroth P, Arakawa H, Law A, Plachy J, | |
992 Korn B and Buerstedde JM. | |
993 TITLE A large database of chicken bursal ESTs as a resource for the | |
994 analysis of vertebrate gene function | |
995 JOURNAL Genome Res. 10 (12), 2062-2069 (2000) | |
996 PUBMED 11116100 | |
997 REFERENCE 2 (bases 1 to 3595) | |
998 AUTHORS Sofer L, Kampa D and Burnside J. | |
999 TITLE Molecular cloning of a chicken JAK homolog from activated T cells | |
1000 JOURNAL Gene 215 (1), 29-36 (1998) | |
1001 PUBMED 9666067 | |
1002 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
1003 preliminary review. The reference sequence was derived from | |
1004 AF034576.2 and AJ399251.1. | |
1005 On Jan 6, 2017 this sequence version replaced gi:787166343. | |
1006 | |
1007 Sequence Note: This RefSeq record was created from transcripts of | |
1008 different breeds. The extent of this transcript is supported by | |
1009 transcript alignments and orthologous data. | |
1010 | |
1011 ##Evidence-Data-START## | |
1012 Transcript exon combination :: AF034576.2 [ECO:0000332] | |
1013 RNAseq introns :: mixed/partial sample support | |
1014 SAMEA2201357, SAMEA2201358 | |
1015 [ECO:0000350] | |
1016 ##Evidence-Data-END## | |
1017 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
1018 1-2334 AF034576.2 1-2334 | |
1019 2335-2826 AJ399251.1 85-576 | |
1020 2827-3595 AF034576.2 2824-3592 | |
1021 FEATURES Location/Qualifiers | |
1022 source 1..3595 | |
1023 /organism="Gallus gallus" | |
1024 /mol_type="mRNA" | |
1025 /db_xref="taxon:9031" | |
1026 /chromosome="28" | |
1027 /map="28" | |
1028 gene 1..3595 | |
1029 /gene="JAK3" | |
1030 /gene_synonym="JAK" | |
1031 /note="Janus kinase 3" | |
1032 /db_xref="CGNC:20233" | |
1033 /db_xref="GeneID:395845" | |
1034 CDS 56..3379 | |
1035 /gene="JAK3" | |
1036 /gene_synonym="JAK" | |
1037 /EC_number="2.7.10.1" | |
1038 /note="Janus kinase 3 (a protein tyrosine kinase, | |
1039 leukocyte)" | |
1040 /codon_start=1 | |
1041 /product="tyrosine-protein kinase JAK3" | |
1042 /protein_id="NP_990327.2" | |
1043 /db_xref="CGNC:20233" | |
1044 /db_xref="GeneID:395845" | |
1045 /translation="MAPLGEETPLIGERSCSLSSSEPGTLQVYLYHRGPHAPPDSAAT | |
1046 LTFTFGEYTAEELCVHAAKACGVLPICHPLFALATEDLSCWYPPNHLFTVEDARSQVV | |
1047 VYRIRFFFPNWCGQGQVHRFQLPSDRPSPVLDYPVIDYLFAQSRSDFIAGRMELALSL | |
1048 AGQEECLSLAVLDMLRIAKEKWQSPKEVFSCVSYKTCIPEQLRCQIQQHSFLTRKRIR | |
1049 RRVAQSLRRMGGCRVDGCCLKLKYLLDLERLRCCWAEESFHAHGPDADIAIHVSTDSG | |
1050 VSWSCVGSESRQHFCDFPDIADVSIKQASRDGGPVENRIVTLTKTDNRVLEVEFPTLR | |
1051 EALSFMALVDGYYRLTADAHHYFCKEVAPPRLLEDMENQCHGPISSEFAVRKLKAAGS | |
1052 HPGLYVLRRSPQDFDSYLLTVCAETRSGQDYKRCLIRRDEDGSFWLAGLARRFCSLQE | |
1053 LLGTYGCCGLQAEGAHLRLDTCCPPLPREKSNLLIVRSGCPRPPNSPPAPRRSPNQMS | |
1054 FHKIDPESLIRGESLGQGSFTHIYKGIKRDQKDDEFYQTPVVLKVMDSSHRNCSESFL | |
1055 EAASIMSQLSHKHLVLLHGVSLGKDSIMVQEYIRHGPLDLYLKKNHSEGKVTTSWKLQ | |
1056 VAKQLAYALNYLEDKKITHGNVSAKKVLLTREGDAASSSPPFIKLNDPGVSITVLAKE | |
1057 WLVERIPWVAPECLSDPQSLALPADKWGFGATLWEIFSGGNMPVSLLEPQKKLQFYDS | |
1058 RLQLPAPRWSELAALIAQCMRYAPSRRPCFRAIIRDINSLISSDYELLSELSPGDVTL | |
1059 RESCWGYEHVAAGHGPAQFEERHLKYISLLGKGNFGSVELCRYDPLGDSTGELVAVKK | |
1060 LQQDSAKELQDFEREIQILHSLQHDFIVKYRGVCYSRGRRGLRLVMEYLPDGCLRDYL | |
1061 QKNQHRLEHRTLLLYAWQICKGMEYLGAQRCVHRDLASRNILVESETHVKIGDFGLAK | |
1062 LLPQDKDYYVVQEPGQSPVFWYAPESLADNVFSRASDVWSFGVLLYELFTYSNKSRSP | |
1063 SEEFLHMMGPEKPAQIICHLLELLKDSRRLPVPPGCPMEVYAMMLSCWAFAPSARPTF | |
1064 TELAARVEALRDGRGTAHG" | |
1065 ORIGIN | |
1066 1 gggggggggg tacacgggga ccacactgag caccgctgtc cccgcagtgc ccgccatggc | |
1067 61 cccgctgggc gaggagacgc cgctgatcgg tgagcgctcc tgcagtctgt cctcctcgga | |
1068 121 gcccggcacg ctgcaggtgt acctctacca ccggggaccc catgcgcccc ccgactccgc | |
1069 181 tgccaccctc accttcacct tcggcgagta cacggccgag gagctgtgcg tgcacgctgc | |
1070 241 caaggcctgc ggagtgctgc ccatctgcca ccccctcttc gcgttggcta cggaggatct | |
1071 301 cagctgctgg taccccccca accacctctt cacggtggag gacgcccgca gccaggtggt | |
1072 361 ggtgtatagg atcaggttct tcttccccaa ctggtgtggg cagggccagg tgcaccgctt | |
1073 421 ccagctgcca agtgaccgcc ccagccccgt gctggactac cctgtcatcg attacctgtt | |
1074 481 tgcccagtct cgtagtgact tcatcgcggg gcgcatggag ctggcactga gcctggcggg | |
1075 541 gcaggaggag tgcctgagcc tggcggtgct ggatatgctg cgcatcgcca aggagaagtg | |
1076 601 gcagagcccc aaggaggtct tcagctgcgt cagctacaag acctgcatcc cggagcagct | |
1077 661 gcggtgtcag atccagcagc acagcttcct cacccgaaag cgcatccgcc gccgtgttgc | |
1078 721 gcagtccctg cgtaggatgg ggggctgccg ggtggacggg tgctgcctga agcttaaata | |
1079 781 cctgctggac ctggagaggc tgcggtgctg ctgggctgag gagagcttcc atgcacacgg | |
1080 841 ccccgacgcc gacatcgcca tccacgtgtc tacagacagc ggggtctcct ggagctgcgt | |
1081 901 tggatctgag agccgccagc acttctgtga cttccccgac atcgccgacg tcagcatcaa | |
1082 961 gcaggcgagc cgcgacggtg gccccgtgga gaaccgcatc gtcaccctca ccaagacgga | |
1083 1021 caacagggtg ctggaggtgg agttccccac gctgcgggaa gcactctcct tcatggctct | |
1084 1081 ggtggatgga tactaccgcc tgactgcaga tgcccaccac tacttctgca aggaggtggc | |
1085 1141 ccccccccgg ctgctcgagg acatggagaa ccaatgccac ggacccatca gctctgagtt | |
1086 1201 tgctgtgcgc aaactgaagg cggcggggtc ccatccgggg ctgtacgtgc tgcgccgaag | |
1087 1261 cccccaggac ttcgacagct acctgctgac cgtgtgcgcc gagacgcgct ccgggcagga | |
1088 1321 ctacaagcgc tgcctgatcc gcagggatga ggatggcagc ttctggctgg cagggctggc | |
1089 1381 acggcgcttc tgcagcctgc aggagctgct tggcacctat gggtgctgcg ggctgcaggc | |
1090 1441 tgagggtgcc cacctgcgcc tggacacgtg ttgcccaccc ctgccccgag agaagtccaa | |
1091 1501 cctgctgatt gtgcgcagtg gatgcccacg accccccaat tctccccccg ccccgcgccg | |
1092 1561 cagccccaac cagatgtcat tccacaagat cgaccccgag agcctcatac ggggcgagag | |
1093 1621 cctggggcag ggctccttca cccacatcta caaaggcatc aagcgggacc agaaggatga | |
1094 1681 cgagttctac cagaccccgg tggtgctcaa ggtgatggac agcagccacc gcaactgctc | |
1095 1741 cgagtccttc ctggaggccg ccagcatcat gagccagctg tcccacaagc acctggtgct | |
1096 1801 gctgcacggc gtcagcctcg gcaaggacag catcatggtg caggagtaca tcaggcacgg | |
1097 1861 gcccctggac ctctacctaa agaagaacca cagcgagggc aaggtgacga ccagctggaa | |
1098 1921 gctgcaggtg gccaagcagc tggcatatgc actcaactac ttggaggata agaaaatcac | |
1099 1981 ccacggcaac gtctctgcta agaaggtgct gctgacccgg gagggggacg cggccagcag | |
1100 2041 cagccccccc ttcatcaagc tcaacgaccc cggggtcagc atcaccgtcc tggccaagga | |
1101 2101 gtggctggtg gagcgcatcc cttgggtggc ccccgagtgc ctgagcgacc cccagagcct | |
1102 2161 ggcgctgcca gctgacaagt ggggctttgg ggcaacctta tgggagatct tcagtggggg | |
1103 2221 caacatgcct gtcagcctac tggagccaca gaagaagctg cagttctacg acagccgcct | |
1104 2281 gcagctgccc gccccgcgct ggagcgagct ggccgcgctc atcgctcagt gcatgcgcta | |
1105 2341 cgcgcccagc aggcggccct gcttccgtgc catcatccgc gacatcaaca gcctcatctc | |
1106 2401 ctccgactac gagctgctct cagagctgtc acccggcgat gtgacgctgc gggagagctg | |
1107 2461 ctgggggtac gagcacgtgg cggcggggca cggcccggct cagttcgagg agaggcacct | |
1108 2521 caagtacatc tcactgctgg gcaagggcaa ctttgggagc gtggagctgt gccgctacga | |
1109 2581 cccgctgggt gacagcacgg gtgagctggt ggccgtgaag aagctgcagc aggattcggc | |
1110 2641 caaggagctg caggactttg agagggagat ccagatcctg cactcgctgc agcacgactt | |
1111 2701 catcgtcaag taccggggcg tctgctacag ccgtgggcgc cgggggctgc ggttggtgat | |
1112 2761 ggagtatctg cctgacggct gcctgaggga ctacctgcaa aagaaccagc accgcctgga | |
1113 2821 gcaccgcacg ctgctgctct acgcctggca gatctgcaag ggcatggagt acctgggggc | |
1114 2881 gcagcgctgc gtgcaccgcg acttggccag caggaacatc ctggtggaga gcgagaccca | |
1115 2941 cgtcaagatc ggtgacttcg ggctggccaa gctgctgcca caggacaagg actactacgt | |
1116 3001 ggtgcaggag cccgggcaga gccccgtgtt ctggtacgca cccgagtcgc tggctgacaa | |
1117 3061 cgtcttctcc cgagcatccg acgtgtggag cttcggggtg ctgctctatg agctcttcac | |
1118 3121 ctacagcaat aagagcagga gcccctcgga ggagttcctc cacatgatgg gccctgagaa | |
1119 3181 accagcacag atcatctgcc atttgctgga gctgctgaag gactcccggc ggctcccggt | |
1120 3241 gcccccgggc tgccccatgg aggtgtatgc gatgatgctg agctgctggg cgttcgcccc | |
1121 3301 cagtgccaga cccaccttca ccgagttggc agccagggtt gaggcactgc gggatggccg | |
1122 3361 tggcaccgcc catgggtagg gggtgcgtgg aggggggagt acaacccccc tgcagccccc | |
1123 3421 agcacgaggg catgacagac ccccagcacg agggcatgac agacagaccg acggacgcag | |
1124 3481 caatgctcca atgcgtttta accactgtgg ttgtttctgt tgtgactccc cccccccatt | |
1125 3541 tacccctctt ttgtaaccgg gtttgaccaa tttcaagtaa atgatggtgg aattt | |
1126 // | |
1127 | |
1128 LOCUS NM_001005808 2905 bp mRNA linear VRT 06-JAN-2017 | |
1129 DEFINITION Gallus gallus isocitrate dehydrogenase 3 (NAD(+)) alpha (IDH3A), | |
1130 mRNA. | |
1131 ACCESSION NM_001005808 XM_413748 | |
1132 VERSION NM_001005808.2 | |
1133 KEYWORDS RefSeq. | |
1134 SOURCE Gallus gallus (chicken) | |
1135 ORGANISM Gallus gallus | |
1136 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
1137 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
1138 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
1139 Phasianidae; Phasianinae; Gallus. | |
1140 REFERENCE 1 (bases 1 to 2905) | |
1141 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
1142 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
1143 P, Hayashizaki Y and Buerstedde JM. | |
1144 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
1145 gene function analysis | |
1146 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
1147 PUBMED 15642098 | |
1148 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
1149 preliminary review. The reference sequence was derived from | |
1150 AJ738046.1, AJ720955.1 and CR406443.1. | |
1151 On Jan 6, 2017 this sequence version replaced gi:347360901. | |
1152 | |
1153 ##RefSeq-Attributes-START## | |
1154 gene product(s) localized to mito. :: inferred from homology | |
1155 ##RefSeq-Attributes-END## | |
1156 COMPLETENESS: complete on the 3' end. | |
1157 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
1158 1-108 AJ738046.1 390-497 c | |
1159 109-217 AJ720955.1 2-110 | |
1160 218-2107 CR406443.1 1-1890 | |
1161 2108-2855 AJ720955.1 2001-2748 | |
1162 2856-2905 AJ720955.1 2749-2798 | |
1163 FEATURES Location/Qualifiers | |
1164 source 1..2905 | |
1165 /organism="Gallus gallus" | |
1166 /mol_type="mRNA" | |
1167 /db_xref="taxon:9031" | |
1168 /chromosome="10" | |
1169 /map="10" | |
1170 gene 1..2905 | |
1171 /gene="IDH3A" | |
1172 /note="isocitrate dehydrogenase 3 (NAD(+)) alpha" | |
1173 /db_xref="CGNC:2399" | |
1174 /db_xref="GeneID:415362" | |
1175 misc_feature 174..176 | |
1176 /gene="IDH3A" | |
1177 /note="upstream in-frame stop codon" | |
1178 CDS 216..1316 | |
1179 /gene="IDH3A" | |
1180 /EC_number="1.1.1.41" | |
1181 /note="isocitrate dehydrogenase 3 (NAD+) alpha" | |
1182 /codon_start=1 | |
1183 /product="isocitrate dehydrogenase [NAD] subunit alpha, | |
1184 mitochondrial" | |
1185 /protein_id="NP_001005808.2" | |
1186 /db_xref="CGNC:2399" | |
1187 /db_xref="GeneID:415362" | |
1188 /translation="MAAAAWMPAVSRLLGAFKNQKQVTRSFSSAVQTVTLIPGDGIGP | |
1189 EISAAVMKIFDAAKVPIQWEERNVTAIQGPGGKWMIPPDAKESMDKNKMGLKGPLKTP | |
1190 IAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDVNIVTIRENTEGEYSGIEHVI | |
1191 VEGVVQSIKLITEEASKRIAEFAFEYARNNQRSHVTAVHKANIMRMSDGLFLRKCREA | |
1192 AENCKDIKFNEMYLDTVCLNMVQDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSG | |
1193 NIGANGVAIFESVHGTAPDIAGKDLANPTALLLSAVMMLRHMGLHKHATKIETACFDT | |
1194 IKDGKALTKDLGGNAKCSEFTEEICSRVRDTD" | |
1195 ORIGIN | |
1196 1 gcccgctgcg ctgacgtagc ccgcccgacg gcgcgggcac ggagcacggg agcgcggacc | |
1197 61 ccgtaacgca gcgcggggcg gggccgtcag cggcgcgcga ggtgcggcgg cggccgcctc | |
1198 121 ccgggggcgg ggcggtagcg cgcggccgct cggcgccggt tccggtccgt cggtgactgc | |
1199 181 ggacgttgcg gggtcggagg agcgccgggc gcgccatggc cgcagccgcg tggatgcccg | |
1200 241 cggtttcccg actgctcggt gctttcaaaa accaaaaaca ggtgaccaga agttttagta | |
1201 301 gtgctgtaca aacggtgact ttaatcccag gagatggcat aggacctgag atttctgctg | |
1202 361 ctgtcatgaa gatctttgat gctgccaaag ttcctattca gtgggaagaa aggaatgtta | |
1203 421 cagcaatcca aggaccagga ggaaagtgga tgatacctcc agatgccaaa gaatccatgg | |
1204 481 ataaaaacaa aatgggatta aaagggccct taaaaacccc aatcgctgca gggcacccct | |
1205 541 cgatgaatct gctgctgcgt aaaacctttg acctctatgc aaacgtccgt ccctgcgtct | |
1206 601 caattgaggg gtacaaaacc ccttacacag acgtaaatat cgtcacgata cgagagaaca | |
1207 661 cagaaggcga atacagtggg attgagcatg tgattgttga aggcgttgtg caaagcatca | |
1208 721 agctaatcac agaggaagct agcaagcgca ttgcagagtt tgcttttgag tatgctagaa | |
1209 781 ataaccagag aagccatgtt actgctgtgc acaaggcaaa tattatgaga atgtctgatg | |
1210 841 ggcttttctt gagaaaatgc agggaagcag cagaaaactg taaagacatt aaatttaatg | |
1211 901 aaatgtatct ggatactgtg tgtctgaata tggttcagga tccttcacaa tttgatgtgc | |
1212 961 ttgttatgcc taacttgtat ggtgacatcc tcagtgactt gtgtgctgga ttgattggag | |
1213 1021 gtcttggagt aacaccaagt ggaaatattg gtgctaacgg agttgccatt tttgaatcgg | |
1214 1081 ttcatggaac agcacctgat attgcaggaa aagacttggc aaatccaact gctcttctcc | |
1215 1141 tgagcgctgt aatgatgctg cgtcatatgg gactacacaa gcatgccaca aaaatcgaga | |
1216 1201 cagcttgctt tgatacaatt aaagatggaa aggccttgac aaaagacttg ggtggcaatg | |
1217 1261 ccaagtgttc agagttcaca gaagagatct gcagcagagt acgggacaca gactaaactt | |
1218 1321 ctcatttgat tcatattaac tctgaaaaga tgcatcacaa acatgcagta tgtaacccgg | |
1219 1381 tatccatatg catatatttt gctcttctct taagagagca aactttatag ggaaggcctc | |
1220 1441 ttcattaata aatttagtcc ccatggctcc agatgatgct tgtgcctgct ttcagtggac | |
1221 1501 tttaagtgct ctgtcttatt tatttgattc tacctggtaa gcatttttat gtaagagaag | |
1222 1561 tattttttgc cactgtagct gtctactgtt tgctgtttca actagatggt ttttattttt | |
1223 1621 cacaaagaaa aattatgtga atataacata accagaacta gtgaattgct acagcacctt | |
1224 1681 aatgcttaga gcctgtgtta ttggtcttac tgaaatttaa aggataggct tttggcctaa | |
1225 1741 caagagcaca agataaacat tataaaaaga aacgggtata aactaattta aaatagcaat | |
1226 1801 tgtgtgttaa aagcaatgaa agaacacttc tgggtgctct gttgattgat gaaatactgc | |
1227 1861 tttgtcttca aaggacatga aaaaaagaaa tgcaaaatct tagagattta atctatttat | |
1228 1921 gtttatacag aaaaaaggca tcaaaccagc tggatgtgag aattgatatt aacaaaaata | |
1229 1981 tttttcaaat ctctatcaaa atagctctca taagttttcc tttctgaaat gcagcttaat | |
1230 2041 ttacaagagt tgtaatgaga gtaatttaga aaaactcatt cctgctctgt attatgaagg | |
1231 2101 gaagttatta actgcaccag tttatacaaa atatttcatg gcttctgctg gattgctttt | |
1232 2161 tgtgttatac tttgttttta tgaagcctgc tcagtgtgtt tcactgcgct gactagtgat | |
1233 2221 tttactctat aaactctgaa tgtaaaagac tagtcctgat ggaatgaaga cagattgaag | |
1234 2281 gtctggctct ggttcctatg ttccagaaat acatttcatc cctattcaag ggatcagaga | |
1235 2341 cttctttctt ctcctgcttc ctaagcctaa taagcaccaa agcacctctt tctttttttt | |
1236 2401 ttccctccct tcttcatcac atacaggtaa tcatgagccg ttctgacctg gatttcttaa | |
1237 2461 gggtatgctg ctcttagtat atccttccag aaaatgcaca ttcgtaaaac ttgtggccaa | |
1238 2521 cacaggttta tacctactgc cagagccaga tgtcttaaag cttaattgta tttataggta | |
1239 2581 ttatgcctct tagttacttt ctactgaggc tgttcaggct ggttatttca gaatcaaaac | |
1240 2641 tattttgaat aatgtcttct agcagaactc tatgaagtaa gcaacacact tttttgtaca | |
1241 2701 gcctaacaac gtgttggagg agggacagta agctttgttt cttgtgctct ctgcttttgg | |
1242 2761 tgaatagggt atcatttcct tctgtgtttt acaagctgct gcttccttgt ttcctctaga | |
1243 2821 ttaatcttaa gatcttctgc agtaccatta cgcacaaaat ggggaaaaaa aataactttt | |
1244 2881 tgaagaccta aaaaaaaaaa aaaaa | |
1245 // | |
1246 | |
1247 LOCUS NM_205405 5027 bp mRNA linear VRT 06-JAN-2017 | |
1248 DEFINITION Gallus gallus complement component 3 (C3), mRNA. | |
1249 ACCESSION NM_205405 XM_001236913 | |
1250 VERSION NM_205405.2 | |
1251 KEYWORDS RefSeq. | |
1252 SOURCE Gallus gallus (chicken) | |
1253 ORGANISM Gallus gallus | |
1254 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
1255 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
1256 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
1257 Phasianidae; Phasianinae; Gallus. | |
1258 REFERENCE 1 (bases 1 to 5027) | |
1259 AUTHORS Wu G, Liu L, Qi Y, Sun Y, Yang N, Xu G, Zhou H and Li X. | |
1260 TITLE Splenic gene expression profiling in White Leghorn layer inoculated | |
1261 with the Salmonella enterica serovar Enteritidis | |
1262 JOURNAL Anim. Genet. 46 (6), 617-626 (2015) | |
1263 PUBMED 26358731 | |
1264 REFERENCE 2 (bases 1 to 5027) | |
1265 AUTHORS Haynes T, Luz-Madrigal A, Reis ES, Echeverri Ruiz NP, | |
1266 Grajales-Esquivel E, Tzekou A, Tsonis PA, Lambris JD and Del | |
1267 Rio-Tsonis K. | |
1268 TITLE Complement anaphylatoxin C3a is a potent inducer of embryonic chick | |
1269 retina regeneration | |
1270 JOURNAL Nat Commun 4, 2312 (2013) | |
1271 PUBMED 23942241 | |
1272 REMARK GeneRIF: C3a is sufficient to induce complete regeneration of the | |
1273 embryonic chick retina from stem/progenitor cells present in the | |
1274 eye, independent of fibroblast growth factor receptor signaling. | |
1275 REFERENCE 3 (bases 1 to 5027) | |
1276 AUTHORS Liu D and Niu ZX. | |
1277 TITLE Cloning of a gene fragment encoding chicken complement component | |
1278 C3d with expression and immunogenicity of Newcastle disease virus F | |
1279 gene-C3d fusion protein | |
1280 JOURNAL Avian Pathol. 37 (5), 477-485 (2008) | |
1281 PUBMED 18798021 | |
1282 REFERENCE 4 (bases 1 to 5027) | |
1283 AUTHORS Fu J, Lin G, Zeng B, Wu Z, Wu Y, Chu H, Qin G, Liang G, Li J, Gan | |
1284 X, Yu X, Li C and Liu D. | |
1285 TITLE Anti-ischemia/reperfusion of C1 inhibitor in myocardial cell injury | |
1286 via regulation of local myocardial C3 activity | |
1287 JOURNAL Biochem. Biophys. Res. Commun. 350 (1), 162-168 (2006) | |
1288 PUBMED 16996480 | |
1289 REMARK GeneRIF: Complement C1 Inactivator Proteins, in addition to | |
1290 inhibition of the systemic complement activation, prevents | |
1291 myocardial cell injury via a direct inhibitory role in the local | |
1292 myocardial C3 activity | |
1293 REFERENCE 5 (bases 1 to 5027) | |
1294 AUTHORS Recheis B, Rumpler H, Schneider WJ and Nimpf J. | |
1295 TITLE Receptor-mediated transport and deposition of complement component | |
1296 C3 into developing chicken oocytes | |
1297 JOURNAL Cell. Mol. Life Sci. 62 (16), 1871-1880 (2005) | |
1298 PUBMED 16041564 | |
1299 REMARK GeneRIF: C3 is transported into oocytes by LR8-mediated | |
1300 endocytosis. | |
1301 REFERENCE 6 (bases 1 to 5027) | |
1302 AUTHORS Mavroidis M, Sunyer JO and Lambris JD. | |
1303 TITLE Isolation, primary structure, and evolution of the third component | |
1304 of chicken complement and evidence for a new member of the alpha | |
1305 2-macroglobulin family | |
1306 JOURNAL J. Immunol. 154 (5), 2164-2174 (1995) | |
1307 PUBMED 7532662 | |
1308 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
1309 preliminary review. The reference sequence was derived from | |
1310 AADN04001210.1 and U16848.1. | |
1311 On Jan 6, 2017 this sequence version replaced gi:45382302. | |
1312 | |
1313 Sequence Note: This RefSeq record was created from transcript and | |
1314 genomic sequence data to make the sequence consistent with the | |
1315 reference genome assembly. The genomic coordinates used for the | |
1316 transcript record were based on transcript alignments. | |
1317 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
1318 1-96 AADN04001210.1 7062-7157 | |
1319 97-289 AADN04001210.1 9895-10087 | |
1320 290-449 AADN04001210.1 12264-12423 | |
1321 450-520 AADN04001210.1 13480-13550 | |
1322 521-615 AADN04001210.1 13637-13731 | |
1323 616-698 AADN04001210.1 13873-13955 | |
1324 699-789 AADN04001210.1 14056-14146 | |
1325 790-892 AADN04001210.1 14966-15068 | |
1326 893-1013 AADN04001210.1 15789-15909 | |
1327 1014-1129 AADN04001210.1 16251-16366 | |
1328 1130-1276 AADN04001210.1 16801-16947 | |
1329 1277-1489 AADN04001210.1 18032-18244 | |
1330 1490-1684 AADN04001210.1 18340-18534 | |
1331 1685-1843 AADN04001210.1 19569-19727 | |
1332 1844-1973 AADN04001210.1 19816-19945 | |
1333 1974-2045 AADN04001210.1 20174-20245 | |
1334 2046-2243 AADN04001210.1 20424-20621 | |
1335 2244-2355 AADN04001210.1 21290-21401 | |
1336 2356-2441 AADN04001210.1 21774-21859 | |
1337 2442-2581 AADN04001210.1 22179-22318 | |
1338 2582-2794 AADN04001210.1 22390-22602 | |
1339 2795-2861 AADN04001210.1 22904-22970 | |
1340 2862-2948 AADN04001210.1 23370-23456 | |
1341 2949-3152 AADN04001210.1 23543-23746 | |
1342 3153-3228 AADN04001210.1 24151-24226 | |
1343 3229-3388 AADN04001210.1 24306-24465 | |
1344 3389-3484 AADN04001210.1 24648-24743 | |
1345 3485-3635 AADN04001210.1 24851-25001 | |
1346 3636-3799 AADN04001210.1 25937-26100 | |
1347 3800-3958 AADN04001210.1 26882-27040 | |
1348 3959-4109 AADN04001210.1 27264-27414 | |
1349 4110-4161 AADN04001210.1 28185-28236 | |
1350 4162-4249 AADN04001210.1 28571-28658 | |
1351 4250-4339 AADN04001210.1 28825-28914 | |
1352 4340-5027 U16848.1 4339-5026 | |
1353 FEATURES Location/Qualifiers | |
1354 source 1..5027 | |
1355 /organism="Gallus gallus" | |
1356 /mol_type="mRNA" | |
1357 /db_xref="taxon:9031" | |
1358 gene 1..5027 | |
1359 /gene="C3" | |
1360 /gene_synonym="C3d" | |
1361 /note="complement component 3" | |
1362 /db_xref="CGNC:8744" | |
1363 /db_xref="GeneID:396370" | |
1364 CDS 26..4981 | |
1365 /gene="C3" | |
1366 /gene_synonym="C3d" | |
1367 /EC_number="3.4.21.43" | |
1368 /note="complement C3 alpha chain; complement component 3d" | |
1369 /codon_start=1 | |
1370 /product="complement C3 precursor" | |
1371 /protein_id="NP_990736.2" | |
1372 /db_xref="CGNC:8744" | |
1373 /db_xref="GeneID:396370" | |
1374 /translation="MGLLLLPLLLGVLLLHAVPTPAQMVTMVTPAVLRLDTDEKVVLE | |
1375 APGLSAPTEANILVQDFPQKRKVLFQVRKQLNPAEGMMAIATVKVPVKLLPPVVGKHF | |
1376 VSVVARVGQVTLEKVLLVSLQSGHIFLQTDKPIYTPGSTVLCRLFALSHFMQPLLKTV | |
1377 IVEVKTPDNVIIKQVPVSSPMRNGIFSINHNLPEVVSLGTWTITAKFEDSQDQVFSTQ | |
1378 FEVKEYVLPSFEVTLDPQEKFLYIDRQEDFRVTITARYLYGKNLQGTAFVLFGVVVDD | |
1379 EKKTIPQSLQRVKVTDGDGEAVLPMAMLRQRFANLQELVGHSLYVTVTVLTESGSDMV | |
1380 EAQRSGIRIVTSPYTIHFTHTPKYFKPGMPFDLTVYVTNPDNSPAPRIPVKADNFQGL | |
1381 VSTQRDGTAKLVLNMPANKNSVPITVRTDQKDLPPERQASRQIVAEAYQSQGNSGNYL | |
1382 HLAVGASQVQPGDNLPINFHLKSNRDDVRKSVSYFTYLILSKGHIVHVGRQPREGDQS | |
1383 LVTMSLPVTANLIPSFRIVAYYHVKPGEIIADSVWVDVKDTCMGSLVVRGASEADNRV | |
1384 HEPRTPMRLHIEGDHKAHVGLVAVDKAVYVLNKNKLTQSKVWDTVENSDIGCTPGSGR | |
1385 NHVGVFADAGLSLTSNVNINTEQRSEVQCAKPAKRKRRSVRLIKHKGTKMAEYSDKNL | |
1386 RKCCEDGMKENLMGYSCEKRATYVLDGKACTEAFLSCCLYIKGIRDEERELQYELARS | |
1387 EVDDAFLSDEDITSRSLFPESWLWQVEELTEPPNEQGISMKTLPIYLKDSITTWEVLA | |
1388 VSISENKGLCVADPYEITVMKEFFIDLRLPYSAVRNEQVEVRAILYNYWTNKIKVRVE | |
1389 LMYNPALCSASTTKTRYQQIFQLEPQSSHAVPFVIVPLQLGQHDVEVKAAVWNSFVSD | |
1390 GVKKKLRVVPEGMRLEKTVKIVELDPKTLGNNGVQEVKVKAANLSDIVPNTESETKVS | |
1391 IQGNPVSILVEKATDGTKLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDSTMQWETFGI | |
1392 NRRTEAIELIKKGYTQQLAYRKEDGSFAAFTTRPSSTWLTAYVAKVFAMAINMVDIKP | |
1393 EVVCGAIKWLILEKQQPDGLFQEDAPVIHKEMVGGYHGAEPSVSLTAFVLSALQESQK | |
1394 ICKNYVKSLDGSIAKASDYLSRKYQSLTRPYTVALTSYALALTGKLNSEKVLMKFSKD | |
1395 GTHWAERNAHTYNIEGTSYALLALLQMEKAELTGPVVRWLAQQNYFGGGYGSTQATIL | |
1396 VFQALAQYHVALPRQLELNLDVSVLLPRRANAITYRIENNNALVARSAETKLNEDFTV | |
1397 KAEGTGKGTMTVVTVYNAKVPEKENKCDNFDLRVSVEDVKAGRELEGVIRSVKITICT | |
1398 RFLDTVDATMSILDISMLTGFSPDVQDLKSLSEGVERYISKFEIDHALSNRSNLIIYL | |
1399 DKVSHQVEECIAFRAHQHFQVGLIQPASVIVYSYYKIDDRCTRFYHPDKAGGQLRKIC | |
1400 HGEVCCAEENCFIRVKKDNPITVNERIDLACKPGVDYVYKVKVVATEETPSHDNYIMS | |
1401 ILTVIKMGTDENPGGSNRTFVSHKQCRDALSLQKGQDYLVWGLASDLWVTGSRFSYLI | |
1402 SKDTWLEAWPLEESCQDADLQPLCQDFTEFSDNLVLFGCPT" | |
1403 sig_peptide 26..76 | |
1404 /gene="C3" | |
1405 /gene_synonym="C3d" | |
1406 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
1407 ORIGIN | |
1408 1 cccgcgtccc catccccgct cagccatggg gctgctgctg ctgcccctcc tgctcggcgt | |
1409 61 tctgctgctc catgcggtcc ccacacctgc acagatggtg accatggtga ccccggcggt | |
1410 121 gctgcggttg gacacggacg agaaggtggt gttggaggct ccgggtctgt ccgcccccac | |
1411 181 cgaggccaac atcctggtgc aggatttccc ccaaaagcgc aaagtcctct tccaggtccg | |
1412 241 caagcagctc aaccccgcag aggggatgat ggccatcgcc accgtcaagg tgccggtgaa | |
1413 301 gctgctgccg ccggtggtgg ggaagcactt tgtctcggtg gtggcgcggg tgggacaggt | |
1414 361 gaccctggag aaggtgctgt tggtgtcact gcagagcggc cacatcttcc tgcagaccga | |
1415 421 caaacccatc tacacccccg gctccaccgt gctctgccgt ctcttcgccc tcagccactt | |
1416 481 catgcagcct ctgctgaaga cggtgatcgt ggaggtcaag acacccgaca acgtcatcat | |
1417 541 caagcaagtg cccgtgtcct cccccatgag gaatgggatc ttctccatca accacaacct | |
1418 601 gccggaggtg gtcagcctgg ggacatggac tatcacggcc aaatttgaag actcgcagga | |
1419 661 ccaggtcttc agcacacaat ttgaagtcaa ggaatacgtg ctgccgagct ttgaggtcac | |
1420 721 cctggacccg caggagaagt tcctctacat tgaccggcag gaggatttcc gggtgaccat | |
1421 781 cacagccagg tacctgtatg ggaagaatct gcaggggacc gccttcgtcc tcttcggtgt | |
1422 841 ggtggtggac gacgagaaaa agaccatccc ccagtccctg cagcgcgtca aggtgaccga | |
1423 901 tggggacggg gaggccgtgc tgcccatggc catgctgcgg cagcgcttcg ccaacctcca | |
1424 961 ggagctggtg ggacactctc tctacgtcac cgtcaccgtc ctcaccgagt caggcagtga | |
1425 1021 catggtggag gcacagcgca gcggcatccg catagtgacg tccccataca ccatccactt | |
1426 1081 cacccacacc cccaagtact tcaagccagg gatgcccttc gatctgacgg tttatgtcac | |
1427 1141 caaccccgat aattccccgg ctccgcgcat ccccgtcaag gccgacaact tccagggcct | |
1428 1201 cgtctccacg cagcgagatg gcacagccaa gctggtcctc aacatgccag ccaacaagaa | |
1429 1261 ctccgtcccc atcactgtga ggacagacca gaaggatctg cccccggagc gccaggcctc | |
1430 1321 gcggcagata gtggccgagg cgtatcaaag ccaggggaac tctggcaact accttcacct | |
1431 1381 ggcagtgggt gccagccagg tgcagcccgg ggacaacctc cccatcaact tccatctcaa | |
1432 1441 gagcaacaga gatgacgtcc gcaaatccgt ttcctacttc acctacctga tcctgagcaa | |
1433 1501 ggggcacatt gtccacgtgg gacggcagcc aagggaaggt gaccagagcc tggtcacgat | |
1434 1561 gtcgcttccc gtgacggcca acctcatccc ttccttccgt atcgtggcct actaccacgt | |
1435 1621 gaagcctggc gagatcattg ctgactccgt ctgggtcgat gtcaaggaca cctgcatggg | |
1436 1681 cagtctggtg gtgaggggag cgtcggaggc tgacaatcgt gtgcatgagc caaggacccc | |
1437 1741 catgcggctg cacatcgagg gcgaccacaa agcccacgtg gggctggtgg ctgtggacaa | |
1438 1801 ggctgtctat gtcctcaaca agaacaaact cactcagagt aaggtgtggg acacagtgga | |
1439 1861 gaacagcgac atcggctgca cgccgggcag tgggaggaac cacgtggggg tcttcgccga | |
1440 1921 tgccggcctc agcctgactt caaacgtgaa catcaacacg gagcagagaa gtgaggtcca | |
1441 1981 gtgtgcaaag cctgcaaaac gcaagcgccg ctccgtgagg ctcatcaagc acaagggcac | |
1442 2041 caagatggcc gagtacagcg acaagaacct gcgcaagtgc tgtgaggacg gcatgaagga | |
1443 2101 aaacctgatg ggctacagct gcgagaaacg ggccacctac gtcctcgatg gcaaagcctg | |
1444 2161 caccgaagcc ttcctcagct gctgcctcta catcaagggc atccgcgatg aggagcgcga | |
1445 2221 gctgcaatac gagctggctc gaagtgaggt ggatgacgcc ttcctgagtg atgaagacat | |
1446 2281 cacctcacgg agcctctttc cagagagctg gctatggcag gtggaggagc tgacagaacc | |
1447 2341 acccaatgaa cagggcatct ccatgaagac gctgcccata tacctgaaag actccatcac | |
1448 2401 cacctgggag gttctggctg tcagtatctc tgagaacaag ggtctgtgcg tggccgaccc | |
1449 2461 ctatgagatt acggtgatga aggagttctt cattgacctg cgcctgccct actcggcagt | |
1450 2521 gaggaacgag caggtggagg tccgcgccat tctctacaac tactggacga acaagatcaa | |
1451 2581 ggtgcgcgtg gagctgatgt acaacccagc cctgtgcagc gcatccacca ccaagacgcg | |
1452 2641 ctaccagcag atcttccaac tggaacctca gtcgtcgcac gccgtgccct tcgtcatcgt | |
1453 2701 gcccctgcag ctggggcagc atgacgtcga ggtgaaggca gctgtctgga acagctttgt | |
1454 2761 gtctgatggc gtcaagaaga agctcagagt ggtgcctgaa gggatgaggc tggagaagac | |
1455 2821 agtgaagata gtggagcttg acccaaagac gctgggaaat aacggtgtgc aagaagtgaa | |
1456 2881 ggtgaaagca gcaaacctct ctgacatcgt ccccaacact gagtcggaga ccaaagtcag | |
1457 2941 cattcaaggc aaccctgtgt ccatcctggt ggagaaagcc accgatggga ccaagctgaa | |
1458 3001 acacctcatt gtgaccccct cgggctgtgg ggagcagaac atgattggga tgacgcccac | |
1459 3061 cgtcattgct gtccactacc tggacagcac aatgcagtgg gagaccttcg gtatcaaccg | |
1460 3121 ccgcactgaa gccatcgaac tgattaaaaa gggttacacc caacaacttg cataccgcaa | |
1461 3181 agaagacggc tcatttgctg ccttcactac ccgcccatcg agcacctggt tgacagccta | |
1462 3241 cgtggccaag gtctttgcca tggccatcaa catggtggac atcaagccgg aggtggtttg | |
1463 3301 tggagccatc aaatggctca ttctggagaa gcaacagcca gatgggcttt tccaagaaga | |
1464 3361 cgctcctgtc atccacaagg agatggtggg aggctaccac ggtgctgagc ccagtgtgtc | |
1465 3421 cctgacagcc ttcgtcctct ccgcgctgca ggaatcccag aagatctgca agaactacgt | |
1466 3481 gaaaagcctg gatgggagca ttgccaaagc ctccgattac ctctcccgga aataccaatc | |
1467 3541 tttgactcga ccctacacgg tggccctgac ctcctacgcc ctggccctaa cggggaaact | |
1468 3601 caacagcgag aaagtcctga tgaagttctc caaagatggc acccactggg cggaacgcaa | |
1469 3661 cgcccacacc tacaacatcg aggggacgtc ctacgctctg ctggcgctgc tgcagatgga | |
1470 3721 gaaggccgag ctgacggggc cggtggtccg ctggttggcc cagcagaact acttcggtgg | |
1471 3781 tggctacgga tccacccagg ccaccatcct ggtgttccag gctctggctc agtaccacgt | |
1472 3841 ggcgctgccg cggcagctgg agctcaacct ggacgtgtcg gtgctgctgc cgcgccgcgc | |
1473 3901 caacgccatc acctaccgca tcgagaacaa caacgcgctg gtggcacgct cagctgagac | |
1474 3961 caagctgaac gaggacttca ctgtgaaagc agagggcact ggcaagggga caatgacagt | |
1475 4021 ggtgaccgtc tacaacgcca aagtgcccga gaaggaaaac aagtgtgaca acttcgacct | |
1476 4081 gcgggtcagc gtggaggacg tgaaggcggg ccgggagctg gaaggggtca tccgctctgt | |
1477 4141 caagatcacc atctgcacca ggttcctgga caccgtggat gccaccatgt ccatccttga | |
1478 4201 tatctccatg ctcaccggct tctcccctga cgtccaggac ctgaagagtc tctcggaggg | |
1479 4261 agtggagagg tacatttcca aatttgagat cgaccacgcg ctgtcgaacc gcagcaacct | |
1480 4321 catcatctac ctggacaagg tctcccacca agtggaggag tgcatcgcct tcagggccca | |
1481 4381 ccagcacttc caggtgggac tgatccagcc cgcctccgtc attgtctaca gctactacaa | |
1482 4441 gatcgatgac cgctgcaccc gcttctacca cccggacaag gctggtgggc agctgaggaa | |
1483 4501 gatctgccat ggggaagtgt gctgcgctga agaaaactgc ttcatacggg tgaagaagga | |
1484 4561 caatcccatc acagtcaatg agcgcatcga ccttgcctgc aagccagggg tggactatgt | |
1485 4621 gtacaaagtg aaggtggtgg caacagagga gacgccatcc cacgacaact acatcatgtc | |
1486 4681 catcctcacc gtcatcaaga tgggcactga tgagaaccca ggtgggagca accggacctt | |
1487 4741 cgtgagccat aagcagtgcc gggatgcatt gagtctccag aagggacagg actacctggt | |
1488 4801 gtgggggctg gcgtccgacc tgtgggtcac cggcagccgc ttctcctacc tcatcagcaa | |
1489 4861 ggacacgtgg ctggaagcgt ggcccttgga ggagtcgtgc caggatgccg acctgcagcc | |
1490 4921 gctctgccag gacttcaccg agttctccga caatctggtc ttgtttgggt gccccacctg | |
1491 4981 atgggtgacc ccaacccgat ggtgacccca acccgatggg tgtccct | |
1492 // | |
1493 | |
1494 LOCUS NM_205387 422 bp mRNA linear VRT 06-JAN-2017 | |
1495 DEFINITION Gallus gallus bone gamma-carboxyglutamate protein (BGLAP), mRNA. | |
1496 ACCESSION NM_205387 | |
1497 VERSION NM_205387.2 | |
1498 KEYWORDS RefSeq. | |
1499 SOURCE Gallus gallus (chicken) | |
1500 ORGANISM Gallus gallus | |
1501 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
1502 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
1503 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
1504 Phasianidae; Phasianinae; Gallus. | |
1505 REFERENCE 1 (bases 1 to 422) | |
1506 AUTHORS Neugebauer BM, Moore MA, Broess M, Gerstenfeld LC and Hauschka PV. | |
1507 TITLE Characterization of structural sequences in the chicken osteocalcin | |
1508 gene: expression of osteocalcin by maturing osteoblasts and by | |
1509 hypertrophic chondrocytes in vitro | |
1510 JOURNAL J. Bone Miner. Res. 10 (1), 157-163 (1995) | |
1511 PUBMED 7747623 | |
1512 REFERENCE 2 (bases 1 to 422) | |
1513 AUTHORS Carr,S.A., Hauschka,P.V. and Biemann,K. | |
1514 TITLE Gas chromatographic mass spectrometric sequence determination of | |
1515 osteocalcin, a gamma-carboxyglutamic acid-containing protein from | |
1516 chicken bone | |
1517 JOURNAL J. Biol. Chem. 256 (19), 9944-9950 (1981) | |
1518 PUBMED 6792200 | |
1519 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
1520 preliminary review. The reference sequence was derived from | |
1521 AADN04000860.1. | |
1522 On Jan 6, 2017 this sequence version replaced gi:46195456. | |
1523 | |
1524 Sequence Note: This RefSeq record was created from transcript and | |
1525 genomic sequence data to make the sequence consistent with the | |
1526 reference genome assembly. The genomic coordinates used for the | |
1527 transcript record were based on transcript alignments. | |
1528 COMPLETENESS: complete on the 3' end. | |
1529 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
1530 1-79 AADN04000860.1 21636-21714 c | |
1531 80-112 AADN04000860.1 21050-21082 c | |
1532 113-179 AADN04000860.1 20875-20941 c | |
1533 180-422 AADN04000860.1 20519-20761 c | |
1534 FEATURES Location/Qualifiers | |
1535 source 1..422 | |
1536 /organism="Gallus gallus" | |
1537 /mol_type="mRNA" | |
1538 /db_xref="taxon:9031" | |
1539 /chromosome="25" | |
1540 /map="25" | |
1541 /breed="Red Jungle Fowl" | |
1542 gene 1..422 | |
1543 /gene="BGLAP" | |
1544 /gene_synonym="BGP" | |
1545 /note="bone gamma-carboxyglutamate protein" | |
1546 /db_xref="CGNC:49764" | |
1547 /db_xref="GeneID:396348" | |
1548 CDS 19..312 | |
1549 /gene="BGLAP" | |
1550 /gene_synonym="BGP" | |
1551 /note="osteocalcin; gamma-carboxyglutamic acid-containing | |
1552 protein; bone Gla protein; bone gamma-carboxyglutamate | |
1553 (gla) protein (osteocalcin)" | |
1554 /codon_start=1 | |
1555 /product="osteocalcin preproprotein" | |
1556 /protein_id="NP_990718.2" | |
1557 /db_xref="CGNC:49764" | |
1558 /db_xref="GeneID:396348" | |
1559 /translation="MKAAALLLLAALLTFSLCRSAPDGSDARSAKAFISHRASAEMVR | |
1560 RQKRHYAQDSGVAGAPPNPLEAQREVCELSPDCDELADQIGFQEAYRRFYGPV" | |
1561 sig_peptide 19..78 | |
1562 /gene="BGLAP" | |
1563 /gene_synonym="BGP" | |
1564 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
1565 ORIGIN | |
1566 1 ctgcagtgga gctgcaccat gaaggccgcg gctctgctgc tcctcgcggc gctgctcaca | |
1567 61 ttcagcctct gccgcagcgc gccggacggc tcggatgctc gcagtgctaa agccttcatc | |
1568 121 tcccaccgcg ccagcgccga gatggtgcgc aggcagaagc ggcactacgc ccaggacagc | |
1569 181 ggcgtcgccg gagctccccc caaccccctg gaggcccaac gagaggtgtg tgagctgagc | |
1570 241 cccgactgcg acgagttggc cgaccagatc ggcttccagg aggcgtaccg ccgcttctac | |
1571 301 ggccccgtct gagccccccc ggggctcaac gccccctccc cacccccacc tccccccact | |
1572 361 ccccccatta tgctccactt ctccgcgaag gatggacaga aataaaggca gagcgcaggg | |
1573 421 ca | |
1574 // | |
1575 | |
1576 LOCUS NM_001115017 5206 bp mRNA linear VRT 05-JAN-2017 | |
1577 DEFINITION Gallus gallus selenoprotein O (SELENOO), mRNA. | |
1578 ACCESSION NM_001115017 XM_415989 | |
1579 VERSION NM_001115017.3 | |
1580 KEYWORDS RefSeq. | |
1581 SOURCE Gallus gallus (chicken) | |
1582 ORGANISM Gallus gallus | |
1583 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
1584 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
1585 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
1586 Phasianidae; Phasianinae; Gallus. | |
1587 REFERENCE 1 (bases 1 to 5206) | |
1588 AUTHORS Gladyshev VN, Arner ES, Berry MJ, Brigelius-Flohe R, Bruford EA, | |
1589 Burk RF, Carlson BA, Castellano S, Chavatte L, Conrad M, Copeland | |
1590 PR, Diamond AM, Driscoll DM, Ferreiro A, Flohe L, Green FR, Guigo | |
1591 R, Handy DE, Hatfield DL, Hesketh J, Hoffmann PR, Holmgren A, | |
1592 Hondal RJ, Howard MT, Huang K, Kim HY, Kim IY, Kohrle J, Krol A, | |
1593 Kryukov GV, Lee BJ, Lee BC, Lei XG, Liu Q, Lescure A, Lobanov AV, | |
1594 Loscalzo J, Maiorino M, Mariotti M, Sandeep Prabhu K, Rayman MP, | |
1595 Rozovsky S, Salinas G, Schmidt EE, Schomburg L, Schweizer U, | |
1596 Simonovic M, Sunde RA, Tsuji PA, Tweedie S, Ursini F, Whanger PD | |
1597 and Zhang Y. | |
1598 TITLE Selenoprotein Gene Nomenclature | |
1599 JOURNAL J. Biol. Chem. 291 (46), 24036-24040 (2016) | |
1600 PUBMED 27645994 | |
1601 REFERENCE 2 (bases 1 to 5206) | |
1602 AUTHORS Mariotti M, Ridge PG, Zhang Y, Lobanov AV, Pringle TH, Guigo R, | |
1603 Hatfield DL and Gladyshev VN. | |
1604 TITLE Composition and evolution of the vertebrate and mammalian | |
1605 selenoproteomes | |
1606 JOURNAL PLoS ONE 7 (3), E33066 (2012) | |
1607 PUBMED 22479358 | |
1608 REFERENCE 3 (bases 1 to 5206) | |
1609 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
1610 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
1611 TITLE A comprehensive collection of chicken cDNAs | |
1612 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
1613 PUBMED 12445392 | |
1614 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The | |
1615 reference sequence was derived from AADN04000481.1. | |
1616 On Jan 5, 2017 this sequence version replaced gi:1071347966. | |
1617 | |
1618 Summary: This gene encodes a selenoprotein containing the rare | |
1619 amino acid, selenocysteine (Sec). Sec is encoded by the UGA codon, | |
1620 which normally signals translation termination. The 3' UTRs of | |
1621 selenoprotein mRNAs contain a conserved stem-loop structure, | |
1622 designated the Sec insertion sequence (SECIS) element, that is | |
1623 necessary for the recognition of UGA as a Sec codon, rather than as | |
1624 a stop signal. The exact function of this selenoprotein is not | |
1625 known, but it is thought to have redox activity. [provided by | |
1626 RefSeq, Jan 2017]. | |
1627 | |
1628 Sequence Note: The RefSeq transcript and protein were derived from | |
1629 genomic sequence to make the sequence consistent with the reference | |
1630 genome assembly. The genomic coordinates used for the transcript | |
1631 record were based on alignments. | |
1632 | |
1633 ##RefSeq-Attributes-START## | |
1634 protein contains selenocysteine :: inferred from conservation | |
1635 ##RefSeq-Attributes-END## | |
1636 COMPLETENESS: complete on the 3' end. | |
1637 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
1638 1-580 AADN04000481.1 98952-99531 | |
1639 581-784 AADN04000481.1 100620-100823 | |
1640 785-965 AADN04000481.1 101605-101785 | |
1641 966-1096 AADN04000481.1 105511-105641 | |
1642 1097-1377 AADN04000481.1 106033-106313 | |
1643 1378-1528 AADN04000481.1 106627-106777 | |
1644 1529-1714 AADN04000481.1 107159-107344 | |
1645 1715-1871 AADN04000481.1 107853-108009 | |
1646 1872-5206 AADN04000481.1 108660-111994 | |
1647 FEATURES Location/Qualifiers | |
1648 source 1..5206 | |
1649 /organism="Gallus gallus" | |
1650 /mol_type="mRNA" | |
1651 /db_xref="taxon:9031" | |
1652 /chromosome="1" | |
1653 /map="1" | |
1654 /breed="Red Jungle Fowl" | |
1655 gene 1..5206 | |
1656 /gene="SELENOO" | |
1657 /gene_synonym="SELO" | |
1658 /note="selenoprotein O" | |
1659 /db_xref="CGNC:50587" | |
1660 /db_xref="GeneID:417745" | |
1661 CDS 48..2060 | |
1662 /gene="SELENOO" | |
1663 /gene_synonym="SELO" | |
1664 /note="UGA stop codon recoded as selenocysteine" | |
1665 /codon_start=1 | |
1666 /transl_except=(pos:2049..2051,aa:Sec) | |
1667 /product="selenoprotein O" | |
1668 /protein_id="NP_001108489.3" | |
1669 /db_xref="CGNC:50587" | |
1670 /db_xref="GeneID:417745" | |
1671 /translation="MAAALRRRRSVLSLRVFCTAMQRSAGPPSRPGSPERADGGGWLS | |
1672 ALRFDNLALRSLPVDPSEDCAPRAVPGACFARVRPTPLRNPRLVAMSAPALALLGLEA | |
1673 GGPEAEREAEAALYFSGNRLLPGSEPAAHCYCGHQFGSFAGQLGDGAAIYLGEVRGPR | |
1674 GARWELQLKGAGITPFSRQADGRKVLRSSIREFLCSEAMFHLGIPTTRAGTCVTSDSE | |
1675 VVRDIFYDGNPKKERCTVVLRIASTFIRFGSFEIFKPPDEYTGRKGPSVNRNDIRIQM | |
1676 LDYVIGTFYPEIQEAHADNSIQRNAAFFKEITKRTARLVAEWQCVGFCHGVLNTDNMS | |
1677 IVGLTIDYGPFGFMDRYDPEHICNGSDNTGRYAYNKQPEICKWNLGKLAEALVPELPL | |
1678 EISELILEEEYDAEFEKHYLQKMRKKLGLIQLELEEDSKLVSELLETMHLTGGDFTNI | |
1679 FYLLSSFSVDTDPSRLEDFLEKLISQCASVEELRVAFKPQMDPRQLSMMLMLAQSNPQ | |
1680 LFALIGTKANINKELERIEQFSKLQQLTAADLLSRNKRHWTEWLEKYRVRLHKEVESI | |
1681 SDVDAWNTERVKVMNSNNPKYILRNYIAQNAIEAAENGDFSEVRNVLKLLENPFQETE | |
1682 DSTEMETKEEEATATAAACAQATRSRLSYCSKPPLWASELCVTUSS" | |
1683 misc_feature 2049..2051 | |
1684 /gene="SELENOO" | |
1685 /gene_synonym="SELO" | |
1686 /note="Selenocysteine; other site" | |
1687 stem_loop 2364..2438 | |
1688 /gene="SELENOO" | |
1689 /gene_synonym="SELO" | |
1690 /note="SECIS_element" | |
1691 regulatory 5171..5176 | |
1692 /regulatory_class="polyA_signal_sequence" | |
1693 /gene="SELENOO" | |
1694 /gene_synonym="SELO" | |
1695 polyA_site 5206 | |
1696 /gene="SELENOO" | |
1697 /gene_synonym="SELO" | |
1698 ORIGIN | |
1699 1 ctgcggctgt gcggagcggc gggcggggcc tctccggggg cgggcggatg gccgcggcgc | |
1700 61 tgcgccgccg ccgctcggtg ctgtcgctgc gcgtcttctg caccgccatg cagcgctcgg | |
1701 121 cgggtcctcc gtcgcggccg ggcagccccg agcgggcgga cggggggggc tggctgagcg | |
1702 181 cgctgcgctt cgacaacctg gcgctgcgct cgctgccggt cgacccttcc gaggactgcg | |
1703 241 ctccgcgagc cgtgcccggc gcctgcttcg cccgggtgcg gcccaccccg ctgcgcaacc | |
1704 301 cgcggctcgt ggccatgtcg gcgcccgcgc tggcgctgct ggggctggag gccggcggcc | |
1705 361 ccgaagccga gcgggaggcg gaggccgccc tgtacttcag cgggaaccga ctgctgcccg | |
1706 421 gctcggagcc cgcggcgcac tgctactgcg ggcaccagtt cggcagcttc gcggggcagc | |
1707 481 tgggtgacgg cgccgccatc tacctgggcg aggtgcgcgg accgcgcggc gcccgctggg | |
1708 541 agctgcagct gaagggcgcc gggatcaccc ccttctcccg gcaagccgat ggtcggaagg | |
1709 601 tcctgcggtc aagcatacgg gagttcctgt gcagcgaggc catgttccac cttggaattc | |
1710 661 caacaacgag ggctggaacc tgtgtgacat ctgactcaga agttgttcgt gacatatttt | |
1711 721 atgatggaaa tccaaaaaaa gaaaggtgta cagttgttct gaggatagct tctacattta | |
1712 781 taagatttgg ttcttttgag attttcaaac cccctgatga gtatacagga cgcaaaggtc | |
1713 841 ccagcgttaa ccggaatgat attcggatac agatgctgga ttacgtgatc ggcactttct | |
1714 901 acccagaaat ccaggaggcg catgcagaca acagcattca gaggaatgca gctttcttca | |
1715 961 aggagataac aaagcggacg gcaagattgg ttgctgagtg gcagtgtgtt ggcttttgcc | |
1716 1021 atggtgtgct gaatacggat aacatgagca tagttggact aactattgac tatggccctt | |
1717 1081 ttggatttat ggacagatat gaccctgagc acatctgcaa tggctctgat aacacagggc | |
1718 1141 gctatgctta caacaaacag ccagagattt gcaagtggaa tctagggaag cttgctgaag | |
1719 1201 ccttagtccc agagctgccc ttggaaataa gtgagctcat cctggaagaa gaatatgatg | |
1720 1261 cagaatttga aaaacattat ttgcagaaga tgaggaagaa actaggccta attcagttgg | |
1721 1321 aattagaaga agatagtaag ctggtgtctg aactacttga aaccatgcat ctcacaggtg | |
1722 1381 gagacttcac aaatattttt tacttgctga gttcattctc agtagatact gatccttcaa | |
1723 1441 gactggaaga tttcttagaa aagcttatca gtcagtgtgc ttcagtggaa gaactgagag | |
1724 1501 ttgctttcaa acctcagatg gatccaagac aactgtcaat gatgttgatg ttggctcagt | |
1725 1561 ctaatcctca gctgtttgca ctcattggaa caaaagctaa tataaataaa gaattagaac | |
1726 1621 gcatcgaaca attctctaaa ctgcagcagt taacagcagc tgatttactc agcagaaata | |
1727 1681 aaaggcactg gacagaatgg ctggagaaat acagagtccg tttacacaaa gaagtagaaa | |
1728 1741 gcattagtga tgttgatgcc tggaatactg aacgtgtgaa ggttatgaat tccaacaatc | |
1729 1801 caaaatacat cttgagaaac tacattgctc agaatgccat agaagcagct gaaaatgggg | |
1730 1861 atttctcaga ggtgagaaat gtattgaaac tcttggaaaa tccattccaa gaaacagaag | |
1731 1921 attccacgga gatggagaca aaagaggagg aagcaactgc tacagcagct gcttgtgctc | |
1732 1981 aagcaaccag aagcaggctg tcgtattgca gtaaacctcc actctgggct tcagagctct | |
1733 2041 gtgttacatg atcttcgtaa ctgccttgtt ttattttttg ctgtaagctg aagactgtga | |
1734 2101 tcctccttca gcagtgaaga attgagcaag gcaacaatcg aagtgctatt aagttattga | |
1735 2161 aacaacccta catttggatg cacctacaac agtcttcagc tgtgcttatt ttagagcagt | |
1736 2221 ttcggatcct tggaacgagc tgataatgct ggacagtctg tacaaatcgt ttctctgtgt | |
1737 2281 gttttgagac tgaaagcctt ccctttattc ataacacatt gcagtgtttt ctgttgagac | |
1738 2341 ccgctgactt ttgaacatcc aaatggagtt gttacgtgaa gacaaaagta tcaagtcagg | |
1739 2401 aatctgatct gtttttgtct gatgtcttaa ctaatagtac ttctaacatc tattcgctgc | |
1740 2461 tctttctatg cagggatttc tgctcctcta taacagagga atagattcag cgatgcttgt | |
1741 2521 tttaagccat gattcagtta attagttcat ttattgtgaa cctttaggtt gatatttaat | |
1742 2581 ctttattttc acagagtctg caggcagggg gctgaggggg aaatgaacaa acgggtgggt | |
1743 2641 tttgttcttt tttgtgttct attatgtata atacataaag agcagaattg agggagactg | |
1744 2701 tatatttgca cttgaaaacc ttggtggtga agtcagttca gattcacaat gtttacgtac | |
1745 2761 agtatacacg tgtgtaaatg tttgcaaaag ccatggatgc agtttgtaag ccagctgtaa | |
1746 2821 gttgactcag gcaaattcag ttgcctaatt gagcacgaat tgtacgggtg accccagaac | |
1747 2881 tcacatacgg gttccttgcg ttgatctgtg tactgctgcc acagttctcc ttgagagaag | |
1748 2941 cacgcagctg ggatgcctgt tcacagtggg cagtgagatg cttccattcc cactgtggtc | |
1749 3001 cggcgtgtct tactttgctt ctgtggcttt tgagaagttt tacactgtaa agagaggaac | |
1750 3061 gtactacttg aggaatgtgc tatttgagca gtgtgtaaaa gattctagag gaggacggga | |
1751 3121 gctgacttgc ttgaaaatgt attgataata tttcagttgg tttcatttga gattttaggg | |
1752 3181 ggaaatctgt ttcttctatt gccatgtcgg caaaaatgaa agaaggtccc aagttaaagg | |
1753 3241 tttgactgtg ctttctgagc ttatttctga agggctctgg ttcacatatc cttgtgcaag | |
1754 3301 tctgatgtgg tgcaaaggtt tctcttttct aaagaggcca ctgtcttcca ctgtgagttt | |
1755 3361 aagggcagtc tactaaatag ctctttgccc ctgtacaggt caggtattag ctcaggttga | |
1756 3421 aatgtgctct tttaagtctt cctcaaataa cgagctatgg agaaacaggg agaaagctgg | |
1757 3481 actgctgcct gtccagttct gctaataatg agtttgttct tgctgccgca gtaaataggt | |
1758 3541 gatgttttga atgcagacat tcattctgtc ttgtgtttga cttagagaag ctgatgctaa | |
1759 3601 gtaacgtctg tggcaaatga gaatctgaca aacacggcac ctcctgtgac atctcagagt | |
1760 3661 cctgactgaa aaggatcaat gtgaagaagt gtctgtccag cttggggcag aacggtgcat | |
1761 3721 gtggaagagg atgtgccttc aagaaggcag cagtaatgtg ggggctggag tggatgatcc | |
1762 3781 cttccagccc gtacagttct gtgattctgt aatgcttgct ggtgcagctg gttgtctcct | |
1763 3841 ggaagcaacc catttctgga ggagtttgac agctgaagtg accattatca ggcattatcc | |
1764 3901 ttcattgaac atggggactt ctgacaccaa accacctcat ggaagctctt actgcgaggc | |
1765 3961 agggctgggt aaggactgcg ccagggaagt ggtctaaagt ggtgatttta aaccatacct | |
1766 4021 cagggaatta tgacgttact ttattttggg gtatgagtag atcttgttaa tgcatggagg | |
1767 4081 agaatggtat tatagcactg tatttggaca caggagatgg tgactactga attagtttcc | |
1768 4141 atataaagca gcacattaat ttgccattgt gataccaaac tcatggagag agaaagaggg | |
1769 4201 agatactttg aaatagctag caaatttatc cttaaaaagg gatgccaaat gtaaaagtgt | |
1770 4261 gaagaatgaa aacgtagggt acattgccaa ctgaatgcat tcttaagtgt gaatcaggtg | |
1771 4321 caagaggcct ggaaagcttg aaatcatgac tagagaaggc tcatggtgtg gctgcgttgg | |
1772 4381 tgtgccactt aaggctgtgt ttgtcacagt tacaccgtgc tcaccagctg tgagtacgct | |
1773 4441 ctccatgttt ctgccagggc tgagctgttg gcgttgaact gcttggtttc tcagtgcatg | |
1774 4501 caataatgct ctgtatttga gtaacagtga caactggaag cccaatagaa tactcgtgct | |
1775 4561 cttctagcgc cttcattcca aaaggcaaat gagtttcagc tcatcgatag tcacttcgtt | |
1776 4621 ctgttcccag agcagtgtgg aagtgggagc ttgttaagga cagttcaacg aagcttagcc | |
1777 4681 tagctaagaa cttcatcttt taggtcagct cttcagagag aaggaaatac agcttgtaac | |
1778 4741 atttgagagt ctgaatattt gaatcataaa tcactgcttg tttgtttttt tttttagagc | |
1779 4801 tcatatgtgc tgtacttagg cctgaaaata attatttctg atcagaaact ctgcttatag | |
1780 4861 aaaaagactt ttaggttcag aatgaatttg tgactcttca acaccaccag tggtgttctt | |
1781 4921 tggaagccct ttggttgcac tttggtcctc tgcctataca acccgacccg ccattgcctg | |
1782 4981 aaggcaggtg gctcccaggg gcccagcagc ctcacactgc agtggggctc ctcttgtgac | |
1783 5041 tgagatctca ccatcactgc ttcctcagct tgtagagcta tcattgcctc atgtttgact | |
1784 5101 gtcagtgttc tctttggaac gtttgtttgt ttctcttcag acaaatgctg ctactgtctt | |
1785 5161 taattctttt attaaaagaa aaaatacatc cgaaatgcaa ttttaa | |
1786 // | |
1787 | |
1788 LOCUS NM_204843 2593 bp mRNA linear VRT 11-JAN-2017 | |
1789 DEFINITION Gallus gallus RAP1 GTPase activating protein 1 (RAP1GAP1), mRNA. | |
1790 ACCESSION NM_204843 | |
1791 VERSION NM_204843.3 | |
1792 KEYWORDS RefSeq. | |
1793 SOURCE Gallus gallus (chicken) | |
1794 ORGANISM Gallus gallus | |
1795 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
1796 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
1797 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
1798 Phasianidae; Phasianinae; Gallus. | |
1799 REFERENCE 1 (bases 1 to 2593) | |
1800 AUTHORS Jordan JD, Carey KD, Stork PJ and Iyengar R. | |
1801 TITLE Modulation of rap activity by direct interaction of Galpha(o) with | |
1802 Rap1 GTPase-activating protein | |
1803 JOURNAL J. Biol. Chem. 274 (31), 21507-21510 (1999) | |
1804 PUBMED 10419452 | |
1805 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
1806 preliminary review. The reference sequence was derived from | |
1807 AADN04000390.1. | |
1808 On Dec 24, 2016 this sequence version replaced gi:933123823. | |
1809 | |
1810 Sequence Note: The RefSeq transcript and protein were derived from | |
1811 genomic sequence to make the sequence consistent with the reference | |
1812 genome assembly. The genomic coordinates used for the transcript | |
1813 record were based on alignments. | |
1814 | |
1815 ##Evidence-Data-START## | |
1816 RNAseq introns :: single sample supports all introns SAMEA2201363, | |
1817 SAMEA2201366 [ECO:0000348] | |
1818 ##Evidence-Data-END## | |
1819 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
1820 1-57 AADN04000390.1 662088-662144 | |
1821 58-151 AADN04000390.1 667485-667578 | |
1822 152-187 AADN04000390.1 668072-668107 | |
1823 188-235 AADN04000390.1 670735-670782 | |
1824 236-274 AADN04000390.1 671444-671482 | |
1825 275-460 AADN04000390.1 671587-671772 | |
1826 461-564 AADN04000390.1 682414-682517 | |
1827 565-643 AADN04000390.1 684441-684519 | |
1828 644-697 AADN04000390.1 684831-684884 | |
1829 698-781 AADN04000390.1 684969-685052 | |
1830 782-882 AADN04000390.1 685308-685408 | |
1831 883-1012 AADN04000390.1 686679-686808 | |
1832 1013-1168 AADN04000390.1 687059-687214 | |
1833 1169-1240 AADN04000390.1 691346-691417 | |
1834 1241-1327 AADN04000390.1 691614-691700 | |
1835 1328-1462 AADN04000390.1 692326-692460 | |
1836 1463-1609 AADN04000390.1 694002-694148 | |
1837 1610-1713 AADN04000390.1 695372-695475 | |
1838 1714-1830 AADN04000390.1 697551-697667 | |
1839 1831-2593 AADN04000390.1 700093-700855 | |
1840 FEATURES Location/Qualifiers | |
1841 source 1..2593 | |
1842 /organism="Gallus gallus" | |
1843 /mol_type="mRNA" | |
1844 /db_xref="taxon:9031" | |
1845 /chromosome="1" | |
1846 /map="1" | |
1847 /breed="Red Jungle Fowl" | |
1848 gene 1..2593 | |
1849 /gene="RAP1GAP1" | |
1850 /gene_synonym="RAP1; RAP1GA1; RAP1GAP" | |
1851 /note="RAP1 GTPase activating protein 1" | |
1852 /db_xref="CGNC:10901" | |
1853 /db_xref="GeneID:395647" | |
1854 CDS 170..1840 | |
1855 /gene="RAP1GAP1" | |
1856 /gene_synonym="RAP1; RAP1GA1; RAP1GAP" | |
1857 /note="GTPase activating protein Rap1-GAP; GTPase | |
1858 activating protein 1" | |
1859 /codon_start=1 | |
1860 /product="RAP1 GTPase activating protein" | |
1861 /protein_id="NP_990174.1" | |
1862 /db_xref="CGNC:10901" | |
1863 /db_xref="GeneID:395647" | |
1864 /translation="MIEKMQGSRLDEQRCSLPAPLKTEEEYIPYPSIHEVLQKGWPYP | |
1865 LIILPQFGGYWIEGTSHNLSSPALSDVPFPWSVKVKLESDPTAKLYRKHFLGKEHQNF | |
1866 YSSDVSLGYLILSVKYEQSEKQENLRLLLRTRTGTKHDLIPISCLNEFPNAVQMAKLL | |
1867 CENVNVERFFPVLYPKASQLIVAFDEHVISNNFKFGVIYQKPGQTTEEEVFSNTEESL | |
1868 GFLEFLDFLGDKIQLQDFRGFRGGLDVIRGQTGTESVYTNFRGKEIMFHVSTKLPFAE | |
1869 GDSQQLQRKRHIGNDIVAIIFQDESTPFVPDMIASNFLHAYVVVQLTHSSSGETLYKV | |
1870 SVTARDDVPFFGPSLPNPAIFRKSTEFREFLLVKLINAEYSCYRAEKFAKLKERTRSA | |
1871 LLESLFEELQLRSRCMMGLPVEEDDKTENGSGGFFENFKRVIRGRSQSLDTMGISMRK | |
1872 QQPATMPSRPTTAGLALSQSVAEGPKAIAASFALPGRSPSRTRTSRFHGRRSSAIGIE | |
1873 NIQEEKSRDIAERIQKVVDSPETLLDLKSDGSSSPSSPEFPSRKSKHI" | |
1874 ORIGIN | |
1875 1 agctgggttc cccgtctcca tccgcttgcc agctggggat gagagaacct tgctcaggag | |
1876 61 gtctgaggag ggagtgtgtt gtgtcagtaa tgttatagat tctcctatcc aaggcattcc | |
1877 121 atctgctctt gcttttgctg ctcccaacaa gactgtggac ttgtttgaga tgattgaaaa | |
1878 181 aatgcagggg agtcgtctgg atgaacaaag atgttccctt ccagctcctc tcaagacaga | |
1879 241 agaagagtat attccttacc ccagcatcca tgaggtatta cagaaggggt ggccatatcc | |
1880 301 cctcattatc ttaccccagt ttgggggcta ctggattgaa gggacaagcc acaacctctc | |
1881 361 cagtccagct ctgtctgatg taccctttcc ctggagtgtt aaagtgaaac tggagagcga | |
1882 421 ccccacagcc aagctatacc gcaagcattt cctagggaag gagcaccaga acttttattc | |
1883 481 cagtgatgtg tccttgggct acttgatact ttctgtgaag tatgaacagt ctgagaaaca | |
1884 541 ggaaaatcta cgtttgttgc tgaggacacg aactggtacc aaacatgatc tgatccccat | |
1885 601 ttcctgtcta aatgagtttc ctaatgctgt ccagatggca aagctactgt gtgaaaatgt | |
1886 661 gaatgttgaa cgcttctttc ctgtcctcta tcccaaggct tcacagctta ttgttgcatt | |
1887 721 tgatgaacat gtcataagca ataacttcaa atttggggta atctaccaga aacctggaca | |
1888 781 gacaactgaa gaggaagtct tcagtaacac ggaagagagt ctgggattcc tggagttctt | |
1889 841 ggatttcctt ggtgacaaga ttcagctgca ggatttccgt gggttccggg gaggtttgga | |
1890 901 tgtcatcaga ggtcaaacgg gcaccgaatc agtttataca aatttccggg gcaaagaaat | |
1891 961 catgtttcat gtatctacaa aactgccctt cgctgaagga gattcccaac agcttcagcg | |
1892 1021 gaagcgtcac attgggaatg acattgtagc catcatcttc caggatgaaa gcacaccttt | |
1893 1081 tgtgcctgat atgatcgctt ctaatttcct acatgcatat gtggtagttc agctcactca | |
1894 1141 cagcagtagt ggggagaccc tctacaaggt ttcagtcaca gcccgagatg atgtgccctt | |
1895 1201 ctttggacct tctctaccaa atccagccat atttagaaag agtacagagt ttcgtgaatt | |
1896 1261 ccttctggtc aagctcatca atgctgaata cagctgctat agagctgaaa aatttgctaa | |
1897 1321 actaaaggag agaacccgaa gtgctctctt ggagagcctt tttgaggagc tgcagcttcg | |
1898 1381 cagccgttgt atgatgggac tgcccgtaga agaagatgac aagacagaga atggcagcgg | |
1899 1441 gggcttcttt gagaatttca agcgggtgat cagaggccgc agccagagcc tggataccat | |
1900 1501 ggggatatcc atgagaaagc agcagccagc caccatgccc agccgcccga cgacagctgg | |
1901 1561 ccttgctctg agccagagtg ttgccgaggg ccctaaggcc attgctgcgt cttttgcctt | |
1902 1621 gcctggtagg agcccatcac gtactcgaac cagccgtttc catgggcgac ggagtagtgc | |
1903 1681 cattggcatt gagaacatac aggaggaaaa gagcagagac attgcagaga ggatacagaa | |
1904 1741 ggtggtagac agtccagaaa ctttgcttga cctgaaatct gatggatcat ccagtcccag | |
1905 1801 ttccccagag ttccccagca ggaagagcaa acacatctga atggggacat caagccaatc | |
1906 1861 aggagtggac cggatgctac taattgctta cctcactgaa gatactggca ggacatttgg | |
1907 1921 ggtgaaatga gagtactggc taaaaggaac acgaacttag aggacctcaa ggactgtgga | |
1908 1981 aagaccaagt gacaccacat aatgcttcac tggcagtccc tggagcagga atcacggaga | |
1909 2041 gggagaagga cagagagatt ctattggagc attttgactc tagggccttc ccattgtcca | |
1910 2101 atcagcagtc actgaaccag actctacaaa tgctggggga aaggaggcta ccttgagcat | |
1911 2161 ctcttcttct cttcccttac atattcaaaa agagaattaa gtcaaaagca gaacacactt | |
1912 2221 ccacctctgt ctctagtaag cactagagat ggattacata gtttaggaag tgcaacgcaa | |
1913 2281 agaaagagga tgaagaaatc tgctgaggaa ggatgctgag aacaggatat ttagtggaaa | |
1914 2341 tttaggtccc agctcatttt attgattggc tctgacaaga gagaagtatg ttagccttca | |
1915 2401 tttccttcaa aatatatttc ctaacttctt gaggaaatat cttcggccta tactggcctt | |
1916 2461 gcctttattg tcctctctat tgcatgctgg catgtaatat gcctggggct ttaggtttca | |
1917 2521 gtactgcttg taggtcgaga ccggccacgt tttgcagtgt ttctgaagga ataaatatat | |
1918 2581 ttaatatatt gaa | |
1919 // | |
1920 | |
1921 LOCUS NM_001347710 1730 bp mRNA linear VRT 11-JAN-2017 | |
1922 DEFINITION Gallus gallus solute carrier family 2 member 11-like 1 (SLC2A11L1), | |
1923 mRNA. | |
1924 ACCESSION NM_001347710 | |
1925 VERSION NM_001347710.1 | |
1926 KEYWORDS RefSeq. | |
1927 SOURCE Gallus gallus (chicken) | |
1928 ORGANISM Gallus gallus | |
1929 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
1930 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
1931 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
1932 Phasianidae; Phasianinae; Gallus. | |
1933 COMMENT INFERRED REFSEQ: This record is predicted by genome sequence | |
1934 analysis and is not yet supported by experimental evidence. The | |
1935 reference sequence was derived from AADN04000193.1. | |
1936 | |
1937 Sequence Note: The RefSeq transcript and protein were derived from | |
1938 genomic sequence to make the sequence consistent with the reference | |
1939 genome assembly. The genomic coordinates used for the transcript | |
1940 record were based on alignments. | |
1941 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
1942 1-37 AADN04000193.1 2454708-2454744 c | |
1943 38-136 AADN04000193.1 2453259-2453357 c | |
1944 137-297 AADN04000193.1 2452126-2452286 c | |
1945 298-422 AADN04000193.1 2451462-2451586 c | |
1946 423-552 AADN04000193.1 2451106-2451235 c | |
1947 553-701 AADN04000193.1 2450715-2450863 c | |
1948 702-889 AADN04000193.1 2449978-2450165 c | |
1949 890-1000 AADN04000193.1 2449289-2449399 c | |
1950 1001-1102 AADN04000193.1 2448895-2448996 c | |
1951 1103-1178 AADN04000193.1 2448469-2448544 c | |
1952 1179-1306 AADN04000193.1 2448013-2448140 c | |
1953 1307-1730 AADN04000193.1 2446851-2447274 c | |
1954 FEATURES Location/Qualifiers | |
1955 source 1..1730 | |
1956 /organism="Gallus gallus" | |
1957 /mol_type="mRNA" | |
1958 /db_xref="taxon:9031" | |
1959 /chromosome="15" | |
1960 /map="15" | |
1961 /breed="Red Jungle Fowl" | |
1962 gene 1..1730 | |
1963 /gene="SLC2A11L1" | |
1964 /note="solute carrier family 2 member 11-like 1" | |
1965 /db_xref="CGNC:50386" | |
1966 /db_xref="GeneID:416935" | |
1967 misc_feature 14..16 | |
1968 /gene="SLC2A11L1" | |
1969 /note="upstream in-frame stop codon" | |
1970 CDS 32..1513 | |
1971 /gene="SLC2A11L1" | |
1972 /note="solute carrier family 2, facilitated glucose | |
1973 transporter member 11-like 1" | |
1974 /codon_start=1 | |
1975 /product="solute carrier family 2, facilitated glucose | |
1976 transporter member 11-like" | |
1977 /protein_id="NP_001334639.1" | |
1978 /db_xref="CGNC:50386" | |
1979 /db_xref="GeneID:416935" | |
1980 /translation="MQKMSYNLFLLAFVLGIGGTFQYGLQISIINSPAEYIKSFIRET | |
1981 WLKRYGSSPSEEITTLMWSFIVSIYTIGGLLGSMCVKYMSVTFGRKKSMLLANIPALL | |
1982 SATLMALSRLSGSFEMIIIGRLFAGVCAGLGLNIHIMYVGECAPQKLRGVIAITASTA | |
1983 IAVGKFAGFALGLREVLGVEALWPVLMAANAIPALIQLLTLPFFPDSPRYLLIDKKDK | |
1984 EGCIKAVKQLWGDGDHMAEVDDMIAEQEAIRGEKSKSVCDLVRDKSVRWQFITLFLVS | |
1985 SCMQLIGVNVVYFYAYNVFLKVGLSPSQTRYVSLGVGITEILTTALCGFLVDRAGRKA | |
1986 LLWKSHTAMALALGLLTITLALQDSFSWTPYCSAALIFIFIMSFGLGPAGVLCPLPTE | |
1987 IFIQSYRPAAYAFNGASNWIQLFFLGLLFPFIVEGLGSFCFIIFLAYCLSMAIFVYLV | |
1988 VPETKGKTMLQIMEEFNRLNYRGKKGQEALQQNNCSLTTVTRL" | |
1989 ORIGIN | |
1990 1 tcagcctgca agctgagatg accacctttg catgcaaaaa atgagctaca atctcttcct | |
1991 61 cctggctttt gtcctgggca ttggtggaac tttccagtat gggttgcaga tctccattat | |
1992 121 caactctcct gccgagtaca tcaagagttt catacgtgag acctggctga agagatacgg | |
1993 181 atcttctccc agtgaagaga taactacttt gatgtggtcc tttattgtgt ccatttacac | |
1994 241 cattggtggg ctcctgggct ccatgtgtgt caaatacatg tctgttacat ttggaaggaa | |
1995 301 gaagtccatg ctgcttgcca acatccctgc tctgttgagt gcaactctca tggcactcag | |
1996 361 tcggctgtct gggtcctttg agatgatcat cattgggaga ttatttgctg gagtgtgtgc | |
1997 421 aggtttaggt ctgaatatcc atatcatgta tgtgggggag tgtgccccac agaagctgcg | |
1998 481 tggggtgatt gccataactg cttccactgc cattgccgtg ggaaagtttg caggatttgc | |
1999 541 tctgggtctc agagaagttc tgggagtaga agctctgtgg cccgttctta tggcagcaaa | |
2000 601 tgcaattcct gccctcattc agctgctcac cctccccttc ttcccagact ctccccgcta | |
2001 661 cctgctcatt gacaaaaagg acaaggaagg ctgcatcaaa gctgtgaagc agctctgggg | |
2002 721 ggatggtgac cacatggccg aagtggatga catgattgca gagcaagaag ccatccgtgg | |
2003 781 ggagaaatct aagagtgttt gtgaccttgt tcgtgacaaa tccgtccgtt ggcagttcat | |
2004 841 cactctcttt cttgtctcct catgcatgca gttaattgga gtcaatgtgg tttactttta | |
2005 901 tgcatacaat gtcttcttaa aagttggact ctccccttcc caaacccgct acgtctccct | |
2006 961 gggagttggg atcaccgaga tcctcaccac agctctgtgt ggcttcctgg tggaccgtgc | |
2007 1021 tgggaggaag gcactgctat ggaaatccca cactgctatg gccttggcgt taggacttct | |
2008 1081 caccatcaca cttgctctac aggattcttt ctcctggaca ccatattgct ctgctgcact | |
2009 1141 catttttatc ttcatcatga gcttcggtct tgggccagct ggagtattat gccccctgcc | |
2010 1201 cacagaaata tttattcagt catacagacc agctgcttat gcttttaatg gtgcttcaaa | |
2011 1261 ctggattcag ctcttctttc ttggactttt gttccctttc attgtggaag gccttggtag | |
2012 1321 tttttgtttc atcattttcc tggcatactg tctgtccatg gctatctttg tctacctggt | |
2013 1381 agtgccagag actaaaggaa agaccatgtt gcagatcatg gaggagttca accgcctgaa | |
2014 1441 ctaccgcgga aagaagggac aggaagccct acagcagaat aactgctcat tgacaactgt | |
2015 1501 tactagactt tagtgacaaa ctctccactc catattctgt tattttatta ctgttgtgac | |
2016 1561 cagaagcctc actaaacaaa agagattcta ttgctcctag acagtacaaa tgtgtattaa | |
2017 1621 aagtagtggc ctgctgtgca ggatgaactt ggtggttccc tccaactgcc gaaatatgaa | |
2018 1681 ctgaattaaa tgctcagcac aaaaagaagg aaggaaggaa ggaaggaagg | |
2019 // | |
2020 | |
2021 LOCUS NM_001328355 1672 bp mRNA linear VRT 12-JAN-2017 | |
2022 DEFINITION Gallus gallus alanyl-tRNA synthetase domain containing 1 (AARSD1), | |
2023 mRNA. | |
2024 ACCESSION NM_001328355 XM_015299626 | |
2025 VERSION NM_001328355.1 | |
2026 KEYWORDS RefSeq. | |
2027 SOURCE Gallus gallus (chicken) | |
2028 ORGANISM Gallus gallus | |
2029 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
2030 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
2031 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
2032 Phasianidae; Phasianinae; Gallus. | |
2033 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
2034 preliminary review. The reference sequence was derived from | |
2035 AADN04000464.1. | |
2036 On Jun 16, 2016 this sequence version replaced gi:971435455. | |
2037 | |
2038 Sequence Note: The RefSeq transcript and protein were derived from | |
2039 genomic sequence to make the sequence consistent with the reference | |
2040 genome assembly. The genomic coordinates used for the transcript | |
2041 record were based on alignments. | |
2042 | |
2043 ##Evidence-Data-START## | |
2044 RNAseq introns :: mixed/partial sample support SAMEA2201357, | |
2045 SAMEA2201358 [ECO:0000350] | |
2046 ##Evidence-Data-END## | |
2047 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
2048 1-137 AADN04000464.1 140118-140254 | |
2049 138-260 AADN04000464.1 140338-140460 | |
2050 261-420 AADN04000464.1 140531-140690 | |
2051 421-478 AADN04000464.1 141038-141095 | |
2052 479-635 AADN04000464.1 141448-141604 | |
2053 636-752 AADN04000464.1 141702-141818 | |
2054 753-883 AADN04000464.1 142010-142140 | |
2055 884-950 AADN04000464.1 142305-142371 | |
2056 951-1042 AADN04000464.1 142536-142627 | |
2057 1043-1097 AADN04000464.1 143233-143287 | |
2058 1098-1192 AADN04000464.1 143746-143840 | |
2059 1193-1672 AADN04000464.1 144002-144481 | |
2060 FEATURES Location/Qualifiers | |
2061 source 1..1672 | |
2062 /organism="Gallus gallus" | |
2063 /mol_type="mRNA" | |
2064 /db_xref="taxon:9031" | |
2065 /chromosome="27" | |
2066 /map="27" | |
2067 /breed="Red Jungle Fowl" | |
2068 gene 1..1672 | |
2069 /gene="AARSD1" | |
2070 /note="alanyl-tRNA synthetase domain containing 1" | |
2071 /db_xref="CGNC:72048" | |
2072 /db_xref="GeneID:107049007" | |
2073 CDS 99..1328 | |
2074 /gene="AARSD1" | |
2075 /note="alanyl-tRNA editing protein Aarsd1-like" | |
2076 /codon_start=1 | |
2077 /product="alanyl-tRNA editing protein Aarsd1" | |
2078 /protein_id="NP_001315284.1" | |
2079 /db_xref="CGNC:72048" | |
2080 /db_xref="GeneID:107049007" | |
2081 /translation="MVFRCQRDSWARQFATRVVSCREAELRPESGGEPMRGFQVVLED | |
2082 TILFPEGGGQPDDRGLIGAVPVLRVTRRGAEAVHFVETALEPGSAVLLSLDWERRFDH | |
2083 MQQHSGQHLITAIAEQMFGFKTTSWELGRQQSVIELDTPSMTTEQMEALEQSVNEKIR | |
2084 ERIPVTVRELAADDPEVETVRSRGLPGDHTGPVRVVDIEGIDSNMCCGTHVSNLSDLQ | |
2085 VIKLICTEKGKKNKTNLVFLAGNRVLKSVEQSHRTEKALTSLLKNGPGEHVEAVKRLQ | |
2086 SSVKLLQKNNLNLLRDIAVLIARDFKSKPVQSPLFVLHRKEGDSEFMNIIANEIGKEE | |
2087 TLLFLTVGDEKEAGLFLLAGSVEAVENLGPRVAELLEGKGAGKRGRYQGKATKMSRRG | |
2088 EVQALLQEFISQQTDEA" | |
2089 ORIGIN | |
2090 1 cgcatccgcc gctctgcagg ccccgcccgc cggtttctcc cgccggccgt ccgctgttcc | |
2091 61 tggttcgccg tctctccgca gcacggggtg ccgccgccat ggtgttccgg tgccagcggg | |
2092 121 acagctgggc tcggcagttc gccaccaggg tggtgtcgtg tcgggaggcc gagctgcggc | |
2093 181 ctgagagcgg tggggaaccg atgcgcggct tccaggtggt gctggaggac acgatcctct | |
2094 241 tccccgaggg cggcgggcag cccgatgacc gcggcctcat cggcgccgtc ccggtgctgc | |
2095 301 gcgtcacccg gcgcggcgcc gaggccgtgc acttcgtgga gacggcgctg gagccgggca | |
2096 361 gcgccgtgct gctgtcgttg gactgggagc gccgcttcga tcacatgcag cagcactcgg | |
2097 421 gacagcacct catcactgcc atagcggagc agatgtttgg attcaaaaca acttcatggg | |
2098 481 agctgggccg gcaacagagt gtcattgagc tggacacccc ctccatgacc acggagcaaa | |
2099 541 tggaggccct ggagcagagt gtgaatgaga agatccggga gaggatacct gtgacagtgc | |
2100 601 gggaactggc tgcagatgac cctgaggttg aaacagtgag aagccgcggc ttgccaggtg | |
2101 661 accacacggg gccagttcga gttgtagaca ttgaaggcat agactccaac atgtgctgtg | |
2102 721 ggactcatgt ctccaacctg agtgacttgc aggttattaa acttatttgc accgagaaag | |
2103 781 ggaaaaagaa caaaaccaac ttggttttcc tggcaggaaa tagagtgctg aagtcagttg | |
2104 841 aacaaagtca ccgtactgag aaggccctaa cctcactgct gaaaaatgga ccgggtgaac | |
2105 901 atgtagaggc tgtgaagaga ttgcagagtt ctgtgaaact tcttcagaag aataatttga | |
2106 961 acctgctaag agacattgcg gttttgatag cccgggattt caaaagcaaa cctgttcaaa | |
2107 1021 gtccgctgtt tgtcttacac aggaaagagg gtgactctga gtttatgaac atcatcgcta | |
2108 1081 atgagattgg gaaagaggaa accctgctgt tcctgactgt gggagatgaa aaggaagcag | |
2109 1141 gactctttct tctagctgga tctgttgaag cagttgagaa tttaggtccc agggtggcag | |
2110 1201 agctgctgga aggcaaagga gctgggaagc gaggccgcta ccagggcaag gcaaccaaga | |
2111 1261 tgagtcgtcg aggagaagtg caagctctgc tccaggaatt catcagtcaa caaacagatg | |
2112 1321 aagcgtaaag aaagaatttt gaaagtaggg ctgtcatccc tgctttgtag gatctccact | |
2113 1381 aagttctctc ccagagaata aagacaaaaa aagtcccatg taaaatccca tggagttagg | |
2114 1441 aaggactcct actcaatgtc tctccagctt gccatttctg ccagcggttc ccaaggctgc | |
2115 1501 tacaacttca gctgcagaaa caaaaggggc actgaagagc tgtggtcaaa aagcacctga | |
2116 1561 tacgggactg ggtagtgttg ttttttttcc cctcctagaa caggcatggc aggtttagtc | |
2117 1621 tggatgttga taataaacag aaaaataaag acagacaaat ctccatccta aa | |
2118 // | |
2119 | |
2120 LOCUS NM_001328354 747 bp mRNA linear VRT 12-JAN-2017 | |
2121 DEFINITION Gallus gallus prostaglandin E synthase 3 (cytosolic)-like | |
2122 (PTGES3L), mRNA. | |
2123 ACCESSION NM_001328354 XM_015299630 | |
2124 VERSION NM_001328354.1 | |
2125 KEYWORDS RefSeq. | |
2126 SOURCE Gallus gallus (chicken) | |
2127 ORGANISM Gallus gallus | |
2128 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
2129 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
2130 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
2131 Phasianidae; Phasianinae; Gallus. | |
2132 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
2133 preliminary review. The reference sequence was derived from | |
2134 AADN04000464.1. | |
2135 On Jun 16, 2016 this sequence version replaced gi:971435462. | |
2136 | |
2137 Sequence Note: This RefSeq record was created from transcript and | |
2138 genomic sequence data to make the sequence consistent with the | |
2139 reference genome assembly. The genomic coordinates used for the | |
2140 transcript record were based on transcript alignments. | |
2141 | |
2142 ##Evidence-Data-START## | |
2143 RNAseq introns :: single sample supports all introns SAMEA2201358 | |
2144 [ECO:0000348] | |
2145 ##Evidence-Data-END## | |
2146 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
2147 1-94 AADN04000464.1 137996-138089 | |
2148 95-208 AADN04000464.1 138453-138566 | |
2149 209-275 AADN04000464.1 138674-138740 | |
2150 276-374 AADN04000464.1 138937-139035 | |
2151 375-464 AADN04000464.1 139379-139468 | |
2152 465-518 AADN04000464.1 139557-139610 | |
2153 519-747 AADN04000464.1 139788-140016 | |
2154 FEATURES Location/Qualifiers | |
2155 source 1..747 | |
2156 /organism="Gallus gallus" | |
2157 /mol_type="mRNA" | |
2158 /db_xref="taxon:9031" | |
2159 /chromosome="27" | |
2160 /map="27" | |
2161 /breed="Red Jungle Fowl" | |
2162 gene 1..747 | |
2163 /gene="PTGES3L" | |
2164 /gene_synonym="PTGES3L-AARSD1" | |
2165 /note="prostaglandin E synthase 3 (cytosolic)-like" | |
2166 /db_xref="CGNC:2079" | |
2167 /db_xref="GeneID:420013" | |
2168 CDS 87..530 | |
2169 /gene="PTGES3L" | |
2170 /gene_synonym="PTGES3L-AARSD1" | |
2171 /note="PTGES3L-AARSD1 readthrough" | |
2172 /codon_start=1 | |
2173 /product="putative protein PTGES3L" | |
2174 /protein_id="NP_001315283.1" | |
2175 /db_xref="CGNC:2079" | |
2176 /db_xref="GeneID:420013" | |
2177 /translation="MARQHAKTLWYDRPRYVFLEFCVEDSTDVQVVIEDHRLVFSCKN | |
2178 ADGVEFYNEINLYARVNSKDSREKRSDRSITCFMRKWKEKVAWPRITKENIKPAWLSV | |
2179 DFDNWRDWEGDEEVERAMVEEYAELLQKVTDKAPPPTMDDLDDDL" | |
2180 ORIGIN | |
2181 1 ccttgaggct gggagggagc gggaggagaa gcgcccggcc ccgttcccga cggtccgaag | |
2182 61 tagtgcggcg cggggccggc acggacatgg cgaggcaaca cgcaaagaca ctgtggtatg | |
2183 121 accgcccacg gtatgttttc ctggagttct gcgtggagga cagcacagat gttcaggttg | |
2184 181 tcattgagga ccaccgattg gtgttcagct gcaaaaacgc agatggagta gaattctaca | |
2185 241 atgagatcaa cctgtatgcc agggtgaact ccaaggactc acgagagaaa cgttctgacc | |
2186 301 gctccatcac atgctttatg aggaagtgga aggagaaagt ggcctggccc cgcatcacca | |
2187 361 aggagaacat caagccagcc tggctctccg ttgactttga caactggcga gactgggaag | |
2188 421 gggatgagga ggtggagagg gccatggtgg aggagtacgc agagctcctg cagaaggtga | |
2189 481 cggacaaggc cccccccccg accatggatg acctggatga cgacctctga agcccagctc | |
2190 541 ctcatagaca gcgcggctcc tcaaagccct ccccgtgcgc cagcagcgca cagcaacgag | |
2191 601 ccgggacacg ggcgaggaaa gcggagcccc gaggaacgac gccggtttgc ggcagagtgc | |
2192 661 ggcggacccc aaagcacggc ggcgagagct gcacgctctt ccagtgccga ttacgcgcgg | |
2193 721 ggcaataaac gcgaaccgct gccgcga | |
2194 // | |
2195 | |
2196 LOCUS NM_001278102 1362 bp mRNA linear VRT 11-JAN-2017 | |
2197 DEFINITION Gallus gallus adipogenesis associated, Mth938 domain containing | |
2198 (AAMDC), transcript variant 2, mRNA. | |
2199 ACCESSION NM_001278102 | |
2200 VERSION NM_001278102.2 | |
2201 KEYWORDS RefSeq. | |
2202 SOURCE Gallus gallus (chicken) | |
2203 ORGANISM Gallus gallus | |
2204 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
2205 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
2206 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
2207 Phasianidae; Phasianinae; Gallus. | |
2208 REFERENCE 1 (bases 1 to 1362) | |
2209 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
2210 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
2211 TITLE A comprehensive collection of chicken cDNAs | |
2212 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
2213 PUBMED 12445392 | |
2214 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
2215 preliminary review. The reference sequence was derived from | |
2216 BX930541.1, BU315144.1 and AADN04000352.1. | |
2217 On Feb 11, 2016 this sequence version replaced gi:493796791. | |
2218 | |
2219 Transcript Variant: This variant (2) lacks an alternate exon in the | |
2220 5' UTR compared to variant 1. All three variants encode the same | |
2221 protein. | |
2222 | |
2223 Sequence Note: This RefSeq record was created from transcript and | |
2224 genomic sequence data from different strains to make the sequence | |
2225 consistent with the reference genome assembly. The genomic | |
2226 coordinates used for the transcript record were based on transcript | |
2227 alignments. | |
2228 | |
2229 ##Evidence-Data-START## | |
2230 Transcript exon combination :: BU315144.1, BM488034.1 [ECO:0000332] | |
2231 RNAseq introns :: single sample supports all introns | |
2232 SAMEA2201376 [ECO:0000348] | |
2233 ##Evidence-Data-END## | |
2234 COMPLETENESS: complete on the 3' end. | |
2235 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
2236 1-50 BX930541.1 1-50 | |
2237 51-713 BU315144.1 1-663 | |
2238 714-1362 AADN04000352.1 548393-549041 c | |
2239 FEATURES Location/Qualifiers | |
2240 source 1..1362 | |
2241 /organism="Gallus gallus" | |
2242 /mol_type="mRNA" | |
2243 /db_xref="taxon:9031" | |
2244 /chromosome="1" | |
2245 /map="1" | |
2246 /breed="Leghorn" | |
2247 gene 1..1362 | |
2248 /gene="AAMDC" | |
2249 /gene_synonym="C11orf6; C1H11ORF67; CK067; PTD015" | |
2250 /note="adipogenesis associated, Mth938 domain containing" | |
2251 /db_xref="CGNC:52510" | |
2252 /db_xref="GeneID:425610" | |
2253 misc_feature 117..119 | |
2254 /gene="AAMDC" | |
2255 /gene_synonym="C11orf6; C1H11ORF67; CK067; PTD015" | |
2256 /note="upstream in-frame stop codon" | |
2257 CDS 156..524 | |
2258 /gene="AAMDC" | |
2259 /gene_synonym="C11orf6; C1H11ORF67; CK067; PTD015" | |
2260 /note="UPF0366 protein C11orf67; adipogenesis associated | |
2261 Mth938 domain-containing protein" | |
2262 /codon_start=1 | |
2263 /product="mth938 domain-containing protein" | |
2264 /protein_id="NP_001265031.1" | |
2265 /db_xref="CGNC:52510" | |
2266 /db_xref="GeneID:425610" | |
2267 /translation="MSSPEIASLSWGQMKVKGCSTTYKDCKVWPGGSRTWDWRETGTN | |
2268 HSPGVQPADLEEVVKKGVKTLVIGRGMSEALQVPPSTVDYLKKNGIDVLVLQTEKAVA | |
2269 EYNALAAQGVKVGGVFHSTC" | |
2270 ORIGIN | |
2271 1 gaagggcggg gcttcgcgct tcccacccgt gtgaggccgt ggtggcggtt gttggggttg | |
2272 61 gggtcgcgcg gttcagaagg tcgttacctt cgagacgcag ctgctggcag ccacactgat | |
2273 121 caaaagcatt tccaagactt tggttcaact cagtgatgtc ttcccctgaa attgcttccc | |
2274 181 tgtcttgggg acagatgaag gtgaaaggct gctctacaac atacaaggac tgcaaagtat | |
2275 241 ggccaggagg aagtcggacc tgggattgga gagaaactgg gactaatcat tctccaggag | |
2276 301 tgcagccggc tgaccttgaa gaagttgtca agaagggtgt taaaactctc gtgattggcc | |
2277 361 gtggcatgag tgaggctctg caggttcctc catctaccgt ggactatctc aagaaaaatg | |
2278 421 ggattgatgt gttggtgttg cagacagaga aggcagtggc agagtacaat gccctggctg | |
2279 481 ctcagggtgt caaagtgggg ggagtcttcc actcaacgtg ctgaagcact gctgctttgc | |
2280 541 agcctgccct gacctcagcc aagtgctggg catgccttgg ctgcatcaaa ttacacccag | |
2281 601 cacagtgggg aggtgcgtgc caatgcatta atgtgcgctg caaagctgaa atgcaagggc | |
2282 661 agtttatgag ttcagggttt aaacagagtg ctgttaatga aatcttttaa ctgcagaaca | |
2283 721 gtttgcatac gttcttggga ttgacctaat cttcctctga agactgtctg cattctggtt | |
2284 781 acttttaggc taaattaatg aactctggtt aatttttggc taaattaaga ctcttaagtt | |
2285 841 gtgaatgctt tgattagaaa atggtgcgga attacattaa tagttactgt attgtagcca | |
2286 901 gaaaacatat gatgacgaca gtcaagtggt aggtatgaag tagtggtaaa ggatcacttt | |
2287 961 attaatgagt ttagaaaaaa gacaaaacac aaggcagccc ctgagcaaca gctctgcctc | |
2288 1021 ctgctggtga actcactcag tgcataactt gacacttctt tacgccagac atagaaaaag | |
2289 1081 ctgtctatgg ggaatgaaca gaatctgtgc cttaaagatt tttatcaatt gaaatgtgag | |
2290 1141 tgttgagttg tggaatatgt atctatgtga aagtccctac ctacttaaaa tgatcaggaa | |
2291 1201 gatctgccac agaattgctt gtaggaaatc agtctaagtt gctgctagca agcttgggga | |
2292 1261 tggaggtaga attcttaccc agcagaagct gctggtttaa acattatgac aagtgtgttg | |
2293 1321 ttacatcaaa aaaattaaaa gttcttttag ttgttgttct cc | |
2294 // | |
2295 | |
2296 LOCUS NM_001278100 1526 bp mRNA linear VRT 11-JAN-2017 | |
2297 DEFINITION Gallus gallus adipogenesis associated, Mth938 domain containing | |
2298 (AAMDC), transcript variant 1, mRNA. | |
2299 ACCESSION NM_001278100 XM_003640599 XM_003640600 XM_424622 | |
2300 VERSION NM_001278100.2 | |
2301 KEYWORDS RefSeq. | |
2302 SOURCE Gallus gallus (chicken) | |
2303 ORGANISM Gallus gallus | |
2304 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
2305 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
2306 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
2307 Phasianidae; Phasianinae; Gallus. | |
2308 REFERENCE 1 (bases 1 to 1526) | |
2309 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
2310 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
2311 TITLE A comprehensive collection of chicken cDNAs | |
2312 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
2313 PUBMED 12445392 | |
2314 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
2315 preliminary review. The reference sequence was derived from | |
2316 BX930541.1, BU315144.1 and AADN04000352.1. | |
2317 On Feb 11, 2016 this sequence version replaced gi:493796415. | |
2318 | |
2319 Transcript Variant: This variant (1) represents the longest | |
2320 transcript. All three variants encode the same protein. | |
2321 | |
2322 Sequence Note: This RefSeq record was created from transcript and | |
2323 genomic sequence data from different strains to make the sequence | |
2324 consistent with the reference genome assembly. The genomic | |
2325 coordinates used for the transcript record were based on transcript | |
2326 alignments. | |
2327 | |
2328 ##Evidence-Data-START## | |
2329 Transcript exon combination :: BX930541.1, BU304087.1 [ECO:0000332] | |
2330 RNAseq introns :: single sample supports all introns | |
2331 SAMEA2201376 [ECO:0000348] | |
2332 ##Evidence-Data-END## | |
2333 COMPLETENESS: complete on the 3' end. | |
2334 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
2335 1-267 BX930541.1 1-267 | |
2336 268-877 BU315144.1 54-663 | |
2337 878-1526 AADN04000352.1 548393-549041 c | |
2338 FEATURES Location/Qualifiers | |
2339 source 1..1526 | |
2340 /organism="Gallus gallus" | |
2341 /mol_type="mRNA" | |
2342 /db_xref="taxon:9031" | |
2343 /chromosome="1" | |
2344 /map="1" | |
2345 /breed="Leghorn" | |
2346 gene 1..1526 | |
2347 /gene="AAMDC" | |
2348 /gene_synonym="C11orf6; C1H11ORF67; CK067; PTD015" | |
2349 /note="adipogenesis associated, Mth938 domain containing" | |
2350 /db_xref="CGNC:52510" | |
2351 /db_xref="GeneID:425610" | |
2352 misc_feature 281..283 | |
2353 /gene="AAMDC" | |
2354 /gene_synonym="C11orf6; C1H11ORF67; CK067; PTD015" | |
2355 /note="upstream in-frame stop codon" | |
2356 CDS 320..688 | |
2357 /gene="AAMDC" | |
2358 /gene_synonym="C11orf6; C1H11ORF67; CK067; PTD015" | |
2359 /note="UPF0366 protein C11orf67; adipogenesis associated | |
2360 Mth938 domain-containing protein" | |
2361 /codon_start=1 | |
2362 /product="mth938 domain-containing protein" | |
2363 /protein_id="NP_001265029.1" | |
2364 /db_xref="CGNC:52510" | |
2365 /db_xref="GeneID:425610" | |
2366 /translation="MSSPEIASLSWGQMKVKGCSTTYKDCKVWPGGSRTWDWRETGTN | |
2367 HSPGVQPADLEEVVKKGVKTLVIGRGMSEALQVPPSTVDYLKKNGIDVLVLQTEKAVA | |
2368 EYNALAAQGVKVGGVFHSTC" | |
2369 ORIGIN | |
2370 1 gaagggcggg gcttcgcgct tcccacccgt gtgaggccgt ggtggcggtt gttggggttg | |
2371 61 gggtcgcgcg gggcgctgag atggatgtca cgtcgtgctg ctgtctcttg tagtgtgtgc | |
2372 121 agcataggaa gacaatccaa agacttctct ttgctgaggg ctcttccttt aatgggtgcc | |
2373 181 accggggttc tgagagtctg gatgtcttga aggatctgct gctgagggtt tctggttcag | |
2374 241 aaggtcgtta ccttcgagac gcagctgctg gcagccacac tgatcaaaag catttccaag | |
2375 301 actttggttc aactcagtga tgtcttcccc tgaaattgct tccctgtctt ggggacagat | |
2376 361 gaaggtgaaa ggctgctcta caacatacaa ggactgcaaa gtatggccag gaggaagtcg | |
2377 421 gacctgggat tggagagaaa ctgggactaa tcattctcca ggagtgcagc cggctgacct | |
2378 481 tgaagaagtt gtcaagaagg gtgttaaaac tctcgtgatt ggccgtggca tgagtgaggc | |
2379 541 tctgcaggtt cctccatcta ccgtggacta tctcaagaaa aatgggattg atgtgttggt | |
2380 601 gttgcagaca gagaaggcag tggcagagta caatgccctg gctgctcagg gtgtcaaagt | |
2381 661 ggggggagtc ttccactcaa cgtgctgaag cactgctgct ttgcagcctg ccctgacctc | |
2382 721 agccaagtgc tgggcatgcc ttggctgcat caaattacac ccagcacagt ggggaggtgc | |
2383 781 gtgccaatgc attaatgtgc gctgcaaagc tgaaatgcaa gggcagttta tgagttcagg | |
2384 841 gtttaaacag agtgctgtta atgaaatctt ttaactgcag aacagtttgc atacgttctt | |
2385 901 gggattgacc taatcttcct ctgaagactg tctgcattct ggttactttt aggctaaatt | |
2386 961 aatgaactct ggttaatttt tggctaaatt aagactctta agttgtgaat gctttgatta | |
2387 1021 gaaaatggtg cggaattaca ttaatagtta ctgtattgta gccagaaaac atatgatgac | |
2388 1081 gacagtcaag tggtaggtat gaagtagtgg taaaggatca ctttattaat gagtttagaa | |
2389 1141 aaaagacaaa acacaaggca gcccctgagc aacagctctg cctcctgctg gtgaactcac | |
2390 1201 tcagtgcata acttgacact tctttacgcc agacatagaa aaagctgtct atggggaatg | |
2391 1261 aacagaatct gtgccttaaa gatttttatc aattgaaatg tgagtgttga gttgtggaat | |
2392 1321 atgtatctat gtgaaagtcc ctacctactt aaaatgatca ggaagatctg ccacagaatt | |
2393 1381 gcttgtagga aatcagtcta agttgctgct agcaagcttg gggatggagg tagaattctt | |
2394 1441 acccagcaga agctgctggt ttaaacatta tgacaagtgt gttgttacat caaaaaaatt | |
2395 1501 aaaagttctt ttagttgttg ttctcc | |
2396 // | |
2397 | |
2398 LOCUS NM_001278104 1297 bp mRNA linear VRT 11-JAN-2017 | |
2399 DEFINITION Gallus gallus adipogenesis associated, Mth938 domain containing | |
2400 (AAMDC), transcript variant 3, mRNA. | |
2401 ACCESSION NM_001278104 | |
2402 VERSION NM_001278104.2 | |
2403 KEYWORDS RefSeq. | |
2404 SOURCE Gallus gallus (chicken) | |
2405 ORGANISM Gallus gallus | |
2406 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
2407 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
2408 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
2409 Phasianidae; Phasianinae; Gallus. | |
2410 REFERENCE 1 (bases 1 to 1297) | |
2411 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
2412 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
2413 TITLE A comprehensive collection of chicken cDNAs | |
2414 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
2415 PUBMED 12445392 | |
2416 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
2417 preliminary review. The reference sequence was derived from | |
2418 BX930541.1, BU296789.1 and AADN04000352.1. | |
2419 On Feb 11, 2016 this sequence version replaced gi:493797437. | |
2420 | |
2421 Transcript Variant: This variant (3) lacks two alternate 5' UTR | |
2422 exons compared to variant 1. All three variants encode the same | |
2423 protein. | |
2424 | |
2425 Sequence Note: This RefSeq record was created from transcript and | |
2426 genomic sequence data from different strains to make the sequence | |
2427 consistent with the reference genome assembly. The genomic | |
2428 coordinates used for the transcript record were based on transcript | |
2429 alignments. | |
2430 | |
2431 ##Evidence-Data-START## | |
2432 Transcript exon combination :: BX930513.1, BU296789.1 [ECO:0000332] | |
2433 RNAseq introns :: single sample supports all introns | |
2434 SAMEA2201358, SAMEA2201376 | |
2435 [ECO:0000348] | |
2436 ##Evidence-Data-END## | |
2437 COMPLETENESS: complete on the 3' end. | |
2438 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
2439 1-28 BX930541.1 1-28 | |
2440 29-694 BU296789.1 1-666 | |
2441 695-1297 AADN04000352.1 548393-548995 c | |
2442 FEATURES Location/Qualifiers | |
2443 source 1..1297 | |
2444 /organism="Gallus gallus" | |
2445 /mol_type="mRNA" | |
2446 /db_xref="taxon:9031" | |
2447 /chromosome="1" | |
2448 /map="1" | |
2449 /breed="Leghorn" | |
2450 gene 1..1297 | |
2451 /gene="AAMDC" | |
2452 /gene_synonym="C11orf6; C1H11ORF67; CK067; PTD015" | |
2453 /note="adipogenesis associated, Mth938 domain containing" | |
2454 /db_xref="CGNC:52510" | |
2455 /db_xref="GeneID:425610" | |
2456 CDS 91..459 | |
2457 /gene="AAMDC" | |
2458 /gene_synonym="C11orf6; C1H11ORF67; CK067; PTD015" | |
2459 /note="UPF0366 protein C11orf67; adipogenesis associated | |
2460 Mth938 domain-containing protein" | |
2461 /codon_start=1 | |
2462 /product="mth938 domain-containing protein" | |
2463 /protein_id="NP_001265033.1" | |
2464 /db_xref="CGNC:52510" | |
2465 /db_xref="GeneID:425610" | |
2466 /translation="MSSPEIASLSWGQMKVKGCSTTYKDCKVWPGGSRTWDWRETGTN | |
2467 HSPGVQPADLEEVVKKGVKTLVIGRGMSEALQVPPSTVDYLKKNGIDVLVLQTEKAVA | |
2468 EYNALAAQGVKVGGVFHSTC" | |
2469 ORIGIN | |
2470 1 gaagggcggg gcttcgcgct tcccacccgt gtgaggccgt ggtggcggtt gttggggttg | |
2471 61 gggtcgcgcg gactttggtt caactcagtg atgtcttccc ctgaaattgc ttccctgtct | |
2472 121 tggggacaga tgaaggtgaa aggctgctct acaacataca aggactgcaa agtatggcca | |
2473 181 ggaggaagtc ggacctggga ttggagagaa actgggacta atcattctcc aggagtgcag | |
2474 241 ccggctgacc ttgaagaagt tgtcaagaag ggtgttaaaa ctctcgtgat tggccgtggc | |
2475 301 atgagtgagg ctctgcaggt tcctccatct accgtggact atctcaagaa aaatgggatt | |
2476 361 gatgtgttgg tgttgcagac agagaaggca gtggcagagt acaatgccct ggctgctcag | |
2477 421 ggtgtcaaag tggggggagt cttccactca acgtgctgaa gcactgctgc tttgcagcct | |
2478 481 gccctgacct cagccaagtg ctgggcatgc cttggctgca tcaaattaca cccagcacag | |
2479 541 tggggaggtg cgtgccaatg cattaatgtg cgctgcaaag ctgaaatgca agggcagttt | |
2480 601 atgagttcag ggtttaaaca gagtgctgtt aatgaaatct tttaactgca gaacagtttg | |
2481 661 catacgttct tgggattgac ctaatcttcc tctgaagact gtctgcattc tggttacttt | |
2482 721 taggctaaat taatgaactc tggttaattt ttggctaaat taagactctt aagttgtgaa | |
2483 781 tgctttgatt agaaaatggt gcggaattac attaatagtt actgtattgt agccagaaaa | |
2484 841 catatgatga cgacagtcaa gtggtaggta tgaagtagtg gtaaaggatc actttattaa | |
2485 901 tgagtttaga aaaaagacaa aacacaaggc agcccctgag caacagctct gcctcctgct | |
2486 961 ggtgaactca ctcagtgcat aacttgacac ttctttacgc cagacataga aaaagctgtc | |
2487 1021 tatggggaat gaacagaatc tgtgccttaa agatttttat caattgaaat gtgagtgttg | |
2488 1081 agttgtggaa tatgtatcta tgtgaaagtc cctacctact taaaatgatc aggaagatct | |
2489 1141 gccacagaat tgcttgtagg aaatcagtct aagttgctgc tagcaagctt ggggatggag | |
2490 1201 gtagaattct tacccagcag aagctgctgg tttaaacatt atgacaagtg tgttgttaca | |
2491 1261 tcaaaaaaat taaaagttct tttagttgtt gttctcc | |
2492 // | |
2493 | |
2494 LOCUS NM_001006176 3248 bp mRNA linear VRT 11-JAN-2017 | |
2495 DEFINITION Gallus gallus coronin 7 (CORO7), mRNA. | |
2496 ACCESSION NM_001006176 XM_414966 | |
2497 VERSION NM_001006176.2 | |
2498 KEYWORDS RefSeq. | |
2499 SOURCE Gallus gallus (chicken) | |
2500 ORGANISM Gallus gallus | |
2501 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
2502 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
2503 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
2504 Phasianidae; Phasianinae; Gallus. | |
2505 REFERENCE 1 (bases 1 to 3248) | |
2506 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
2507 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
2508 P, Hayashizaki Y and Buerstedde JM. | |
2509 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
2510 gene function analysis | |
2511 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
2512 PUBMED 15642098 | |
2513 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
2514 preliminary review. The reference sequence was derived from | |
2515 BM426249.1 and AJ719722.1. | |
2516 On Mar 21, 2015 this sequence version replaced gi:57525130. | |
2517 | |
2518 ##Evidence-Data-START## | |
2519 Transcript exon combination :: AJ719722.1 [ECO:0000332] | |
2520 RNAseq introns :: mixed/partial sample support | |
2521 SAMEA2201357, SAMEA2201358 | |
2522 [ECO:0000350] | |
2523 ##Evidence-Data-END## | |
2524 COMPLETENESS: complete on the 3' end. | |
2525 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
2526 1-312 BM426249.1 1-312 | |
2527 313-3248 AJ719722.1 10-2945 | |
2528 FEATURES Location/Qualifiers | |
2529 source 1..3248 | |
2530 /organism="Gallus gallus" | |
2531 /mol_type="mRNA" | |
2532 /db_xref="taxon:9031" | |
2533 /chromosome="14" | |
2534 /map="14" | |
2535 /breed="Commercial broiler, Ottawa Research Centre, | |
2536 leghorn" | |
2537 gene 1..3248 | |
2538 /gene="CORO7" | |
2539 /gene_synonym="CORO7-PAM16; coronin-7" | |
2540 /note="coronin 7" | |
2541 /db_xref="CGNC:50317" | |
2542 /db_xref="GeneID:416670" | |
2543 misc_feature 308..310 | |
2544 /gene="CORO7" | |
2545 /gene_synonym="CORO7-PAM16; coronin-7" | |
2546 /note="upstream in-frame stop codon" | |
2547 CDS 347..3118 | |
2548 /gene="CORO7" | |
2549 /gene_synonym="CORO7-PAM16; coronin-7" | |
2550 /note="CORO7-PAM16 readthrough" | |
2551 /codon_start=1 | |
2552 /product="coronin-7" | |
2553 /protein_id="NP_001006176.1" | |
2554 /db_xref="CGNC:50317" | |
2555 /db_xref="GeneID:416670" | |
2556 /translation="MNRFKASKFRHTEARLPRREAWIGGLRASSVASYGNHVEASCRW | |
2557 VASSAEATGVLGIVPLEGRDGGKRTVSQLCCHSDAVTDFDFSPFDPFLLATGSADEMV | |
2558 KVWRLPEEGQELPSSAGLMLGPGGGTVDMLQFHPTADGILTSGVGKRVTVWDVGQQQP | |
2559 LTALEAHGDQLQSLSWKHDGRLLGTSCKDKKLRILDPRASPAASQSVPGHENNKDSRL | |
2560 LWMGASDCLISVGFSQMREREVKLWDTRKFSGATFTLALDTSSGAVIPLYDADTGLLV | |
2561 LAGKGENLLYCLEAAPAQPALTQVTQCLMEGPTRGLATVPRLALDVMACEVLRVLQLT | |
2562 DTFLVPVSYIVPRKSNQEFHEDLFPDCAGMLPATDAQAWWAGDSQQVGRVSLHPARRP | |
2563 TETFCSPLITAAPSTQLPDDGPVDSDRSEGSGYSSPSGSLTSPSSAGASLSTSTGPSS | |
2564 GFVSSPSQKSLQSILGPSSRFRHTQGTVLHRDSHITNLRGLSLTTPGESDGFCANHQR | |
2565 VALPLLSAGGQIAVLELSKPGRLPDVAVPTIQNGAAVSDLSWDPFDPQRLAVAGEDAK | |
2566 IRLWRVPEGGLQDTLQEPEAVLRGHTEKIYSIRFHPVAADLLVSSSYDMTVRIWDLGA | |
2567 GREVLCLQGHTDQIFSLAWSPDGRKLATVSKDGRLRLFEPRCSLQPQQEGPGPEGGRG | |
2568 ARVVWVCGGDFLLVSGFDSRSERRILLYRAQALSDGPLYVLGLDVAPSTLLPFYDEDT | |
2569 SVVFLTGKGDTRVFLYEVTPEPPYFLECNSFTSSDPHKGFVFLRKTACDVREVEFARA | |
2570 LRLGQSSLEPVAFRVPRVKKEYFQEDIFPPTRVWWEPALSASAWLGGADGQQNRAELR | |
2571 PADMVPVSQAPKEAPARKFVPAAVYLGEKTDEQKKEELLSAMVARLGNRHDPLPQDSF | |
2572 EGVDEAEWD" | |
2573 ORIGIN | |
2574 1 gatccgggct gctccgcccg cgcggcgacg gcgacgggga cggcccgtgg gcgacacggc | |
2575 61 ggggcgcggg gctcttcgcc cgcttccctg acagctgcgg ttgtgctcgc tgccgggggc | |
2576 121 ggaccggcag cctcctgacg tcccgccgtg ttgtgcgtgg agcagctgct gccaggcgcc | |
2577 181 gagggcggcc ggctcagcga gggcggacag ctgccggcct gcagagcccc caacccgcgc | |
2578 241 ggcgcagagc ggcccggccg cgccctgccc tgccctggcc gtgccgcggg gcggggcggg | |
2579 301 gcggggctga gggcggcgcg gcgcggcgcg gcggtcccgg cgcaccatga accgcttcaa | |
2580 361 ggcgtccaag ttccggcaca ccgaggcccg gctgccccgc agggaggcct ggattggggg | |
2581 421 tctccgagcc agctctgttg catcctatgg gaaccatgtg gaggccagct gccgctgggt | |
2582 481 cgcctccagt gctgaggcaa caggagtgct gggcatcgtg ccactggagg gcagggacgg | |
2583 541 aggcaagagg accgtgtctc agctctgctg ccactcagat gcagtgacag actttgactt | |
2584 601 ctcacccttt gacccattcc tgctggccac aggctccgct gatgaaatgg tgaaggtttg | |
2585 661 gcgcctgcct gaggaaggcc aggagctgcc cagcagtgca gggctgatgt tgggtcctgg | |
2586 721 tgggggcaca gtggacatgc tgcagtttca cccaacggca gatggcatcc tgaccagtgg | |
2587 781 tgtgggaaag cgggtcactg tgtgggatgt ggggcagcag cagccgctga cagcactgga | |
2588 841 ggcccatggg gaccagctgc agagcctatc ctggaagcat gatggccgcc tgcttggcac | |
2589 901 ctcctgcaag gacaagaaac tgcggatcct tgaccctcga gccagcccag ctgcatccca | |
2590 961 gagtgtccca ggacatgaga acaacaagga ctcccggctg ctctggatgg gagccagcga | |
2591 1021 ttgcctcatc tccgtggggt tcagccagat gcgtgagcgg gaggtgaagc tctgggacac | |
2592 1081 gcggaaattc agtggcgcga ctttcacctt ggcactggac acctcatctg gggccgtgat | |
2593 1141 cccactgtat gacgccgaca cggggctgct ggtgctggcg gggaagggag aaaacctcct | |
2594 1201 gtactgcttg gaggcggcac cggctcagcc tgcactcacc caagtcactc agtgcctgat | |
2595 1261 ggagggaccc acacggggcc tggccaccgt cccccgcctg gccctggacg tcatggcctg | |
2596 1321 cgaggtgctc cgcgtcctgc agctcaccga caccttcctc gtccctgtca gctacatcgt | |
2597 1381 gccccgcaag tccaaccagg agttccacga ggatctgttc cctgactgcg ctgggatgct | |
2598 1441 gccggccaca gatgcccagg cctggtgggc aggggacagc cagcaggtgg ggagggtgag | |
2599 1501 cctgcacccg gcacggagac ccacagagac cttctgttcc ccactcatca ccgccgcacc | |
2600 1561 cagcacccag ctgcctgatg acggccccgt ggattccgac cgcagtgaag gcagtggcta | |
2601 1621 ctcttcaccc tctggctcgc tgacctcacc gagcagcgct ggcgcctcac tctccaccag | |
2602 1681 cactggcccc tccagtggct tcgtcagcag ccccagccag aagtcactgc agagtatttt | |
2603 1741 ggggcccagc tcccgcttcc ggcacacaca gggcacagtg ctgcaccgtg acagccacat | |
2604 1801 aaccaacctg cgggggctga gcctcaccac gccgggcgag agcgacggct tctgtgccaa | |
2605 1861 ccaccagcgt gttgccctcc cactgctctc tgccggtggc cagatcgctg tccttgagct | |
2606 1921 ctccaaacca ggccgtctcc ccgacgtggc tgtgcccacc atccagaatg gtgcagcggt | |
2607 1981 gtccgacctc tcctgggacc ccttcgaccc acagcgcctt gcggttgcgg gggaggatgc | |
2608 2041 caagatccgg ctgtggcggg tgcctgaggg ggggctgcag gacacgctgc aggagcctga | |
2609 2101 ggccgtgctg agagggcaca cggagaagat ctactccatc cgcttccacc ccgtggcagc | |
2610 2161 cgacctcctt gtctcctctt cctatgacat gacagtgcgg atttgggatc tgggtgctgg | |
2611 2221 gcgggaggtg ctgtgcctac agggacacac ggaccagatc ttcagcctgg cctggagccc | |
2612 2281 agacgggagg aagctggcga cggtgagcaa ggatggccgg ttgcggctct ttgagcctcg | |
2613 2341 gtgcagcctt caaccccagc aggagggtcc gggccctgag ggaggccgtg gggcacgcgt | |
2614 2401 ggtctgggtg tgcggaggtg acttcctcct cgtgtccggc ttcgacagcc gcagcgagag | |
2615 2461 gaggatcctt ctgtaccgtg cacaggccct gtccgatggg cccctctacg ttctcggcct | |
2616 2521 cgatgtggcc ccttccacac tcctgccctt ctatgatgag gacaccagtg ttgtcttcct | |
2617 2581 cactggcaag ggtgacacca gagtcttcct ctacgaggtg acccccgagc caccctattt | |
2618 2641 cctcgaatgc aacagcttca cctccagcga cccccacaag ggctttgtct tcctgcgcaa | |
2619 2701 gacagcgtgc gacgtgcggg aggtggagtt cgcccgggcg ctgcggctgg ggcagagcag | |
2620 2761 cctcgagccg gtggctttcc gtgtgccgcg tgtcaagaaa gagtatttcc aagaagacat | |
2621 2821 cttccctccc acccgcgtgt ggtgggagcc ggccctgagc gccagcgcct ggctgggggg | |
2622 2881 ggcggacggg cagcagaacc gcgctgagct ccgtcccgcc gacatggtgc cagtgagcca | |
2623 2941 ggccccaaag gaggcacctg cgcggaagtt cgtccctgcg gccgtgtatc tgggggagaa | |
2624 3001 gacagacgag cagaagaagg aggagctcct cagcgccatg gtggcccggc tggggaaccg | |
2625 3061 ccacgacccg ctgccgcagg actccttcga aggcgtggat gaggccgagt gggactaggc | |
2626 3121 cgcgggcgga ccccacggcg ctgcgcggac cccaggcctc gccggagagg agccgtctcg | |
2627 3181 aacccggccc gcgccagggg ccaggccccg ccattaaagc cgctgcagcc ccaaaaaaaa | |
2628 3241 aaaaaaaa | |
2629 // | |
2630 | |
2631 LOCUS NM_001281486 572 bp mRNA linear VRT 11-JAN-2017 | |
2632 DEFINITION Gallus gallus small integral membrane protein 7 (SMIM7), mRNA. | |
2633 ACCESSION NM_001281486 XM_418258 | |
2634 VERSION NM_001281486.1 | |
2635 KEYWORDS RefSeq. | |
2636 SOURCE Gallus gallus (chicken) | |
2637 ORGANISM Gallus gallus | |
2638 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
2639 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
2640 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
2641 Phasianidae; Phasianinae; Gallus. | |
2642 REFERENCE 1 (bases 1 to 572) | |
2643 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
2644 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
2645 TITLE A comprehensive collection of chicken cDNAs | |
2646 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
2647 PUBMED 12445392 | |
2648 REFERENCE 2 (bases 1 to 572) | |
2649 AUTHORS Abdrakhmanov I, Lodygin D, Geroth P, Arakawa H, Law A, Plachy J, | |
2650 Korn B and Buerstedde JM. | |
2651 TITLE A large database of chicken bursal ESTs as a resource for the | |
2652 analysis of vertebrate gene function | |
2653 JOURNAL Genome Res. 10 (12), 2062-2069 (2000) | |
2654 PUBMED 11116100 | |
2655 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
2656 preliminary review. The reference sequence was derived from | |
2657 BU332068.1, CR389276.1, CR352906.1, AJ392482.1 and BU317186.1. | |
2658 On Jul 31, 2013 this sequence version replaced gi:513227766. | |
2659 | |
2660 ##Evidence-Data-START## | |
2661 Transcript exon combination :: BU332068.1, AM065877.1 [ECO:0000332] | |
2662 RNAseq introns :: single sample supports all introns | |
2663 SAMEA2201357, SAMEA2201358 | |
2664 [ECO:0000348] | |
2665 ##Evidence-Data-END## | |
2666 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
2667 1-27 BU332068.1 1-27 | |
2668 28-361 CR389276.1 1-334 | |
2669 362-413 CR352906.1 450-501 | |
2670 414-436 AJ392482.1 197-219 | |
2671 437-479 CR389276.1 410-452 | |
2672 480-536 AJ392482.1 263-319 | |
2673 537-572 BU317186.1 508-543 | |
2674 FEATURES Location/Qualifiers | |
2675 source 1..572 | |
2676 /organism="Gallus gallus" | |
2677 /mol_type="mRNA" | |
2678 /db_xref="taxon:9031" | |
2679 /chromosome="28" | |
2680 /map="28" | |
2681 /breed="Leghorn" | |
2682 gene 1..572 | |
2683 /gene="SMIM7" | |
2684 /gene_synonym="C19orf42; C28H19ORF42" | |
2685 /note="small integral membrane protein 7" | |
2686 /db_xref="CGNC:51190" | |
2687 /db_xref="GeneID:420141" | |
2688 CDS 21..248 | |
2689 /gene="SMIM7" | |
2690 /gene_synonym="C19orf42; C28H19ORF42" | |
2691 /note="UPF0608 protein C19orf42" | |
2692 /codon_start=1 | |
2693 /product="small integral membrane protein 7" | |
2694 /protein_id="NP_001268415.1" | |
2695 /db_xref="CGNC:51190" | |
2696 /db_xref="GeneID:420141" | |
2697 /translation="MLGDLLLCGTLLVNAGAVLNFRLRRRDTEGFGEGAREPTTGDNI | |
2698 REFLLSLRYFRIFIALWNVFMMFCMIVLFGS" | |
2699 ORIGIN | |
2700 1 ccggcgccgg gaccgccgcc atgctggggg atctgctgct ctgcggaacg ctgctggtga | |
2701 61 acgccggcgc tgtgctgaac ttcagactga ggaggagaga cacggagggc ttcggcgagg | |
2702 121 gggcgaggga gcccaccacc ggtgacaata tcagagagtt cttgctgagc cttaggtatt | |
2703 181 tccgaatctt cattgccttg tggaatgtct tcatgatgtt ctgcatgatt gtgttatttg | |
2704 241 gatcttgaaa gtcatccaca aacatggctg gtaacttgga agagactttt ggctgcaaac | |
2705 301 ataacttttc tatcaagtaa aagattataa tgctttccaa acacagccct gggattgtga | |
2706 361 cagttcttca gcacgagctc cgaggggcag cacagcacac agccccccca gccagctgtg | |
2707 421 taaggctgtg ggtgtgtggg gctgcgtgct gcagggcagg gagccttcca gcccctgagc | |
2708 481 caaaggcctc aaagtaaaat taattcaact tcaccgggag gaaaaaaaca acccacccac | |
2709 541 ctttacagtg ggttgctcag cattctgtgc cc | |
2710 // | |
2711 | |
2712 LOCUS NM_001278545 940 bp mRNA linear VRT 09-JAN-2017 | |
2713 DEFINITION Gallus gallus immunoglobulin lambda-like polypeptide 1 (IGLL1), | |
2714 mRNA. | |
2715 ACCESSION NM_001278545 | |
2716 VERSION NM_001278545.1 | |
2717 KEYWORDS RefSeq. | |
2718 SOURCE Gallus gallus (chicken) | |
2719 ORGANISM Gallus gallus | |
2720 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
2721 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
2722 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
2723 Phasianidae; Phasianinae; Gallus. | |
2724 REFERENCE 1 (bases 1 to 940) | |
2725 AUTHORS Luo J, Zhang H, Teng M, Fan JM, You LM, Xiao ZJ, Yi ML, Zhi YB, Li | |
2726 XW and Zhang GP. | |
2727 TITLE Surface IgM on DT40 cells may be a component of the putative | |
2728 receptor complex responsible for the binding of infectious bursal | |
2729 disease virus | |
2730 JOURNAL Avian Pathol. 39 (5), 359-365 (2010) | |
2731 PUBMED 20954012 | |
2732 REFERENCE 2 (bases 1 to 940) | |
2733 AUTHORS Yamanaka HI, Inoue T and Ikeda-Tanaka O. | |
2734 TITLE Chicken monoclonal antibody isolated by a phage display system | |
2735 JOURNAL J. Immunol. 157 (3), 1156-1162 (1996) | |
2736 PUBMED 8757621 | |
2737 REFERENCE 3 (bases 1 to 940) | |
2738 AUTHORS Mansikka A, Sandberg M, Lassila O and Toivanen P. | |
2739 TITLE Rearrangement of immunoglobulin light chain genes in the chicken | |
2740 occurs prior to colonization of the embryonic bursa of Fabricius | |
2741 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 87 (23), 9416-9420 (1990) | |
2742 PUBMED 2123557 | |
2743 REFERENCE 4 (bases 1 to 940) | |
2744 AUTHORS Parvari,R., Ziv,E., Lantner,F., Tel-Or,S., Burstein,Y. and | |
2745 Schechter,I. | |
2746 TITLE A few germline genes encode the variable regions of chicken | |
2747 immunoglobulin light and gamma-heavy chains | |
2748 JOURNAL Prog. Clin. Biol. Res. 238, 15-26 (1987) | |
2749 PUBMED 3110791 | |
2750 REFERENCE 5 (bases 1 to 940) | |
2751 AUTHORS Reynaud,C.A., Anquez,V., Dahan,A. and Weill,J.C. | |
2752 TITLE A single rearrangement event generates most of the chicken | |
2753 immunoglobulin light chain diversity | |
2754 JOURNAL Cell 40 (2), 283-291 (1985) | |
2755 PUBMED 3917859 | |
2756 REFERENCE 6 (bases 1 to 940) | |
2757 AUTHORS Reynaud,C.A., Dahan,A. and Weill,J.C. | |
2758 TITLE Complete sequence of a chicken lambda light chain immunoglobulin | |
2759 derived from the nucleotide sequence of its mRNA | |
2760 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 80 (13), 4099-4103 (1983) | |
2761 PUBMED 6408641 | |
2762 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
2763 NCBI review. The reference sequence was derived from AC171016.2. | |
2764 | |
2765 Sequence Note: The RefSeq transcript and protein were derived from | |
2766 genomic sequence to make the sequence consistent with the reference | |
2767 genome assembly. The genomic coordinates used for the transcript | |
2768 record were based on alignments. | |
2769 | |
2770 ##Evidence-Data-START## | |
2771 RNAseq introns :: single sample supports all introns SAMN03376185, | |
2772 SAMN03376188 [ECO:0000348] | |
2773 ##Evidence-Data-END## | |
2774 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
2775 1-87 AC171016.2 125417-125503 c | |
2776 88-372 AC171016.2 125007-125291 c | |
2777 373-414 AC171016.2 123150-123191 c | |
2778 415-940 AC171016.2 120886-121411 c | |
2779 FEATURES Location/Qualifiers | |
2780 source 1..940 | |
2781 /organism="Gallus gallus" | |
2782 /mol_type="mRNA" | |
2783 /db_xref="taxon:9031" | |
2784 /chromosome="15" | |
2785 /map="15" | |
2786 /breed="Red Jungle Fowl" | |
2787 gene 1..940 | |
2788 /gene="IGLL1" | |
2789 /gene_synonym="IgL; IGLV" | |
2790 /note="immunoglobulin lambda-like polypeptide 1" | |
2791 /db_xref="CGNC:14448" | |
2792 /db_xref="GeneID:416928" | |
2793 CDS 42..728 | |
2794 /gene="IGLL1" | |
2795 /gene_synonym="IgL; IGLV" | |
2796 /note="Ig light chain variable region; Ig lambda chain V-1 | |
2797 region; immunoglobulin light-chain VJ region; | |
2798 immunoglobulin lambda light chain; immunoglobulin | |
2799 light-chain C-lambda region; immunoglobulin lambda chain; | |
2800 Ig VL1; immunoglobulin light chain; sIgM light chain; | |
2801 immunoglobulin Y light chain; Ig lambda chain C region; | |
2802 immunoglobulin light chain variable region" | |
2803 /codon_start=1 | |
2804 /product="Ig lambda chain V-1 region precursor" | |
2805 /protein_id="NP_001265474.1" | |
2806 /db_xref="CGNC:14448" | |
2807 /db_xref="GeneID:416928" | |
2808 /translation="MAWAPLLLAVLAHTSGSLVQAALTQPSSVSANPGETVKITCSGD | |
2809 RSYYGWYQQKAPGSAPVTLIYDNTNRPSNIPSRFSGSKSGSTATLTITGVQADDEAVY | |
2810 YCGSADSSMCGIFGAGTTLTVLGQPKVAPTITLFPPSKEELNEATKATLVCLINDFYP | |
2811 SPVTVDWVIDGSTRSGETTAPQRQSNSQYMASSYLSLSASDWSSHETYTCRVTHNGTS | |
2812 ITKTLKRSEC" | |
2813 sig_peptide 42..104 | |
2814 /gene="IGLL1" | |
2815 /gene_synonym="IgL; IGLV" | |
2816 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
2817 misc_feature 105..164 | |
2818 /gene="IGLL1" | |
2819 /gene_synonym="IgL; IGLV" | |
2820 /experiment="experimental evidence, no additional details | |
2821 recorded" | |
2822 /note="propagated from UniProtKB/Swiss-Prot (P04210.1); | |
2823 Region: Framework-1" | |
2824 misc_feature 165..188 | |
2825 /gene="IGLL1" | |
2826 /gene_synonym="IgL; IGLV" | |
2827 /experiment="experimental evidence, no additional details | |
2828 recorded" | |
2829 /note="propagated from UniProtKB/Swiss-Prot (P04210.1); | |
2830 Region: Complementarity-determining-1" | |
2831 misc_feature 189..236 | |
2832 /gene="IGLL1" | |
2833 /gene_synonym="IgL; IGLV" | |
2834 /experiment="experimental evidence, no additional details | |
2835 recorded" | |
2836 /note="propagated from UniProtKB/Swiss-Prot (P04210.1); | |
2837 Region: Framework-2" | |
2838 misc_feature 237..257 | |
2839 /gene="IGLL1" | |
2840 /gene_synonym="IgL; IGLV" | |
2841 /experiment="experimental evidence, no additional details | |
2842 recorded" | |
2843 /note="propagated from UniProtKB/Swiss-Prot (P04210.1); | |
2844 Region: Complementarity-determining-2" | |
2845 misc_feature 258..353 | |
2846 /gene="IGLL1" | |
2847 /gene_synonym="IgL; IGLV" | |
2848 /experiment="experimental evidence, no additional details | |
2849 recorded" | |
2850 /note="propagated from UniProtKB/Swiss-Prot (P04210.1); | |
2851 Region: Framework-3" | |
2852 ORIGIN | |
2853 1 gccccatcgg cgtggggaca cacagctgct gggattccgc catggcctgg gctcctctcc | |
2854 61 tcctggcggt gctcgcccac acctcaggtt ccctggtgca ggcagcgctg actcagccgt | |
2855 121 cctcggtgtc agcgaacccg ggagaaaccg tcaagatcac ctgctccggg gataggagct | |
2856 181 actatggctg gtaccagcag aaggcacctg gcagtgcccc tgtcactctg atctatgaca | |
2857 241 acaccaacag accctcgaac atcccttcac gattctccgg ttccaaatcc ggctccacag | |
2858 301 ccacattaac catcactggg gtccaagccg acgacgaggc tgtctattac tgtgggagtg | |
2859 361 cagacagcag catgtgtggt atatttgggg ccgggacaac cctgaccgtc ctaggccagc | |
2860 421 ccaaggtggc ccccaccatc accctcttcc caccgtcaaa ggaggagctg aacgaagcca | |
2861 481 ccaaggccac cctggtgtgc ctgataaacg acttctaccc cagcccagtg actgtggatt | |
2862 541 gggtgatcga tggctccacc cgctctggcg agaccacagc accacagcgg cagagcaaca | |
2863 601 gccagtatat ggccagcagc tacctgtcac tgtctgccag cgactggtca agccacgaga | |
2864 661 cctacacctg cagggtcaca cacaacggca cctctatcac gaagaccctg aagaggtccg | |
2865 721 agtgctaata gtcccactgg ggatgcaatg tgaggacagt ggttcctcac cctccctgtc | |
2866 781 cctctgggcc gctgctggtg gcagcagccc tcacttccca ctcagatgtc ccccaccgtg | |
2867 841 cccccatcac ccacctctgc ctgtcgactc ctcttgccct catctctcca ggtgtcacat | |
2868 901 taataaacac gacactgaac tagtgctgac tctgcatcca | |
2869 // | |
2870 | |
2871 LOCUS NM_001277657 1691 bp mRNA linear VRT 11-JAN-2017 | |
2872 DEFINITION Gallus gallus calcium channel flower domain containing 1 (CACFD1), | |
2873 mRNA. | |
2874 ACCESSION NM_001277657 XM_415434 | |
2875 VERSION NM_001277657.1 | |
2876 KEYWORDS RefSeq. | |
2877 SOURCE Gallus gallus (chicken) | |
2878 ORGANISM Gallus gallus | |
2879 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
2880 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
2881 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
2882 Phasianidae; Phasianinae; Gallus. | |
2883 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
2884 NCBI review. The reference sequence was derived from CR385838.1. | |
2885 On Apr 13, 2013 this sequence version replaced gi:363740460. | |
2886 | |
2887 ##Evidence-Data-START## | |
2888 Transcript exon combination :: CR385838.1, BU455956.1 [ECO:0000332] | |
2889 RNAseq introns :: single sample supports all introns | |
2890 SAMEA2201357, SAMEA2201358 | |
2891 [ECO:0000348] | |
2892 ##Evidence-Data-END## | |
2893 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
2894 1-1691 CR385838.1 2-1692 | |
2895 FEATURES Location/Qualifiers | |
2896 source 1..1691 | |
2897 /organism="Gallus gallus" | |
2898 /mol_type="mRNA" | |
2899 /db_xref="taxon:9031" | |
2900 /chromosome="17" | |
2901 /map="17" | |
2902 gene 1..1691 | |
2903 /gene="CACFD1" | |
2904 /gene_synonym="C17H9ORF7; C9orf7; D9S2135; FLOWER" | |
2905 /note="calcium channel flower domain containing 1" | |
2906 /db_xref="CGNC:50452" | |
2907 /db_xref="GeneID:417151" | |
2908 misc_feature 226..228 | |
2909 /gene="CACFD1" | |
2910 /gene_synonym="C17H9ORF7; C9orf7; D9S2135; FLOWER" | |
2911 /note="upstream in-frame stop codon" | |
2912 CDS 250..774 | |
2913 /gene="CACFD1" | |
2914 /gene_synonym="C17H9ORF7; C9orf7; D9S2135; FLOWER" | |
2915 /note="calcium channel flower domain-containing protein 1" | |
2916 /codon_start=1 | |
2917 /product="calcium channel flower homolog" | |
2918 /protein_id="NP_001264586.1" | |
2919 /db_xref="CGNC:50452" | |
2920 /db_xref="GeneID:417151" | |
2921 /translation="MSSQDEQFQAAAPESASSSADDGMTWWYRWLCRIAGVIGGVSCA | |
2922 VAGLWNCVTINPLNIAAGVWMMLNAFVLFLCEAPFCCQFIEFANAVSARADKLRAWQK | |
2923 AAFYCGMAVFPVMLSLTLTTLFGNAIAFATGVLYGLSALGKKGDAISYARIHQQQKQM | |
2924 DEEKLTGCLEGQAL" | |
2925 ORIGIN | |
2926 1 gacgtggagg ctgctcccac ggccgctggc atcgctgctg cggtcagaaa ccctctattg | |
2927 61 tcagccctgg ggggcccggc cccgtatggg ggtgcgagga gaggcccagc agcagcaggg | |
2928 121 ccgggttagg ggccgtctcc tggtcctgct ggaggagggg ggagtgtcac ctggaggggc | |
2929 181 atccagcgct gctggggctc aggtggggag cggggagctg ccctttgacc ccccagcagc | |
2930 241 agcggggcca tgagctctca ggatgagcag ttccaagcag cagcccccga gtcagcatct | |
2931 301 tcctccgccg atgatggcat gacctggtgg tacaggtggc tctgcaggat tgccggggtc | |
2932 361 atcgggggcg tgtcttgcgc tgttgctggt ctctggaact gtgttaccat caacccactg | |
2933 421 aacatagcag ccggagtgtg gatgatgctc aacgccttcg tcctgttcct gtgcgaggct | |
2934 481 ccgttctgct gccagttcat cgagttcgcc aacgccgtgt ctgcgagggc agacaagctg | |
2935 541 cgggcctggc agaaagctgc tttctactgc gggatggctg tgttccctgt catgctcagc | |
2936 601 ctgacgctca ccactctctt tggaaatgcc attgcgtttg cgaccggggt gctgtatggc | |
2937 661 ctgtcagctc ttggcaagaa gggagatgcc atttcctacg ctcggatcca ccagcagcag | |
2938 721 aagcaaatgg atgaagagaa gctcacgggg tgcctggagg gacaggctct gtgaagtgcg | |
2939 781 tgagcccagg gtgacctttt ggaccctgag atggtggtga agatttggaa acccactctg | |
2940 841 ccctcccctc tgctcaaccc ctctccatca ctccacgatt tccctggaca ctacagcaac | |
2941 901 aactggagct ctcagggccg gggtgggctg tgcccccctc acacaccagc agttggacct | |
2942 961 cagtgctttg gctgctccct cctcctgccc actcagaacc aaatatctca tggtccttct | |
2943 1021 ttttctttct ttcttccttt cttttttttc ttcttttttt atggcagggg tgctggccct | |
2944 1081 ttgagtgctg ctgtataagc ctaaacacat agcctttctc tggttttgat gcccatcaca | |
2945 1141 ttttgctggg aactgtgtgt gggcagcaca ctctttgagg actgctccgg aggtctcatg | |
2946 1201 cccagggtgc tgctgcacgt tacacattta gtgcagcaca ctctggtgtg gctcattcca | |
2947 1261 ggcataaaac acggatgcag tgttgagcag tacctgctga cgcttgcatt tggtgttcat | |
2948 1321 catcatccag gttttaatat aggtccaatt aggtcggaca ttggaggcat ctctgcacag | |
2949 1381 taaaggactt ccagcaaaaa aaacaaccat gcatgaagac agtgatgcct ccagaggaga | |
2950 1441 gaagcacagt ctgcccttcc tctggataca gcttcaggca gataatgcaa tttacttgaa | |
2951 1501 ttatgaccat taattacgta gtcttaataa gggtactttt cttcagcttc attcttttac | |
2952 1561 tggggaagaa gggaagcgag gctgaaaaag ggtggtgttg cttgaggcaa acagaggcag | |
2953 1621 tttgcaggtg ggatggttgc tgatgtgcaa gtgagtcccc tctgagccca gacagacact | |
2954 1681 gctctgttct c | |
2955 // | |
2956 | |
2957 LOCUS NM_001277490 1452 bp mRNA linear VRT 11-JAN-2017 | |
2958 DEFINITION Gallus gallus elongator acetyltransferase complex subunit 6 (ELP6), | |
2959 mRNA. | |
2960 ACCESSION NM_001277490 XM_418484 | |
2961 VERSION NM_001277490.1 | |
2962 KEYWORDS RefSeq. | |
2963 SOURCE Gallus gallus (chicken) | |
2964 ORGANISM Gallus gallus | |
2965 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
2966 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
2967 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
2968 Phasianidae; Phasianinae; Gallus. | |
2969 REFERENCE 1 (bases 1 to 1452) | |
2970 AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R, | |
2971 Burnside J, Aggrey SE, Simon J and Cogburn LA. | |
2972 TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs | |
2973 from single and multiple tissue cDNA libraries and CAP3 assembly of | |
2974 a chicken gene index | |
2975 JOURNAL Physiol. Genomics 25 (3), 514-524 (2006) | |
2976 PUBMED 16554550 | |
2977 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
2978 preliminary review. The reference sequence was derived from | |
2979 CD219096.1, BX932848.1, DR424316.1 and AADN04000184.1. | |
2980 On Apr 11, 2013 this sequence version replaced gi:363729718. | |
2981 | |
2982 Sequence Note: This RefSeq record was created from transcript and | |
2983 genomic sequence data from different strains because no single | |
2984 transcript from the same strain was available for the full length | |
2985 of the gene. The extent of this transcript is supported by | |
2986 transcript alignments and orthologous data. | |
2987 | |
2988 ##Evidence-Data-START## | |
2989 Transcript exon combination :: BX932848.1, BU465771.1 [ECO:0000332] | |
2990 RNAseq introns :: single sample supports all introns | |
2991 SAMEA2201357, SAMEA2201358 | |
2992 [ECO:0000348] | |
2993 ##Evidence-Data-END## | |
2994 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
2995 1-30 CD219096.1 4-33 | |
2996 31-388 BX932848.1 2-359 | |
2997 389-775 DR424316.1 337-723 | |
2998 776-1441 BX932848.1 747-1412 | |
2999 1442-1452 AADN04000184.1 3723704-3723714 c | |
3000 FEATURES Location/Qualifiers | |
3001 source 1..1452 | |
3002 /organism="Gallus gallus" | |
3003 /mol_type="mRNA" | |
3004 /db_xref="taxon:9031" | |
3005 /chromosome="2" | |
3006 /map="2" | |
3007 /breed="Leghorn" | |
3008 gene 1..1452 | |
3009 /gene="ELP6" | |
3010 /gene_synonym="C2H3ORF75; C3orf75; TMEM103" | |
3011 /note="elongator acetyltransferase complex subunit 6" | |
3012 /db_xref="CGNC:3759" | |
3013 /db_xref="GeneID:420379" | |
3014 CDS 21..818 | |
3015 /gene="ELP6" | |
3016 /gene_synonym="C2H3ORF75; C3orf75; TMEM103" | |
3017 /note="transmembrane protein 103; UPF0405 protein C3orf75; | |
3018 angiotonin-transactivated protein 1; elongator complex | |
3019 protein 6 homolog" | |
3020 /codon_start=1 | |
3021 /product="elongator complex protein 6" | |
3022 /protein_id="NP_001264419.1" | |
3023 /db_xref="CGNC:3759" | |
3024 /db_xref="GeneID:420379" | |
3025 /translation="MLEELNELLDATPQRPDTGKFTLLRDSRTDGSFLVHHFLSFYLR | |
3026 AGCKVCFLALVQSFSHYNIVAQKLGVSLTAAKERGQLVFLEGLKSCLDLVFGEEEPSG | |
3027 QPSPLQFISGSVSNLKDLFDFVRTSLAPTDSDSWKGRVLLVDDLSVLLSLGAAPVDVL | |
3028 DFIHYCRMVVCSQLKGNIVVLVHGSEDSEDEENKLVVTSLCHHSNLILWVQGLATGFC | |
3029 KDVHGEIKIIKRLSLESTEQDVIQIYQYKIQDKNVTFFARGLSAAVL" | |
3030 ORIGIN | |
3031 1 cacacacaca cgcagccgcc atgctggagg agctgaacga actgctggac gccaccccgc | |
3032 61 agcgcccgga cacgggtaaa ttcacactgc tgcgagacag cagaacggat ggcagcttcc | |
3033 121 tggtgcacca cttcctctcc ttctacctca gagctggctg caaggtttgc ttcctggccc | |
3034 181 tggtccagtc cttcagtcac tataacatcg tagcacagaa gctgggagtc agtctgacag | |
3035 241 ctgccaagga gcggggacag cttgtctttt tggaaggcct caagtcctgc cttgacctcg | |
3036 301 tgtttgggga ggaggagccg tcaggacagc ccagtcctct tcagtttata agtgggagcg | |
3037 361 tttccaacct caaagacctg tttgacttcg tccggacgtc cctggcgccc actgacagcg | |
3038 421 actcctggaa gggccgggtg ctgctggtgg atgatctcag cgtgctgctc agcctgggtg | |
3039 481 ctgcgccagt ggacgtgctg gacttcatcc actactgcag aatggtggtg tgctctcagc | |
3040 541 tcaaggggaa cattgtggtg ctggttcatg gcagcgagga ttcagaagat gaggagaaca | |
3041 601 agctggtggt gacctccctg tgtcatcaca gcaacctgat cctgtgggtg caggggctgg | |
3042 661 caactggctt ctgcaaggat gttcatgggg agattaaaat aattaagaga ctgtccttgg | |
3043 721 agtcaacaga gcaggacgtc atccagatct accagtacaa gatccaggac aagaatgtca | |
3044 781 ccttttttgc tagagggctg tcagctgctg tcctgtgatg cagtgatacc acacagagct | |
3045 841 gtgagagcac cgcagcacaa ggagaactgc tactgacgat tggaacctat agattggtac | |
3046 901 ctatagatcg gatgtgctgc aaaaccagcc tgcttgcttc ctcggtgcct tccaggagct | |
3047 961 gtacagcaac ctggcctaag agggaagctt aatagcatct cgaactgcat gcagacaagg | |
3048 1021 gcatcagctt gccgagagct tgttgcatcc ctttgtcatc ccagcctgtt cccagcacac | |
3049 1081 aaggccacaa agaacagcac caactgacat ggatgtccct tggagcatgt acatacaagc | |
3050 1141 agggggcatg ccctgagggc tgggcatgcc tcaccttttc cggttgtgta tggctgcccc | |
3051 1201 accctggcat ttaaagagat gacacagaga gggcggaggc agggatggct tgggaacatg | |
3052 1261 ttgcaattct tacctttctc ccagctctgg gatggaagag atttgctcaa ctcccagttg | |
3053 1321 acacagagtt aaacaataca cagctctgta tatagctgct ctccttgctg atgtaagact | |
3054 1381 tggaggccgc ctcgcttggg tgcttccttg ctttttgtta cttttaatat aatataaaac | |
3055 1441 cactgtgccc at | |
3056 // | |
3057 | |
3058 LOCUS NM_001277477 759 bp mRNA linear VRT 11-JAN-2017 | |
3059 DEFINITION Gallus gallus retinoic acid receptor responder (tazarotene induced) | |
3060 2 (RARRES2), transcript variant 2, mRNA. | |
3061 ACCESSION NM_001277477 | |
3062 VERSION NM_001277477.1 | |
3063 KEYWORDS RefSeq. | |
3064 SOURCE Gallus gallus (chicken) | |
3065 ORGANISM Gallus gallus | |
3066 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
3067 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
3068 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
3069 Phasianidae; Phasianinae; Gallus. | |
3070 REFERENCE 1 (bases 1 to 759) | |
3071 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
3072 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
3073 TITLE A comprehensive collection of chicken cDNAs | |
3074 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
3075 PUBMED 12445392 | |
3076 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
3077 preliminary review. The reference sequence was derived from | |
3078 AADN04000184.1, BU267206.1 and BU241015.1. | |
3079 | |
3080 Transcript Variant: This variant (2) differs in the 3' UTR compared | |
3081 to variant 1. Both variants 1 and 2 encode the same protein. | |
3082 | |
3083 Sequence Note: This RefSeq record was created from transcript and | |
3084 genomic sequence data from different strains because no single | |
3085 transcript from the same strain was available for the full length | |
3086 of the gene. The extent of this transcript is supported by | |
3087 transcript alignments and orthologous data. | |
3088 | |
3089 ##Evidence-Data-START## | |
3090 Transcript exon combination :: CR385440.1, BU408629.1 [ECO:0000332] | |
3091 RNAseq introns :: single sample supports all introns | |
3092 SAMEA2201357, SAMEA2201358 | |
3093 [ECO:0000348] | |
3094 ##Evidence-Data-END## | |
3095 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
3096 1-43 AADN04000184.1 4195720-4195762 c | |
3097 44-64 AADN04000184.1 4195699-4195719 c | |
3098 65-561 BU267206.1 51-547 | |
3099 562-582 AADN04000184.1 4194254-4194274 c | |
3100 583-742 AADN04000184.1 4193991-4194150 c | |
3101 743-759 BU241015.1 671-687 | |
3102 FEATURES Location/Qualifiers | |
3103 source 1..759 | |
3104 /organism="Gallus gallus" | |
3105 /mol_type="mRNA" | |
3106 /db_xref="taxon:9031" | |
3107 /chromosome="2" | |
3108 /map="2" | |
3109 /breed="Red Jungle Fowl" | |
3110 gene 1..759 | |
3111 /gene="RARRES2" | |
3112 /gene_synonym="chemerin" | |
3113 /note="retinoic acid receptor responder (tazarotene | |
3114 induced) 2" | |
3115 /db_xref="CGNC:3645" | |
3116 /db_xref="GeneID:420366" | |
3117 misc_feature 45..47 | |
3118 /gene="RARRES2" | |
3119 /gene_synonym="chemerin" | |
3120 /note="upstream in-frame stop codon" | |
3121 CDS 81..569 | |
3122 /gene="RARRES2" | |
3123 /gene_synonym="chemerin" | |
3124 /note="retinoic acid receptor responder protein 2" | |
3125 /codon_start=1 | |
3126 /product="retinoic acid receptor responder protein 2 | |
3127 precursor" | |
3128 /protein_id="NP_001264406.1" | |
3129 /db_xref="CGNC:3645" | |
3130 /db_xref="GeneID:420366" | |
3131 /translation="MKLLLGIAVAVLALADAGQSPLQRRVVKDVLDYFHSRSNVQFLF | |
3132 REQSVEGAVERVDSSGTFVQLHLNLAQTACRKQAQRKQNCRIMENRRKPVCLACYKFD | |
3133 SSDVPKVLDKYYNCGPSHHLAMKDIKHRDEAECRAVEEAGKMSDVLYLPGMFAFSKGL | |
3134 PA" | |
3135 sig_peptide 81..131 | |
3136 /gene="RARRES2" | |
3137 /gene_synonym="chemerin" | |
3138 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
3139 ORIGIN | |
3140 1 gttcccagga aattggttaa tgagagacca aaatcaacaa gcagtagtgg gcagcaggct | |
3141 61 ggccgggccg cgcagtgggg atgaagctgc tgctgggcat cgccgtggcc gtgctggcgt | |
3142 121 tggcagacgc cgggcagagc cctctgcagc ggcgcgtggt gaaggatgtg ctggactact | |
3143 181 tccacagccg cagcaacgtc cagttcctct ttagggagca gtcggtggaa ggggccgtcg | |
3144 241 agagagtgga ctcatcgggg acgttcgtcc agctgcacct taacctcgca cagacggcat | |
3145 301 gcaggaagca ggcacagagg aaacagaact gcaggatcat ggagaacagg aggaagccag | |
3146 361 tctgcttggc ctgctacaag tttgacagca gcgatgtccc caaggtgctg gacaagtact | |
3147 421 acaactgtgg ccccagccac cacctggcca tgaaggacat caagcaccgt gacgaggctg | |
3148 481 agtgcagggc tgtggaggag gccggcaaga tgagtgatgt cctctatctg ccaggcatgt | |
3149 541 ttgctttctc caaggggctg ccagcctagg tgcccacaca catccagcgg ccgctgcatc | |
3150 601 cccagcccag gaggaggatg ctggcctggg gccccccaac ccccagcttg ctgcccccca | |
3151 661 gcgctgtgca gtgaagggaa ggtcgtcccg cagtgccccc cggctcctgg cagtgtctgc | |
3152 721 atgcaccatt aaaccccagc tctgcctctg tttctctgc | |
3153 // | |
3154 | |
3155 LOCUS NM_001277476 782 bp mRNA linear VRT 11-JAN-2017 | |
3156 DEFINITION Gallus gallus retinoic acid receptor responder (tazarotene induced) | |
3157 2 (RARRES2), transcript variant 1, mRNA. | |
3158 ACCESSION NM_001277476 XM_003640642 XM_418471 | |
3159 VERSION NM_001277476.1 | |
3160 KEYWORDS RefSeq. | |
3161 SOURCE Gallus gallus (chicken) | |
3162 ORGANISM Gallus gallus | |
3163 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
3164 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
3165 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
3166 Phasianidae; Phasianinae; Gallus. | |
3167 REFERENCE 1 (bases 1 to 782) | |
3168 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
3169 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
3170 TITLE A comprehensive collection of chicken cDNAs | |
3171 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
3172 PUBMED 12445392 | |
3173 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
3174 preliminary review. The reference sequence was derived from | |
3175 AADN04000184.1, BX271418.4 and BX932071.2. | |
3176 On or before Apr 10, 2013 this sequence version replaced | |
3177 gi:363729706, gi:363729708. | |
3178 | |
3179 Transcript Variant: This variant (1) represents the longer | |
3180 transcript. Both variants 1 and 2 encode the same protein. | |
3181 | |
3182 Sequence Note: This RefSeq record was created from transcript and | |
3183 genomic sequence data from different strains because no single | |
3184 transcript from the same strain was available for the full length | |
3185 of the gene. The extent of this transcript is supported by | |
3186 transcript alignments and orthologous data. | |
3187 | |
3188 ##Evidence-Data-START## | |
3189 Transcript exon combination :: BX932071.2, BU125657.1 [ECO:0000332] | |
3190 RNAseq introns :: single sample supports all introns | |
3191 SAMEA2201357, SAMEA2201358 | |
3192 [ECO:0000348] | |
3193 ##Evidence-Data-END## | |
3194 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
3195 1-65 AADN04000184.1 4195698-4195762 c | |
3196 66-550 BX271418.4 39-523 | |
3197 551-772 BX932071.2 483-704 | |
3198 773-782 AADN04000184.1 4193974-4193983 c | |
3199 FEATURES Location/Qualifiers | |
3200 source 1..782 | |
3201 /organism="Gallus gallus" | |
3202 /mol_type="mRNA" | |
3203 /db_xref="taxon:9031" | |
3204 /chromosome="2" | |
3205 /map="2" | |
3206 /breed="Red Jungle Fowl" | |
3207 gene 1..782 | |
3208 /gene="RARRES2" | |
3209 /gene_synonym="chemerin" | |
3210 /note="retinoic acid receptor responder (tazarotene | |
3211 induced) 2" | |
3212 /db_xref="CGNC:3645" | |
3213 /db_xref="GeneID:420366" | |
3214 misc_feature 45..47 | |
3215 /gene="RARRES2" | |
3216 /gene_synonym="chemerin" | |
3217 /note="upstream in-frame stop codon" | |
3218 CDS 81..569 | |
3219 /gene="RARRES2" | |
3220 /gene_synonym="chemerin" | |
3221 /note="retinoic acid receptor responder protein 2" | |
3222 /codon_start=1 | |
3223 /product="retinoic acid receptor responder protein 2 | |
3224 precursor" | |
3225 /protein_id="NP_001264405.1" | |
3226 /db_xref="CGNC:3645" | |
3227 /db_xref="GeneID:420366" | |
3228 /translation="MKLLLGIAVAVLALADAGQSPLQRRVVKDVLDYFHSRSNVQFLF | |
3229 REQSVEGAVERVDSSGTFVQLHLNLAQTACRKQAQRKQNCRIMENRRKPVCLACYKFD | |
3230 SSDVPKVLDKYYNCGPSHHLAMKDIKHRDEAECRAVEEAGKMSDVLYLPGMFAFSKGL | |
3231 PA" | |
3232 sig_peptide 81..131 | |
3233 /gene="RARRES2" | |
3234 /gene_synonym="chemerin" | |
3235 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
3236 ORIGIN | |
3237 1 gttcccagga aattggttaa tgagagacca aaatcaacaa gcagtagtgg gcagcaggct | |
3238 61 ggccgggccg cgcagtgggg atgaagctgc tgctgggcat cgccgtggcc gtgctggcgt | |
3239 121 tggcagacgc cgggcagagc cctctgcagc ggcgcgtggt gaaggatgtg ctggactact | |
3240 181 tccacagccg cagcaacgtc cagttcctct ttagggagca gtcggtggaa ggggccgtcg | |
3241 241 agagagtgga ctcatcgggg acgttcgtcc agctgcacct taacctcgca cagacggcat | |
3242 301 gcaggaagca ggcacagagg aaacagaact gcaggatcat ggagaacagg aggaagccag | |
3243 361 tctgcttggc ctgctacaag tttgacagca gcgatgtccc caaggtgctg gacaagtact | |
3244 421 acaactgtgg ccccagccac cacctggcca tgaaggacat caagcaccgt gacgaggctg | |
3245 481 agtgcagggc tgtggaggag gccggcaaga tgagtgatgt cctctatctg ccaggcatgt | |
3246 541 ttgctttctc caaggggctg ccagcctagg tgcccacaca cacaccccct gtcccctctc | |
3247 601 cgcagtccag cggccgctgc atccccagcc caggaggagg atgctggcct ggggcccccc | |
3248 661 aacccccagc ttgctgcccc ccagcgctgt gcagtgaagg gaaggtcgtc ccgcagtgcc | |
3249 721 ccccggctcc tggcagtgtc tgcatgcacc attaaacccc agctctgcct ctgtttctct | |
3250 781 gc | |
3251 // | |
3252 | |
3253 LOCUS NM_001199231 2038 bp mRNA linear VRT 11-JAN-2017 | |
3254 DEFINITION Gallus gallus small integral membrane protein 15 (SMIM15), mRNA. | |
3255 ACCESSION NM_001199231 XM_001233977 | |
3256 VERSION NM_001199231.2 | |
3257 KEYWORDS RefSeq. | |
3258 SOURCE Gallus gallus (chicken) | |
3259 ORGANISM Gallus gallus | |
3260 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
3261 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
3262 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
3263 Phasianidae; Phasianinae; Gallus. | |
3264 REFERENCE 1 (bases 1 to 2038) | |
3265 AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R, | |
3266 Burnside J, Aggrey SE, Simon J and Cogburn LA. | |
3267 TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs | |
3268 from single and multiple tissue cDNA libraries and CAP3 assembly of | |
3269 a chicken gene index | |
3270 JOURNAL Physiol. Genomics 25 (3), 514-524 (2006) | |
3271 PUBMED 16554550 | |
3272 REFERENCE 2 (bases 1 to 2038) | |
3273 AUTHORS Shin JH, Kim H, Lim D, Jeon M, Han BK, Park TS, Kim JK, Lillehoj | |
3274 HS, Cho BW and Han JY. | |
3275 TITLE Analysis of chicken embryonic gonad expressed sequenced tags | |
3276 JOURNAL Anim. Genet. 37 (1), 85-86 (2006) | |
3277 PUBMED 16441308 | |
3278 REFERENCE 3 (bases 1 to 2038) | |
3279 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
3280 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
3281 P, Hayashizaki Y and Buerstedde JM. | |
3282 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
3283 gene function analysis | |
3284 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
3285 PUBMED 15642098 | |
3286 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
3287 preliminary review. The reference sequence was derived from | |
3288 AJ453243.1, AC188450.3, BI394192.1 and CV853891.1. | |
3289 On Jan 12, 2012 this sequence version replaced gi:312839851. | |
3290 | |
3291 Sequence Note: This RefSeq record was created from transcript and | |
3292 genomic sequence data to make the sequence consistent with the | |
3293 reference genome assembly. The genomic coordinates used for the | |
3294 transcript record were based on transcript alignments. | |
3295 | |
3296 ##Evidence-Data-START## | |
3297 Transcript exon combination :: AJ453243.1, AJ448907.1 [ECO:0000332] | |
3298 RNAseq introns :: single sample supports all introns | |
3299 SAMEA2201375, SAMEA2201377 | |
3300 [ECO:0000348] | |
3301 ##Evidence-Data-END## | |
3302 COMPLETENESS: complete on the 3' end. | |
3303 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
3304 1-12 AJ453243.1 2-13 | |
3305 13-16 AC188450.3 187484-187487 c | |
3306 17-57 AJ453243.1 18-58 | |
3307 58-67 AJ453243.1 60-69 | |
3308 68-639 BI394192.1 1-572 | |
3309 640-1838 AC188450.3 184697-185895 c | |
3310 1839-2038 CV853891.1 482-681 | |
3311 FEATURES Location/Qualifiers | |
3312 source 1..2038 | |
3313 /organism="Gallus gallus" | |
3314 /mol_type="mRNA" | |
3315 /db_xref="taxon:9031" | |
3316 /chromosome="Z" | |
3317 /map="Z" | |
3318 gene 1..2038 | |
3319 /gene="SMIM15" | |
3320 /gene_synonym="C5orf43; CZH5ORF43" | |
3321 /note="small integral membrane protein 15" | |
3322 /db_xref="CGNC:56176" | |
3323 /db_xref="GeneID:770642" | |
3324 misc_feature 27..29 | |
3325 /gene="SMIM15" | |
3326 /gene_synonym="C5orf43; CZH5ORF43" | |
3327 /note="upstream in-frame stop codon" | |
3328 CDS 141..365 | |
3329 /gene="SMIM15" | |
3330 /gene_synonym="C5orf43; CZH5ORF43" | |
3331 /note="UPF0542 protein C5orf43 homolog" | |
3332 /codon_start=1 | |
3333 /product="small integral membrane protein 15" | |
3334 /protein_id="NP_001186160.1" | |
3335 /db_xref="CGNC:56176" | |
3336 /db_xref="GeneID:770642" | |
3337 /translation="MFDVKAWAVYIVEWAAKDPYGFLTTVILVLTPLFIISAALSWKL | |
3338 AKMIETREREQKKKRKRQENIVKAKRAKKD" | |
3339 misc_feature 198..260 | |
3340 /gene="SMIM15" | |
3341 /gene_synonym="C5orf43; CZH5ORF43" | |
3342 /experiment="experimental evidence, no additional details | |
3343 recorded" | |
3344 /note="propagated from UniProtKB/Swiss-Prot (Q5F409.1); | |
3345 transmembrane region" | |
3346 ORIGIN | |
3347 1 gcttcttgct tcctgcttcc gctcggtagc gcggcgcgcc gcggggtagc gggacctggt | |
3348 61 gctgctcgtc cgtcgcttgc cgcgcccgcg gcgccggcct acctctggtg cagtgtttcc | |
3349 121 cccataacaa agcggctgag atgtttgacg tgaaggcttg ggctgtgtac attgtggaat | |
3350 181 gggctgccaa ggacccctat ggcttcctca ctacggtgat cctggtcctc acgcccctgt | |
3351 241 tcatcatcag cgcggcactg tcgtggaagc ttgcaaagat gattgagacc agggagcgag | |
3352 301 agcagaagaa gaaacggaaa cgccaggaga acattgtgaa ggccaaacga gcaaagaagg | |
3353 361 attaaatggg caagaaaggc cttccttggg cagagaattc actttattga tggagcactg | |
3354 421 ctgtacattt tgtgttgtaa ccatcctttg atacttgatg ctgttgtttc ttgaattatg | |
3355 481 agattttaac ttcttgagaa tatttttttt ctgctgaaat catctgtgtt agaagttgcc | |
3356 541 ccagtgacac agtcacttca tctcctgctt atatttccat gcagactgct tctctaaatt | |
3357 601 tgcatgttat atttaaaaat gaaatagtcg gggagcatta ggggcatatc tttttcctta | |
3358 661 gctgagctat gactcaaaga gagtcaaatt atggggataa tgtaaatgac tccttaatgc | |
3359 721 tatgaccttt ggtttcttag tgtagcacac ccttctccat tgcagcagta gttcatgttg | |
3360 781 tgcttacgtg tatttgcagt tcctggttta actggactac aggaagggag gttctggtac | |
3361 841 acctgcagca gagctacaga gcagctagct tctgagcttc ttgtttgctg ttgtgtttga | |
3362 901 ctgacacact ttcaaggcat gcagtgcgta tggctgtgca gttcattcac tgcatgccca | |
3363 961 tcaggtctgc agtagctcag ctcatggggc ttgtctgcac catgaaccaa actgactcct | |
3364 1021 cctgtttcct ccacaaccca cccatcagca gtcttcatat tcagcccaaa ctctgggaaa | |
3365 1081 ccgattgctt atcttcagta tcttcatttg tctgaggcta ctcgtgttct acagagtaca | |
3366 1141 ctatagcgtt gtctggtttt ccctaattat cacctgaaca gtccatctct aacttgtttg | |
3367 1201 tctgtagaag cttttttgcc tcaaagaata gccataagtg ggatcagatg aaaggcccag | |
3368 1261 gtggccttga gttctgtctt ttgtgacctg tagcagttgg ccaagggaga ctacccaagt | |
3369 1321 ctgatatgca cgctggtgac acaagttatt cctaattgct agccctgtag ctacctgcac | |
3370 1381 tttaggacct tctgagttca ggtggtatca ttttgttctg atagctcttg aagatctgct | |
3371 1441 gtacgccagg ttacaaaatg ctggcatagc agaaaaagtc caagtgaggt ttctgttgta | |
3372 1501 aatacgccaa aattttttaa cctcgattcc aattcatctt tttctaacaa atgattaatt | |
3373 1561 tttcacagcc tgacttctat cagcctaatt ctaaagagtc tgtggaagtc attaggtttt | |
3374 1621 tagacagcat atttctaaat ggcagcatgg agctgtgctt tctagcaact agtccattat | |
3375 1681 atggttaaaa gtaaaatctt aagataatgt cccattcagc agagacctat agagctagct | |
3376 1741 gacagcagca agataagggg gaagttttac tgaaatgact tgaagtaaat atgaagtact | |
3377 1801 tagctgcaac cagtatctga tgaccatctt tccgttctgt tggtcagaac agcaagcatt | |
3378 1861 actggaatga tgttttgaca ctttgtggta catgacatta aatcaccact cttggaaatg | |
3379 1921 tcaaatgtgt atgtattcca cctttgatac ctagatagtt caaaatgcat acctacatgg | |
3380 1981 tttaaaataa atttgatact ttttcaaaat atacttttta aaaaaaaaaa aaaaaaaa | |
3381 // | |
3382 | |
3383 LOCUS NM_001031013 971 bp mRNA linear VRT 11-JAN-2017 | |
3384 DEFINITION Gallus gallus low density lipoprotein receptor class A domain | |
3385 containing 4 (LDLRAD4), mRNA. | |
3386 ACCESSION NM_001031013 XM_419130 | |
3387 VERSION NM_001031013.2 | |
3388 KEYWORDS RefSeq. | |
3389 SOURCE Gallus gallus (chicken) | |
3390 ORGANISM Gallus gallus | |
3391 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
3392 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
3393 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
3394 Phasianidae; Phasianinae; Gallus. | |
3395 REFERENCE 1 (bases 1 to 971) | |
3396 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
3397 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
3398 P, Hayashizaki Y and Buerstedde JM. | |
3399 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
3400 gene function analysis | |
3401 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
3402 PUBMED 15642098 | |
3403 REFERENCE 2 (bases 1 to 971) | |
3404 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
3405 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
3406 TITLE A comprehensive collection of chicken cDNAs | |
3407 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
3408 PUBMED 12445392 | |
3409 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
3410 preliminary review. The reference sequence was derived from | |
3411 AJ720368.1 and BU264529.1. | |
3412 On Nov 22, 2011 this sequence version replaced gi:71896400. | |
3413 | |
3414 ##Evidence-Data-START## | |
3415 RNAseq introns :: mixed/partial sample support SAMEA2201357, | |
3416 SAMEA2201358 [ECO:0000350] | |
3417 ##Evidence-Data-END## | |
3418 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
3419 1-272 AJ720368.1 1-272 | |
3420 273-292 BU264529.1 99-118 | |
3421 293-971 AJ720368.1 1501-2179 | |
3422 FEATURES Location/Qualifiers | |
3423 source 1..971 | |
3424 /organism="Gallus gallus" | |
3425 /mol_type="mRNA" | |
3426 /db_xref="taxon:9031" | |
3427 /chromosome="2" | |
3428 /map="2" | |
3429 /breed="Leghorn" | |
3430 gene 1..971 | |
3431 /gene="LDLRAD4" | |
3432 /gene_synonym="C18orf1; C2H18ORF1" | |
3433 /note="low density lipoprotein receptor class A domain | |
3434 containing 4" | |
3435 /db_xref="CGNC:51390" | |
3436 /db_xref="GeneID:421044" | |
3437 misc_feature 67..69 | |
3438 /gene="LDLRAD4" | |
3439 /gene_synonym="C18orf1; C2H18ORF1" | |
3440 /note="upstream in-frame stop codon" | |
3441 CDS 121..822 | |
3442 /gene="LDLRAD4" | |
3443 /gene_synonym="C18orf1; C2H18ORF1" | |
3444 /note="clone 22" | |
3445 /codon_start=1 | |
3446 /product="low-density lipoprotein receptor class A | |
3447 domain-containing protein 4" | |
3448 /protein_id="NP_001026184.2" | |
3449 /db_xref="CGNC:51390" | |
3450 /db_xref="GeneID:421044" | |
3451 /translation="MVVVIICLLNHYKLSTRSFINRQSQSRRQEDTLQTEGCLWPSES | |
3452 SVSRQGASEIMYAPRSRDRFTAPSFMQRDRFSRFQPTYPYMQHEIDLPPTISLSDGEE | |
3453 PPPYQGPCTLQLRDPEQQMELNRESVRAPPNRTIFDSDLIDISMYNGGPCPPSSNSGI | |
3454 SATNYSSNGRMEGPPPTYSEVMGHYPGSSFFHHQHSNAPPSSQRGSRLQFQQNNSEST | |
3455 IVPSKGQDRKPGNLV" | |
3456 ORIGIN | |
3457 1 gagggcgcgg aggctccgcc gggcgccggg cggccgcggc ttaaagagcg gcgcggcgct | |
3458 61 gcgcggtaag ctgaactgga gtttgttcaa atcatcatta tcatcgtggt tataactgtt | |
3459 121 atggtggtag tgatcatctg cttgttgaac cattacaaac tatcgacgcg ctcctttatc | |
3460 181 aaccggcaga gccaaagcag aagacaggag gatactttgc agacagaagg gtgcttgtgg | |
3461 241 ccttcggaaa gctcagtttc acgccagggt gcttcagaga ttatgtatgc tccaaggtcc | |
3462 301 agggacaggt ttaccgcccc atcttttatg cagcgggacc gtttcagtcg cttccagccc | |
3463 361 acttacccat acatgcagca tgagattgac cttcctccaa ccatttccct ctcagatggg | |
3464 421 gaagagccgc cgccatacca aggcccgtgc accctgcagc tccgggaccc agagcagcag | |
3465 481 atggagctca accgggaatc tgtcagggca ccgcccaacc gaaccatttt tgatagcgac | |
3466 541 ttgatagaca tttccatgta caatgggggc ccctgcccac cgagcagcaa ttcgggcata | |
3467 601 agtgcaacca actatagcag taatggaagg atggaaggac cacccccgac gtacagcgag | |
3468 661 gtcatggggc actacccagg ctcctcgttt ttccatcacc agcacagcaa cgctcctcct | |
3469 721 tcctcgcaga gggggagcag acttcagttt cagcagaaca attcagagag cacaattgtc | |
3470 781 cccagcaaag gccaagaccg gaaaccaggg aacctggtct aagtcactct ccgacgtgca | |
3471 841 tttggactga agacaagaga ttgaagcagg gcggcggagg aagagccccg tgctccggtg | |
3472 901 cacaatgttg ttacatttca cgtggtacaa cttagtaaaa ccaaacgtgc aaaccaaaaa | |
3473 961 aaaaaaaaaa a | |
3474 // | |
3475 | |
3476 LOCUS NM_001195562 2664 bp mRNA linear VRT 11-JAN-2017 | |
3477 DEFINITION Gallus gallus patched domain containing 4 (PTCHD4), mRNA. | |
3478 ACCESSION NM_001195562 XM_420069 | |
3479 VERSION NM_001195562.1 | |
3480 KEYWORDS RefSeq. | |
3481 SOURCE Gallus gallus (chicken) | |
3482 ORGANISM Gallus gallus | |
3483 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
3484 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
3485 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
3486 Phasianidae; Phasianinae; Gallus. | |
3487 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
3488 preliminary review. The reference sequence was derived from | |
3489 AADN04000287.1. | |
3490 On Sep 17, 2010 this sequence version replaced gi:118089240. | |
3491 | |
3492 Sequence Note: The RefSeq transcript and protein were derived from | |
3493 genomic sequence to make the sequence consistent with the reference | |
3494 genome assembly. The genomic coordinates used for the transcript | |
3495 record were based on alignments. | |
3496 | |
3497 ##Evidence-Data-START## | |
3498 RNAseq introns :: single sample supports all introns SAMEA2201363, | |
3499 SAMEA2201366 [ECO:0000348] | |
3500 ##Evidence-Data-END## | |
3501 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
3502 1-549 AADN04000287.1 582005-582553 | |
3503 550-1030 AADN04000287.1 607213-607693 | |
3504 1031-2664 AADN04000287.1 664513-666146 | |
3505 FEATURES Location/Qualifiers | |
3506 source 1..2664 | |
3507 /organism="Gallus gallus" | |
3508 /mol_type="mRNA" | |
3509 /db_xref="taxon:9031" | |
3510 /chromosome="3" | |
3511 /map="3" | |
3512 /breed="Red Jungle Fowl" | |
3513 gene 1..2664 | |
3514 /gene="PTCHD4" | |
3515 /gene_synonym="C3H6ORF138; C6orf138; dJ402H5.2" | |
3516 /note="patched domain containing 4" | |
3517 /db_xref="CGNC:51608" | |
3518 /db_xref="GeneID:422064" | |
3519 CDS 1..2664 | |
3520 /gene="PTCHD4" | |
3521 /gene_synonym="C3H6ORF138; C6orf138; dJ402H5.2" | |
3522 /note="patched domain-containing protein C6orf138" | |
3523 /codon_start=1 | |
3524 /product="patched domain-containing protein 4" | |
3525 /protein_id="NP_001182491.1" | |
3526 /db_xref="CGNC:51608" | |
3527 /db_xref="GeneID:422064" | |
3528 /translation="MLRQVIHRGLQSFFYKLGLFVSRHPVFFLTVPAVLTIIFGFSLL | |
3529 NRFQPDTDLESLVAPSHSLAKIERSLASSLFSLDQSKSQLYSDLHTPGRYGRVILLSK | |
3530 PGGNILHQADVILQIHRAVLEMKVNYKGYNYTFSHLCVLRNQDKKCVLDDIISVLEDL | |
3531 RQAALSNKTTARVQVSYPNTKLKDGRSSFIGHQLGGVMEVPNSKDQRVKSARAIQITY | |
3532 YLQTYGSVTQDLIGEKWESEFCKLMHKMQLDHQDLQLYSLASFSLWKDFHQTSLLARG | |
3533 KILVSLMLILLTATLSSSMKDCLRSKPFLGLLGVLTICISSVTAAGIFFITDGKYNST | |
3534 LLGIPFFAMGHGTKGVFELLSGWRRTRENLPFKDRVADAYSDVMVSYTMTSSLYFIAF | |
3535 GMGASPFTNIEAVKVFCQNMCVSILLNYFYIFSFFGSCLVFAGQLEQNRYHSIFCCKI | |
3536 PSAEYLDRKPVWFQTMMNDGHQHSSHHETNPYQHHFIQHFLREHYNEWITNIYVKPFV | |
3537 VILYLIYASFSFMGCLQINDGANIINLLASESPSVSYALIQQKYFSNYSPVIGFYIYE | |
3538 PLEYWNGTVQEDLKTLSQGFNTVSWIEQYYQFLRVGNISATNKSDFISILQSNFLKKP | |
3539 EFQHFKNDIIFSKAGDENNIIASRLYLVARTSENTQREAVELLEKLRPLSLIQSIKFI | |
3540 VFNPTFVFMDHYGLSVTMPVLISGFGILLVLILTFFLVIHPLGNFWLILSVTSIELGV | |
3541 LGLMTLWNVDMDWISILCLIYTLNFAIDHCAPLLYTFVLATEHTRTQCIKNSLQEHGT | |
3542 AILQNVSSFLIGLVPLLFVPSNLTFTLFKCLLLAGSCTLLHCFVILPVFLTFFPPSKK | |
3543 HHKKKKRAKRKEREEIECIEIQENPDHVTAV" | |
3544 ORIGIN | |
3545 1 atgctgcggc aggtgataca cagagggctc cagtcgtttt tctacaagct gggcttattc | |
3546 61 gtgagcaggc atccggtgtt tttcctcact gtgcccgcag tcctgaccat catcttcggc | |
3547 121 ttcagcctgc tcaaccgctt ccagcctgac actgacctgg agagcctggt agcccccagc | |
3548 181 cacagcctgg ccaagatcga gaggagctta gccagcagcc tgttctccct cgatcaatcc | |
3549 241 aaaagccagc tgtattcgga cttgcacacc ccggggaggt atggcagggt gattctcctc | |
3550 301 tccaaacccg gaggcaatat tttgcatcag gctgatgtga tcctgcagat ccaccgagcc | |
3551 361 gtgctggaaa tgaaggtgaa ctacaaaggc tataattata ctttttccca tctgtgtgtg | |
3552 421 ttgagaaatc aggataagaa atgcgtgctg gatgatatta tttcagtgct agaggatctg | |
3553 481 aggcaggctg ccctctccaa taagacaaca gccagggtgc aagtgagcta tcccaacact | |
3554 541 aaattaaagg atggaaggag cagttttatt ggccaccagc ttggaggggt catggaagtg | |
3555 601 cccaacagca aggaccagag agtcaaatca gccagagcca tccaaatcac ttactacctc | |
3556 661 caaacgtatg gctctgtcac ccaggacctc attggggaga agtgggagag tgaattctgt | |
3557 721 aaactgatgc acaagatgca gctggatcac caagatctgc agctctactc gctggcgtcc | |
3558 781 ttcagcctct ggaaggactt ccaccagacc agtctcttgg ccaggggcaa gattttggtg | |
3559 841 agcctgatgc tgatcctcct gactgctacc ctctcgagct ccatgaagga ctgcctgcgt | |
3560 901 agcaaacctt tcctgggact cttgggagta ctcactatct gtatttccag tgtcactgcg | |
3561 961 gcagggatat ttttcattac tgatggaaaa tataattcta ctctgttggg aatccctttc | |
3562 1021 ttcgctatgg gtcatggaac caaaggagta ttcgaacttc tttcaggatg gcgtcgaaca | |
3563 1081 agagaaaatc ttccattcaa ggacagagta gcagatgcct actcagatgt catggtgtcc | |
3564 1141 tatacaatga caagctcctt gtatttcata gcctttggca tgggtgcaag ccctttcact | |
3565 1201 aacattgaag ccgtaaaagt cttttgccag aacatgtgtg tctccatcct gttgaactac | |
3566 1261 ttctatatct tctcattctt tggctcctgc ctggtctttg ctggccagtt ggagcagaac | |
3567 1321 cgttaccaca gtatcttctg ctgtaaaatc ccttcagcag aatacctgga ccggaagcct | |
3568 1381 gtgtggttcc agaccatgat gaatgatggc catcaacatt cttctcatca tgagaccaac | |
3569 1441 ccataccagc atcactttat ccagcatttc ctccgagagc attacaatga gtggattacc | |
3570 1501 aacatctatg tcaagccttt tgtggtgata ctgtatctca tctatgcctc tttctccttc | |
3571 1561 atggggtgct tacagattaa tgatggagcc aacattatta accttcttgc cagtgagtct | |
3572 1621 ccaagcgtct cctatgccct cattcagcaa aagtacttca gcaactacag cccggtgata | |
3573 1681 ggattctata tttacgaacc tctggagtac tggaatggca ctgtgcaaga agacctaaaa | |
3574 1741 acactgagcc aagggttcaa cacagtgtcc tggatcgaac agtattacca gttccttcga | |
3575 1801 gtgggtaaca tcagtgcaac taacaaaagt gactttatca gtatcctcca gagcaacttt | |
3576 1861 ttaaaaaagc cagaattcca gcacttcaaa aatgacatca tattctctaa agctggagat | |
3577 1921 gagaataaca taatagcttc tcgtttgtac ctggtggcca ggacgagtga aaacacacag | |
3578 1981 agggaggcag tggaattact ggagaaactg agaccgctct ctcttataca gagcatcaag | |
3579 2041 ttcatagtgt tcaatcctac ctttgttttc atggaccact atggtttatc agtaactatg | |
3580 2101 cctgtcctga tttctggttt tggcatcctg ttggtgttaa tactgacctt tttcctggtt | |
3581 2161 atccatcctc tgggaaattt ctggttgatt ctcagcgtca cctcaataga gctgggcgtc | |
3582 2221 cttggcttga tgaccttatg gaatgtagac atggattgga tttctatact gtgccttatc | |
3583 2281 tacaccttga attttgccat agatcactgt gcacccctgc tttatacatt tgtactagct | |
3584 2341 actgagcaca cccgaactca atgtataaag aactccctcc aagagcatgg gacagccatt | |
3585 2401 ttgcagaacg tttcttcttt tcttattggg ttggtccccc ttctctttgt gccttcaaac | |
3586 2461 ttgaccttca cactgttcaa atgcttgctg cttgccggca gttgcacact tctgcactgt | |
3587 2521 tttgttattt tgcccgtctt tctaaccttt ttcccacctt ccaaaaagca ccacaaaaaa | |
3588 2581 aagaaacgag ccaaaaggaa ggaacgagaa gagattgaat gcatagagat tcaggagaat | |
3589 2641 cctgatcacg tgacagcagt ctga | |
3590 // | |
3591 | |
3592 LOCUS NM_001194996 1525 bp mRNA linear VRT 11-JAN-2017 | |
3593 DEFINITION Gallus gallus trafficking protein particle complex 13 (TRAPPC13), | |
3594 transcript variant 1, mRNA. | |
3595 ACCESSION NM_001194996 | |
3596 VERSION NM_001194996.1 | |
3597 KEYWORDS RefSeq. | |
3598 SOURCE Gallus gallus (chicken) | |
3599 ORGANISM Gallus gallus | |
3600 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
3601 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
3602 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
3603 Phasianidae; Phasianinae; Gallus. | |
3604 REFERENCE 1 (bases 1 to 1525) | |
3605 AUTHORS Froman DP, Kirby JD and Rhoads DD. | |
3606 TITLE An expressed sequence tag analysis of the chicken reproductive | |
3607 tract transcriptome | |
3608 JOURNAL Poult. Sci. 85 (8), 1438-1441 (2006) | |
3609 PUBMED 16903475 | |
3610 REFERENCE 2 (bases 1 to 1525) | |
3611 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
3612 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
3613 P, Hayashizaki Y and Buerstedde JM. | |
3614 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
3615 gene function analysis | |
3616 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
3617 PUBMED 15642098 | |
3618 REFERENCE 3 (bases 1 to 1525) | |
3619 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
3620 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
3621 TITLE A comprehensive collection of chicken cDNAs | |
3622 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
3623 PUBMED 12445392 | |
3624 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
3625 preliminary review. The reference sequence was derived from | |
3626 AC187110.2, BU335726.1, BU388633.1 and AC145935.3. | |
3627 | |
3628 Transcript Variant: This variant (1) represents the longer | |
3629 transcript and encodes the longer isoform (1). | |
3630 | |
3631 Sequence Note: This RefSeq record was created from transcript and | |
3632 genomic sequence data to make the sequence consistent with the | |
3633 reference genome assembly. The genomic coordinates used for the | |
3634 transcript record were based on transcript alignments. | |
3635 | |
3636 ##Evidence-Data-START## | |
3637 RNAseq introns :: single sample supports all introns SAMEA2201357, | |
3638 SAMEA2201361 [ECO:0000348] | |
3639 ##Evidence-Data-END## | |
3640 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
3641 1-27 AC187110.2 219680-219706 | |
3642 28-789 BU335726.1 1-762 | |
3643 790-1336 BU388633.1 42-588 | |
3644 1337-1525 AC145935.3 50710-50898 | |
3645 FEATURES Location/Qualifiers | |
3646 source 1..1525 | |
3647 /organism="Gallus gallus" | |
3648 /mol_type="mRNA" | |
3649 /db_xref="taxon:9031" | |
3650 /chromosome="Z" | |
3651 /map="Z" | |
3652 /breed="Red Jungle Fowl" | |
3653 gene 1..1525 | |
3654 /gene="TRAPPC13" | |
3655 /gene_synonym="C5orf44; CZH5ORF44; Trs65-related" | |
3656 /note="trafficking protein particle complex 13" | |
3657 /db_xref="CGNC:53002" | |
3658 /db_xref="GeneID:427165" | |
3659 CDS 58..1314 | |
3660 /gene="TRAPPC13" | |
3661 /gene_synonym="C5orf44; CZH5ORF44; Trs65-related" | |
3662 /note="isoform 1 is encoded by transcript variant 1; | |
3663 UPF0533 protein C5orf44; trafficking protein particle | |
3664 complex subunit 13" | |
3665 /codon_start=1 | |
3666 /product="trafficking protein particle complex subunit 13 | |
3667 isoform 1" | |
3668 /protein_id="NP_001181925.1" | |
3669 /db_xref="CGNC:53002" | |
3670 /db_xref="GeneID:427165" | |
3671 /translation="MDVNQPKQEHLLALKVMRLTKPTLFTNIPVTCEERDLPGNLFNQ | |
3672 LMKDDPSTVKGAEALMLGEMLTLPQNFGNIFLGETFSSYISVHNDSNQVVKDILVKAD | |
3673 LQTSSQRLNLSASTAAVAELKPDCCIDDVIHHEVKEIGTHILVCAVSYTTQAGEKMYF | |
3674 RKFFKFQVLKPLDVKTKFYNAESDLSSVTDEVFLEAQIQNITTSPMFMEKVSLEPSIM | |
3675 YNVAELNTVDSAGESESTFGSRTYLQPMDTRQYLYCLKPKQEFAEKAGVIKGVTVIGK | |
3676 LDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCKITNCSS | |
3677 ERTMDLVLEMCNTNSIHWCGVSGRQLGKLHPSSSLRLALTLLSSVQGLQSVSGLRLTD | |
3678 TFLKRTYEYDDIAQVCVVSSKVKQES" | |
3679 ORIGIN | |
3680 1 gcgctgtgct tacgcacttc ttccctggtt gcggcggcca ggtctcgcgg ccgcaccatg | |
3681 61 gacgttaacc agcccaagca ggagcacctg ctggccctga aagtgatgag gttaacaaaa | |
3682 121 cctaccttat tcactaatat tccagtgact tgtgaagaaa gagatttgcc aggtaatcta | |
3683 181 tttaaccagc tcatgaaaga tgatccttct actgtaaaag gagcagaagc tttgatgcta | |
3684 241 ggagaaatgc tgactttgcc tcaaaatttt ggaaatatat ttctgggaga aacattttcc | |
3685 301 agttacatta gtgtacataa tgatagtaat caagttgtca aggacatact ggtgaaggct | |
3686 361 gatcttcaga caagttctca gcgcttgaac ctttcagctt ctactgctgc agtggcagaa | |
3687 421 cttaaacctg actgctgtat tgatgatgtg attcatcacg aagtgaagga aataggaacg | |
3688 481 cacatcttag tttgtgcagt aagttatact acgcaagcag gagagaagat gtatttcaga | |
3689 541 aagttcttca aatttcaggt gctcaaacca ctagatgtga aaaccaaatt ctacaatgcg | |
3690 601 gagagtgacc tcagttctgt gacagatgaa gtgtttctgg aagctcagat tcagaatatc | |
3691 661 actacctctc caatgtttat ggagaaggtt tctttagagc catccattat gtacaacgtt | |
3692 721 gcagaactga acacagttga ctcagcaggg gaaagtgagt caacttttgg ctcaagaact | |
3693 781 tacttacaac ctatggacac acgtcagtat ttatattgcc tgaaaccaaa gcaggaattt | |
3694 841 gcagagaaag ctggcgtaat aaaaggtgta actgtgattg gtaaactaga tatcgtatgg | |
3695 901 aaaacgaatc taggtgagcg aggaagactg caaactagcc agctccaaag aatggctcct | |
3696 961 ggctatggtg atgtaaggct ttctctggag acaataccag acaccgtaaa tttggaagag | |
3697 1021 ccttttgata ttacttgtaa aataacaaat tgcagcagtg aaaggactat ggatctggtt | |
3698 1081 ttagaaatgt gcaatactaa ttccatccac tggtgtggag tttctggaag acaacttgga | |
3699 1141 aaattacatc ctagttcctc tctccgtctt gcacttacat tattgtcttc agtgcaggga | |
3700 1201 ttgcaaagtg tttctggctt aagacttacc gacacatttt tgaagagaac atacgaatat | |
3701 1261 gatgatattg cacaggtctg cgtcgtttct tcaaaagtaa aacaagaaag ctgaagaaaa | |
3702 1321 gttttatttc tgctgtttgt tttttttgga ccaacttctt gtgttttttg cagttaaatc | |
3703 1381 atattgcgta aagagaaaat taacccccag tatatgcata gacacaagtt gcttatttaa | |
3704 1441 tttctctgag cattttttta atgttttaaa atcttttgaa aagatgtata tgcatctcaa | |
3705 1501 taaaaataaa gcctttgaaa aaaaa | |
3706 // | |
3707 | |
3708 LOCUS NM_001006577 1504 bp mRNA linear VRT 11-JAN-2017 | |
3709 DEFINITION Gallus gallus trafficking protein particle complex 13 (TRAPPC13), | |
3710 transcript variant 2, mRNA. | |
3711 ACCESSION NM_001006577 XM_424753 | |
3712 VERSION NM_001006577.2 | |
3713 KEYWORDS RefSeq. | |
3714 SOURCE Gallus gallus (chicken) | |
3715 ORGANISM Gallus gallus | |
3716 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
3717 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
3718 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
3719 Phasianidae; Phasianinae; Gallus. | |
3720 REFERENCE 1 (bases 1 to 1504) | |
3721 AUTHORS Froman DP, Kirby JD and Rhoads DD. | |
3722 TITLE An expressed sequence tag analysis of the chicken reproductive | |
3723 tract transcriptome | |
3724 JOURNAL Poult. Sci. 85 (8), 1438-1441 (2006) | |
3725 PUBMED 16903475 | |
3726 REFERENCE 2 (bases 1 to 1504) | |
3727 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
3728 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
3729 P, Hayashizaki Y and Buerstedde JM. | |
3730 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
3731 gene function analysis | |
3732 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
3733 PUBMED 15642098 | |
3734 REFERENCE 3 (bases 1 to 1504) | |
3735 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
3736 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
3737 TITLE A comprehensive collection of chicken cDNAs | |
3738 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
3739 PUBMED 12445392 | |
3740 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
3741 preliminary review. The reference sequence was derived from | |
3742 AC187110.2, AJ720892.1, DT656730.1 and AC145935.3. | |
3743 On Aug 17, 2010 this sequence version replaced gi:57527713. | |
3744 | |
3745 Transcript Variant: This variant (2) lacks an in-frame exon in the | |
3746 coding region, compared to variant 1. The encoded isoform (2) is | |
3747 shorter than isoform 1. | |
3748 | |
3749 Sequence Note: This RefSeq record was created from transcript and | |
3750 genomic sequence data to make the sequence consistent with the | |
3751 reference genome assembly. The genomic coordinates used for the | |
3752 transcript record were based on transcript alignments. | |
3753 | |
3754 ##Evidence-Data-START## | |
3755 Transcript exon combination :: AJ720892.1 [ECO:0000332] | |
3756 RNAseq introns :: single sample supports all introns | |
3757 SAMEA2201361, SAMEA2201363 | |
3758 [ECO:0000348] | |
3759 ##Evidence-Data-END## | |
3760 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
3761 1-52 AC187110.2 219680-219731 | |
3762 53-448 AJ720892.1 54-449 | |
3763 449-684 DT656730.1 216-451 | |
3764 685-773 AJ720892.1 688-776 | |
3765 774-786 AJ720892.1 778-790 | |
3766 787-1347 AJ720892.1 792-1352 | |
3767 1348-1348 AC145935.3 50742-50742 | |
3768 1349-1476 AJ720892.1 1353-1480 | |
3769 1477-1504 AC145935.3 50871-50898 | |
3770 FEATURES Location/Qualifiers | |
3771 source 1..1504 | |
3772 /organism="Gallus gallus" | |
3773 /mol_type="mRNA" | |
3774 /db_xref="taxon:9031" | |
3775 /chromosome="Z" | |
3776 /map="Z" | |
3777 /breed="Red Jungle Fowl" | |
3778 gene 1..1504 | |
3779 /gene="TRAPPC13" | |
3780 /gene_synonym="C5orf44; CZH5ORF44; Trs65-related" | |
3781 /note="trafficking protein particle complex 13" | |
3782 /db_xref="CGNC:53002" | |
3783 /db_xref="GeneID:427165" | |
3784 CDS 58..1293 | |
3785 /gene="TRAPPC13" | |
3786 /gene_synonym="C5orf44; CZH5ORF44; Trs65-related" | |
3787 /note="isoform 2 is encoded by transcript variant 2; | |
3788 UPF0533 protein C5orf44; trafficking protein particle | |
3789 complex subunit 13" | |
3790 /codon_start=1 | |
3791 /product="trafficking protein particle complex subunit 13 | |
3792 isoform 2" | |
3793 /protein_id="NP_001006577.2" | |
3794 /db_xref="CGNC:53002" | |
3795 /db_xref="GeneID:427165" | |
3796 /translation="MDVNQPKQEHLLALKVMRLTKPTLFTNIPVTCEERDLPGNLFNQ | |
3797 LMKDDPSTVKGAEALMLGEMLTLPQNFGNIFLGETFSSYISVHNDSNQVVKDILVKAD | |
3798 LQTSSQRLNLSASTAAVAELKPDCCIDDVIHHEVKEIGTHILVCAVSYTTQAGEKMYF | |
3799 RKFFKFQVLKPLDVKTKFYNAETDEVFLEAQIQNITTSPMFMEKVSLEPSIMYNVAEL | |
3800 NTVDSAGESESTFGSRTYLQPMDTRQYLYCLKPKQEFAEKAGVIKGVTVIGKLDIVWK | |
3801 TNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCKITNCSERTMDLV | |
3802 LEMCNTNSIHWCGVSGRQLGKLHPSSSLRLALTLLSSVQGLQSVSGLRLTDTFLKRTY | |
3803 EYDDIAQVCVVSSKVKQES" | |
3804 ORIGIN | |
3805 1 gcgctgtgct tacgcacttc ttccctggtt gcggcggcca ggtctcgcgg ccgcaccatg | |
3806 61 gacgttaacc agcccaagca ggagcacctg ctggccctga aagtgatgag gttaacaaaa | |
3807 121 cctaccttat tcactaatat tccagtgact tgtgaagaaa gagatttgcc aggtaatcta | |
3808 181 tttaaccagc tcatgaaaga tgatccttct actgtaaaag gagcagaagc tttgatgcta | |
3809 241 ggagaaatgc tgactttgcc tcaaaatttt ggaaatatat ttctgggaga aacattttcc | |
3810 301 agttacatta gtgtacataa tgatagtaat caagttgtca aggacatact ggtgaaggct | |
3811 361 gatcttcaga caagttctca gcgcttgaac ctttcagctt ctactgctgc agtggcagaa | |
3812 421 cttaaacctg actgctgtat tgatgatgtg attcatcacg aagtgaagga aataggaacg | |
3813 481 cacatcttag tttgtgcagt aagttatact acgcaagcag gagagaagat gtatttcaga | |
3814 541 aagttcttca aatttcaggt gctcaaacca ctagatgtga aaaccaaatt ctacaatgcg | |
3815 601 gagacagatg aagtgtttct ggaagctcag attcagaata tcactacctc tccaatgttt | |
3816 661 atggagaagg tttctttaga gccatccatt atgtacaacg ttgcagaact gaacacagtt | |
3817 721 gactcagcag gggaaagtga gtcaactttt ggctcaagaa cttacttaca acctatggac | |
3818 781 acacgtcagt atttatattg cctgaaacca aagcaggaat ttgcagagaa agctggcgta | |
3819 841 ataaaaggtg taactgtgat tggtaaacta gatatcgtat ggaaaacgaa tctaggtgag | |
3820 901 cgaggaagac tgcaaactag ccagctccaa agaatggctc ctggctatgg tgatgtaagg | |
3821 961 ctttctctgg agacaatacc agacaccgta aatttggaag agccttttga tattacttgt | |
3822 1021 aaaataacaa attgcagtga aaggactatg gatctggttt tagaaatgtg caatactaat | |
3823 1081 tccatccact ggtgtggagt ttctggaaga caacttggaa aattacatcc tagttcctct | |
3824 1141 ctccgtcttg cacttacatt attgtcttca gtgcagggat tgcaaagtgt ttctggctta | |
3825 1201 agacttaccg acacattttt gaagagaaca tacgaatatg atgatattgc acaggtctgc | |
3826 1261 gtcgtttctt caaaagtaaa acaagaaagc tgaagaaaag ttttatttct gctgtttgtt | |
3827 1321 ttttttggac caacttcttg tgttttttgc agttaaatca tattgcgtaa agagaaaatt | |
3828 1381 aacccccagt atatgcatag acacaagttg cttatttaat ttctctgagc atttttttaa | |
3829 1441 tgttttaaaa tcttttgaaa agatgtatat gcatctcaat aaaaataaag cctttgaaaa | |
3830 1501 aaaa | |
3831 // | |
3832 | |
3833 LOCUS NM_001145430 928 bp mRNA linear VRT 11-JAN-2017 | |
3834 DEFINITION Gallus gallus small integral membrane protein 20 (SMIM20), mRNA. | |
3835 ACCESSION NM_001145430 XM_001232657 | |
3836 VERSION NM_001145430.1 | |
3837 KEYWORDS RefSeq. | |
3838 SOURCE Gallus gallus (chicken) | |
3839 ORGANISM Gallus gallus | |
3840 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
3841 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
3842 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
3843 Phasianidae; Phasianinae; Gallus. | |
3844 REFERENCE 1 (bases 1 to 928) | |
3845 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
3846 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
3847 TITLE A comprehensive collection of chicken cDNAs | |
3848 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
3849 PUBMED 12445392 | |
3850 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
3851 preliminary review. The reference sequence was derived from | |
3852 CR523170.1 and BU307818.1. | |
3853 On Feb 28, 2009 this sequence version replaced gi:118090651. | |
3854 | |
3855 ##Evidence-Data-START## | |
3856 Transcript exon combination :: BX933175.1, CR523170.1 [ECO:0000332] | |
3857 RNAseq introns :: single sample supports all introns | |
3858 SAMEA2201368, SAMEA2201373 | |
3859 [ECO:0000348] | |
3860 ##Evidence-Data-END## | |
3861 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
3862 1-921 CR523170.1 1-921 | |
3863 922-928 BU307818.1 715-721 | |
3864 FEATURES Location/Qualifiers | |
3865 source 1..928 | |
3866 /organism="Gallus gallus" | |
3867 /mol_type="mRNA" | |
3868 /db_xref="taxon:9031" | |
3869 /chromosome="4" | |
3870 /map="4" | |
3871 /breed="Leghorn" | |
3872 gene 1..928 | |
3873 /gene="SMIM20" | |
3874 /gene_synonym="C4H4ORF52; C4orf52; phoenixin" | |
3875 /note="small integral membrane protein 20" | |
3876 /db_xref="CGNC:55214" | |
3877 /db_xref="GeneID:769392" | |
3878 CDS 217..420 | |
3879 /gene="SMIM20" | |
3880 /gene_synonym="C4H4ORF52; C4orf52; phoenixin" | |
3881 /codon_start=1 | |
3882 /product="small integral membrane protein 20" | |
3883 /protein_id="NP_001138902.1" | |
3884 /db_xref="CGNC:55214" | |
3885 /db_xref="GeneID:769392" | |
3886 /translation="MARLFRTLVIFGGFAAVVGAAFYPIYFRPLLLPEEYKREQSINR | |
3887 AGIVQENIQPPGLKVWSDPFGRK" | |
3888 ORIGIN | |
3889 1 gggccggggc ggcatccggt cgcggggggg ccgagcagcg tcggagcgac agagcgctgg | |
3890 61 cgctcggcag gaagcgtccg ccccagcgcc gtcgctgctt ctgccgagct cggcggcggc | |
3891 121 acgccgccct ccccgctccg cccgccgggc cccgtctcgc ccggaagcgg cggccgcgga | |
3892 181 gcttccgtcc cggacgcggg gcgtccctcc gccgccatgg ccaggctgtt ccgcacgctc | |
3893 241 gtcatcttcg gcggcttcgc ggccgtggtg ggggccgcct tctaccccat ctacttccgg | |
3894 301 ccgctgctgc tgcccgagga gtacaagaga gaacagtcaa taaaccgagc tggtattgtt | |
3895 361 caagagaata tccagcctcc agggttaaaa gtgtggtctg atccatttgg aagaaagtaa | |
3896 421 tgttgccagc gtggtgcatt tcaaggtaga actgaagatg aacttcaatt atttcttcgt | |
3897 481 acactgaagt atgcctttgg gcgtcgctgg agaagatttc tgattatgct gtgtgggcat | |
3898 541 atgaggagca ataaatgcta ctggttggaa agccaagagg aggaaacatc ccagttttgg | |
3899 601 cagggtgctg tggcacaatg gacagactgc tagagaggtg actgtttctt gtgttaagaa | |
3900 661 gtaaaatatt tacttccttg agaaaaagga agaagaatta tttttgtggt taatctgtaa | |
3901 721 acatttggag aacaaattat gaatagacta aattatgcag accactgcag tttcctccct | |
3902 781 agtttgaaaa ttactttctg tggtttaatt gtgaaaacat gatagaagtt tatactaaga | |
3903 841 gagactggtg aagatttgct ctctcttagg cagaatataa catggtgagt gagaatttgt | |
3904 901 gcattaaaat ttcttccatt caaatcaa | |
3905 // | |
3906 | |
3907 LOCUS NM_001110060 714 bp mRNA linear VRT 11-JAN-2017 | |
3908 DEFINITION Gallus gallus ras-related protein Rab-23 (RAB23), mRNA. | |
3909 ACCESSION NM_001110060 XM_419896 | |
3910 VERSION NM_001110060.1 | |
3911 KEYWORDS RefSeq. | |
3912 SOURCE Gallus gallus (chicken) | |
3913 ORGANISM Gallus gallus | |
3914 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
3915 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
3916 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
3917 Phasianidae; Phasianinae; Gallus. | |
3918 REFERENCE 1 (bases 1 to 714) | |
3919 AUTHORS Li N, Volff JN and Wizenmann A. | |
3920 TITLE Rab23 GTPase is expressed asymmetrically in Hensen's node and plays | |
3921 a role in the dorsoventral patterning of the chick neural tube | |
3922 JOURNAL Dev. Dyn. 236 (11), 2993-3006 (2007) | |
3923 PUBMED 17937392 | |
3924 REMARK GeneRIF: Rab23 plays an important role in patterning the | |
3925 dorso-ventral axis by dorsalizing the neural tube | |
3926 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
3927 NCBI review. The reference sequence was derived from EU176872.1. | |
3928 On Oct 23, 2007 this sequence version replaced gi:118088838. | |
3929 | |
3930 ##Evidence-Data-START## | |
3931 Transcript exon combination :: EU176872.1, BU404031.1 [ECO:0000332] | |
3932 RNAseq introns :: single sample supports all introns | |
3933 SAMEA2201361, SAMEA2201363 | |
3934 [ECO:0000348] | |
3935 ##Evidence-Data-END## | |
3936 FEATURES Location/Qualifiers | |
3937 source 1..714 | |
3938 /organism="Gallus gallus" | |
3939 /mol_type="mRNA" | |
3940 /db_xref="taxon:9031" | |
3941 /chromosome="3" | |
3942 /map="3" | |
3943 gene 1..714 | |
3944 /gene="RAB23" | |
3945 /note="ras-related protein Rab-23" | |
3946 /db_xref="CGNC:12171" | |
3947 /db_xref="GeneID:421879" | |
3948 CDS 1..714 | |
3949 /gene="RAB23" | |
3950 /note="RAB23, member RAS oncogene family" | |
3951 /codon_start=1 | |
3952 /product="ras-related protein Rab-23" | |
3953 /protein_id="NP_001103530.1" | |
3954 /db_xref="CGNC:12171" | |
3955 /db_xref="GeneID:421879" | |
3956 /translation="MLEEDMEVAIKVVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGV | |
3957 DFLERQIQVNDEEVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFKAIPT | |
3958 WKEKVTTEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKKLKLRFYRASVKEDLNVTE | |
3959 VFKYLADKYLQRLKQQTAEEPELVHTSSNKIGVFNTAIGSHPNQNSNTLNGGDVINLR | |
3960 PNKQRTKKSRSLFSNCSIP" | |
3961 ORIGIN | |
3962 1 atgttggaag aagacatgga ggtggccatc aaggtggtag tggtaggaaa tggagctgtt | |
3963 61 gggaagtcca gtatgattca gcgatactgc aaggggatct ttacaaaaga ctacaagaag | |
3964 121 actattggtg tagatttcct ggaaagacaa atccaagtta atgatgaaga agtcaggcta | |
3965 181 atgttatggg acactgcagg tcaagaggaa tttgatgcga taactaaggc ctactacaga | |
3966 241 ggagcccagg cttgtgttct tgtgttttct acaactgaca gagagtcctt caaagcaatc | |
3967 301 cctacctgga aggaaaaagt gacgactgaa gttggagaca ttcccacagt tcttgtgcag | |
3968 361 aataagatcg atcttttgga tgactcttgt ataaagaatg aagaggcaga agcactggca | |
3969 421 aaaaagctga aattaaggtt ctaccgagca tctgtgaagg aggacctcaa cgtcaccgaa | |
3970 481 gtttttaagt atttggctga taaatatctt caaaggctca agcagcaaac ggctgaagaa | |
3971 541 ccagaactag tacatacaag cagtaacaag attggtgttt tcaatacagc cattggaagt | |
3972 601 caccccaacc agaattccaa cactcttaac ggtggagacg tcatcaacct cagaccaaac | |
3973 661 aaacagagaa ccaagaaaag cagaagtctt tttagcaact gcagcatacc ttag | |
3974 // | |
3975 | |
3976 LOCUS NM_001044640 774 bp mRNA linear VRT 11-JAN-2017 | |
3977 DEFINITION Gallus gallus ras-related protein Rab-6A (RAB6A), mRNA. | |
3978 ACCESSION NM_001044640 XM_417254 | |
3979 VERSION NM_001044640.1 | |
3980 KEYWORDS RefSeq. | |
3981 SOURCE Gallus gallus (chicken) | |
3982 ORGANISM Gallus gallus | |
3983 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
3984 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
3985 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
3986 Phasianidae; Phasianinae; Gallus. | |
3987 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
3988 NCBI review. The reference sequence was derived from DQ470138.1. | |
3989 On Aug 29, 2006 this sequence version replaced gi:50731390. | |
3990 | |
3991 ##Evidence-Data-START## | |
3992 Transcript exon combination :: DQ470138.1, CR390639.1 [ECO:0000332] | |
3993 RNAseq introns :: single sample supports all introns | |
3994 SAMEA2201368, SAMEA2201377 | |
3995 [ECO:0000348] | |
3996 ##Evidence-Data-END## | |
3997 FEATURES Location/Qualifiers | |
3998 source 1..774 | |
3999 /organism="Gallus gallus" | |
4000 /mol_type="mRNA" | |
4001 /db_xref="taxon:9031" | |
4002 /chromosome="1" | |
4003 /map="1" | |
4004 gene 1..774 | |
4005 /gene="RAB6A" | |
4006 /note="ras-related protein Rab-6A" | |
4007 /db_xref="CGNC:50908" | |
4008 /db_xref="GeneID:419063" | |
4009 CDS 16..642 | |
4010 /gene="RAB6A" | |
4011 /note="RAB6A, member RAS oncogene family" | |
4012 /codon_start=1 | |
4013 /product="ras-related protein Rab-6A" | |
4014 /protein_id="NP_001038105.1" | |
4015 /db_xref="CGNC:50908" | |
4016 /db_xref="GeneID:419063" | |
4017 /translation="MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQA | |
4018 TIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQ | |
4019 QTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAG | |
4020 YNVKQLFRRVAAALPGMESTQDKSREDMIDIKLEKPQEQPVSEGGCSC" | |
4021 misc_feature 19..21 | |
4022 /gene="RAB6A" | |
4023 /experiment="experimental evidence, no additional details | |
4024 recorded" | |
4025 /note="N-acetylserine. {ECO:0000250}; propagated from | |
4026 UniProtKB/Swiss-Prot (Q1KME6.3); acetylation site" | |
4027 misc_feature 139..165 | |
4028 /gene="RAB6A" | |
4029 /experiment="experimental evidence, no additional details | |
4030 recorded" | |
4031 /note="propagated from UniProtKB/Swiss-Prot (Q1KME6.3); | |
4032 Region: Effector region. {ECO:0000250}" | |
4033 misc_feature 637..639 | |
4034 /gene="RAB6A" | |
4035 /experiment="experimental evidence, no additional details | |
4036 recorded" | |
4037 /note="Cysteine methyl ester. {ECO:0000250}; propagated | |
4038 from UniProtKB/Swiss-Prot (Q1KME6.3); methylation site" | |
4039 ORIGIN | |
4040 1 tcctctagtt ccacaatgtc ggcgggcggg gacttcggca acccgctgcg gaaattcaag | |
4041 61 ctggtgttcc tgggcgagca gagcgtgggg aagacttcct tgatcaccag gttcatgtat | |
4042 121 gacagctttg acaacaccta ccaggcaaca attggcattg acttcttatc aaaaaccatg | |
4043 181 tatttggagg atcgaacaat caggttgcag ctgtgggata ctgcgggtca ggaacgtttc | |
4044 241 cgtagcctca ttcccagtta catccgtgac tctgctgctg ctgtagtagt ttacgatatc | |
4045 301 acaaatgtca actcgttcca gcaaacaaca aaatggatcg acgatgtcag aacggaacgg | |
4046 361 ggcagcgatg tcatcattat gctggtggga aataaaacag atctagcaga taagaggcaa | |
4047 421 gtgtccattg aggaaggaga aagaaaagcc aaagagctga atgtaatgtt catcgaaact | |
4048 481 agtgcaaaag caggatacaa tgtaaaacag cttttccgac gcgtggcagc tgccttgcct | |
4049 541 ggaatggaaa gcacacaaga caaaagtaga gaagacatga ttgacatcaa actggaaaag | |
4050 601 cctcaagagc agcctgtcag tgaaggaggc tgctcctgct aataccacgt ggcttctgac | |
4051 661 ttcctccaga acatcactgc tttccctccc tttactcttc attgactgca gtgtgaatat | |
4052 721 tggcttgaac cttccccttt cagtaataac gtattgcagt tcatcatcgc tggc | |
4053 // | |
4054 | |
4055 LOCUS NM_001030706 1661 bp mRNA linear VRT 12-JAN-2017 | |
4056 DEFINITION Gallus gallus proteasome 26S subunit, non-ATPase 12 (PSMD12), mRNA. | |
4057 ACCESSION NM_001030706 XM_415677 | |
4058 VERSION NM_001030706.1 | |
4059 KEYWORDS RefSeq. | |
4060 SOURCE Gallus gallus (chicken) | |
4061 ORGANISM Gallus gallus | |
4062 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
4063 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
4064 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
4065 Phasianidae; Phasianinae; Gallus. | |
4066 REFERENCE 1 (bases 1 to 1661) | |
4067 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
4068 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
4069 P, Hayashizaki Y and Buerstedde JM. | |
4070 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
4071 gene function analysis | |
4072 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
4073 PUBMED 15642098 | |
4074 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
4075 NCBI review. The reference sequence was derived from AJ720947.1. | |
4076 On Aug 8, 2005 this sequence version replaced gi:50757850. | |
4077 | |
4078 ##Evidence-Data-START## | |
4079 Transcript exon combination :: AJ720947.1 [ECO:0000332] | |
4080 RNAseq introns :: single sample supports all introns | |
4081 SAMEA2201357, SAMEA2201358 | |
4082 [ECO:0000348] | |
4083 ##Evidence-Data-END## | |
4084 FEATURES Location/Qualifiers | |
4085 source 1..1661 | |
4086 /organism="Gallus gallus" | |
4087 /mol_type="mRNA" | |
4088 /db_xref="taxon:9031" | |
4089 /chromosome="18" | |
4090 /map="18" | |
4091 /breed="Leghorn" | |
4092 gene 1..1661 | |
4093 /gene="PSMD12" | |
4094 /note="proteasome 26S subunit, non-ATPase 12" | |
4095 /db_xref="CGNC:2706" | |
4096 /db_xref="GeneID:417425" | |
4097 CDS 43..1413 | |
4098 /gene="PSMD12" | |
4099 /note="proteasome (prosome, macropain) 26S subunit, | |
4100 non-ATPase, 12" | |
4101 /codon_start=1 | |
4102 /product="26S proteasome non-ATPase regulatory subunit 12" | |
4103 /protein_id="NP_001025877.1" | |
4104 /db_xref="CGNC:2706" | |
4105 /db_xref="GeneID:417425" | |
4106 /translation="MAEGGAERADGRIVKMEVDYSATVDQRLPECGRLAQEGRLQEVI | |
4107 ENLLSLEKQTRTASDMVSTSRILVAIVKMCYEAKDWDALNENIILLSKRRSQLKQAVA | |
4108 KMVQQCCTYVEDITDLPVKLRLIDTLRTVTEGKIYVEIERARLTKTLATIKEQNGEVK | |
4109 EAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEEN | |
4110 TEKLKLKYYNLMIQLDQHEGSYLSICKHYRAIYDTPCIQAESEKWQQALKSVVLYVIL | |
4111 SPYDNEQSDLVHRISSDKKLEEIPKYKDLLKLFTTMELMRWTALVEEYGKELREGSLD | |
4112 SPATDVFGCTEEGEKRWKDLKNRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEEF | |
4113 LSNLVVNKTIFAKVDRLAGIINFQRPKGPNNILNDWSHKLNSLMALVNKTTHLIAKEE | |
4114 MIHNLQ" | |
4115 ORIGIN | |
4116 1 ctggtgtgtg ttcgcggggg gacgcggagc ggagccgggg ccatggcgga gggcggcgcg | |
4117 61 gagcgggccg atggccgcat cgtgaaaatg gaggtggatt atagcgcgac ggtggaccag | |
4118 121 cggctgcccg agtgcgggcg actggcgcag gaggggagat tgcaagaagt aattgaaaac | |
4119 181 cttctctcct tggaaaaaca aacgcgaacg gcttctgaca tggtttccac atcgcgtatc | |
4120 241 ttagtggcta tagtgaagat gtgttatgaa gctaaagact gggatgctct gaatgaaaat | |
4121 301 attattcttc tgtcaaagag aagaagtcag ttaaaacagg cagttgctaa aatggtccag | |
4122 361 cagtgctgca cttacgttga agacatcaca gacttaccag tgaaactgcg cttaattgac | |
4123 421 acgttgcgta cagttacaga aggaaaaata tatgtggaaa tcgaacgtgc tcgcctgaca | |
4124 481 aagacacttg caacaataaa agaacagaat ggtgaagtga aagaggctgc ctctattctg | |
4125 541 caagaattgc aggtggaaac ttacggttca atggaaaaga aagaacgtgt agaatttatc | |
4126 601 cttgagcaga tgaggctctg tctagctgta aaagactaca ttcggactca aattatcagc | |
4127 661 aaaaaaatta atacaaaatt ttttcaagaa gaaaacacag aaaaactaaa attgaaatac | |
4128 721 tacaacctaa tgatccagct ggatcaacac gaaggctcct acctctccat ttgtaagcac | |
4129 781 tacagagcca tttatgatac tccatgtatt caagctgaga gtgaaaagtg gcagcaggca | |
4130 841 ctgaagagcg ttgttcttta tgttattctt tcaccttatg acaacgaaca atctgatttg | |
4131 901 gtgcacagaa ttagtagtga caaaaagcta gaagaaatcc cgaagtataa agacctccta | |
4132 961 aaattattta ccaccatgga gttgatgcga tggactgccc tagttgaaga atatgggaaa | |
4133 1021 gaattgagag aagggtccct cgacagtcct gcaacagatg tttttggctg tacagaggaa | |
4134 1081 ggtgaaaaga gatggaaaga tttaaagaac agagttgtgg aacataatat tagaataatg | |
4135 1141 gctaaatatt ataccagaat tacaatgaag agaatggcac agctcctgga tctgtccgtt | |
4136 1201 gatgaatcgg aggagttcct gtctaaccta gtagttaaca agaccatctt tgctaaagta | |
4137 1261 gacaggctgg caggaattat caatttccag aggcctaagg gtccaaacaa tatactgaat | |
4138 1321 gactggtctc acaagctgaa ctcactaatg gccctagtta acaaaaccac acatctcatt | |
4139 1381 gccaaagagg agatgataca taacctacag taaggtgcct caataatctc agtgctttta | |
4140 1441 aaggaaggca ttaaatcttc ataatagaga ctattattac agtgtgtata tgtttttttt | |
4141 1501 tctccccatc agggcttcct ggtctaaaat ttagaacata attctgaaat tcctgttgac | |
4142 1561 agttgagttc ccttgattat tcattcagtt gttaaacatt tttgctacaa ttggtgaaag | |
4143 1621 aacataataa aactgtattg cctgtaaaaa aaaaaaaaaa a | |
4144 // | |
4145 | |
4146 LOCUS NM_001030974 3714 bp mRNA linear VRT 11-JAN-2017 | |
4147 DEFINITION Gallus gallus RNA binding motif protein 48 (RBM48), mRNA. | |
4148 ACCESSION NM_001030974 XM_418656 | |
4149 VERSION NM_001030974.1 | |
4150 KEYWORDS RefSeq. | |
4151 SOURCE Gallus gallus (chicken) | |
4152 ORGANISM Gallus gallus | |
4153 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
4154 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
4155 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
4156 Phasianidae; Phasianinae; Gallus. | |
4157 REFERENCE 1 (bases 1 to 3714) | |
4158 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
4159 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
4160 P, Hayashizaki Y and Buerstedde JM. | |
4161 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
4162 gene function analysis | |
4163 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
4164 PUBMED 15642098 | |
4165 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
4166 NCBI review. The reference sequence was derived from AJ851572.1. | |
4167 On Aug 8, 2005 this sequence version replaced gi:50732482. | |
4168 | |
4169 ##Evidence-Data-START## | |
4170 Transcript exon combination :: AJ851572.1 [ECO:0000332] | |
4171 RNAseq introns :: single sample supports all introns | |
4172 SAMEA2201357, SAMEA2201358 | |
4173 [ECO:0000348] | |
4174 ##Evidence-Data-END## | |
4175 FEATURES Location/Qualifiers | |
4176 source 1..3714 | |
4177 /organism="Gallus gallus" | |
4178 /mol_type="mRNA" | |
4179 /db_xref="taxon:9031" | |
4180 /chromosome="2" | |
4181 /map="2" | |
4182 /breed="Leghorn" | |
4183 gene 1..3714 | |
4184 /gene="RBM48" | |
4185 /gene_synonym="C2H7ORF64; C7orf64; HSPC304" | |
4186 /note="RNA binding motif protein 48" | |
4187 /db_xref="CGNC:51284" | |
4188 /db_xref="GeneID:420555" | |
4189 CDS 38..1090 | |
4190 /gene="RBM48" | |
4191 /gene_synonym="C2H7ORF64; C7orf64; HSPC304" | |
4192 /note="UPF0712 protein C7orf64" | |
4193 /codon_start=1 | |
4194 /product="RNA-binding protein 48" | |
4195 /protein_id="NP_001026145.1" | |
4196 /db_xref="CGNC:51284" | |
4197 /db_xref="GeneID:420555" | |
4198 /translation="MAAGGGGALGEACRHHQQLGACGSRAKYREGRRPRAVKVYTINL | |
4199 ESRYLLIQGVPALGVMKELVEQFALYGAIEEYHALDEYPAEQFTEVYLIKFQNLQCAR | |
4200 VAKKKMDERSFFGSLLHVCYAPEFETVQETREKLQDRRKYIAKATNQRDCFLLKKTEG | |
4201 PRKTKSDCQWSTSGSYAASHWDPSCFPDSHGVSQNTEYPSGNHSQNLLTFPHCDNHSA | |
4202 ETSGNFGQSTSLKMHPGGCAAPVPLIQQRTGPADNGTDRFMPRTTQLQERKRKREEGN | |
4203 KSALIETNVNSTDIIIGPQLPEIPKVDMDDDSLNTSATLIRNKLKEVAESVSSTSVEK | |
4204 PGSSATKPLVKQRRRI" | |
4205 ORIGIN | |
4206 1 ggagctgcct gcgcggggag cggcggcggc cgggaagatg gcggcgggcg gtggcggcgc | |
4207 61 gctgggcgag gcgtgcagac accaccagca gctgggcgcc tgcgggtcgc gcgccaagta | |
4208 121 ccgcgagggg cggcggccca gggccgtcaa ggtgtatacc atcaacttgg aatctcgtta | |
4209 181 tttactgatc cagggggttc ctgcattagg tgtcatgaag gaattagtgg agcagtttgc | |
4210 241 cttatacggt gccatagaag agtaccacgc cctggatgaa tatcccgcag agcagttcac | |
4211 301 tgaagtttat ctcataaagt tccagaatct ccaatgtgcg agggtggcca agaaaaaaat | |
4212 361 ggatgaacgc agtttctttg ggagtttgct gcacgtgtgc tatgctccag aattcgaaac | |
4213 421 agtccaagaa accagggaga agctgcagga cagaaggaag tatatagcaa aagcaacaaa | |
4214 481 tcagagagac tgcttcctgt tgaagaaaac agaggggcct aggaagacca agtctgactg | |
4215 541 tcagtggagt acatcaggat cgtatgcagc tagtcactgg gatccatcct gctttccaga | |
4216 601 ttctcatggg gtgtcccaaa acacggaata tccttctggc aatcacagtc agaacctgtt | |
4217 661 gacttttccc cactgtgaca accacagtgc tgaaacttct gggaactttg gtcaaagcac | |
4218 721 atccctgaag atgcatccag gaggatgtgc tgcaccggtg cctttaattc agcaaagaac | |
4219 781 aggtccagct gataatggaa ctgacaggtt tatgcctcgt acaactcaac tgcaggaacg | |
4220 841 taagaggaag agagaagagg gtaacaaatc tgccctcatt gaaacaaatg tgaacagtac | |
4221 901 tgacatcatt attggtccac agctaccaga aatacctaaa gtggatatgg atgatgattc | |
4222 961 actgaatact tcagctacac tgattcgaaa taaactgaaa gaggtagcag agtcagtttc | |
4223 1021 aagtacatct gtggaaaagc caggcagcag tgccaccaag ccactagtaa agcagagaag | |
4224 1081 aagaatatag atactgctgg cagcatcctt ctgcagctct ttatagagga tataattaaa | |
4225 1141 aatacttaat gttgtttttt aaattaaaaa gaagtgtttt atattgcatt tccaagcaat | |
4226 1201 tccttgttaa aaactgtacc aggataaact aaaccagtat aatactgtag caattccttg | |
4227 1261 tcctgtgtat ttaaagagct gcaattaggt aaagtaataa aagtaaattc tatttattgc | |
4228 1321 atagctttta cagtaaagga atattgaaac ttaagatatc aattgttttg tgttgctttt | |
4229 1381 attcctaatg tcctctgagg aatgatgaag cattcttaga gcagtgttcc acttggagtt | |
4230 1441 acagttcacg cttttcctgg aaggtcctcc tttcaaatgc caaactgctc tgtgaaggag | |
4231 1501 aggaaaataa caagtttatt ctcagttaac tggaacgtct acatttagtt agttagaaaa | |
4232 1561 agagggcaaa ctggaatgtg taagtagcga aacaatgctt tgtagcacag aaaagctaaa | |
4233 1621 tccagtagca ttactgtcat caagaaactg atcacagttg taactgcact gggaaagctt | |
4234 1681 atgaattctg agcttccttc atttggtgct catagctgaa attattgatt tttgggattt | |
4235 1741 ggaagaatgt ataaatagag ttctttttaa gaatggaact agagacctag taaaaaggca | |
4236 1801 ccagttgggt agggtgcaga acagaataca cagataatgg aatcaagaaa ctggctcagc | |
4237 1861 ttcctacctg ttgccacaac tggctggaat tgtatccctg atttaccaca aactctgaca | |
4238 1921 aaaaacaaat catttttctg tgctgatcag tgaacgtaaa tgctgttaag aaactcttca | |
4239 1981 gaactttccc ttcatggaga aaaatagaag tactggccct gggtctctga aagcccactg | |
4240 2041 acagcctttt aaaatgtgac atcttgaaaa cagctgctat tcgggtgacc tgagataatc | |
4241 2101 cagactgcaa ccacagctat gagactcctt ccttctgtct tccagcctac caggaaggtg | |
4242 2161 agctggcatg aaatgtaggt tctgagcaaa taaatgcttg ccttgttttc aacaatctta | |
4243 2221 tggaactttt ctgtttctat gcattattgc atatatgtca gaatcttgtt tttccatctc | |
4244 2281 tatgagggca agaccgctgg cacttaaaaa tgaaatgcag ttcaaagagt ataatgatgg | |
4245 2341 atcagtgaaa aaattactat tacaaaggag acatctacac gtcagtttga tttaacgcta | |
4246 2401 aggaaattac tgcctcccaa atgaccatct ttcaggaaaa aaacctctct gaatcggatg | |
4247 2461 tactgctaat aaataaggct cagctggatg gaatttaaca acagtagcct aatacagtta | |
4248 2521 ttgtgagatg acacttctaa agtattttct ctgaaggtta ccggtctctc ccagaagaat | |
4249 2581 ggcagtggag ctggtggcac tgaagaaaga agaacaaaca ctgctttcct ggtgaagttt | |
4250 2641 cagataaact ctgcaagaga ctgatctcat tttttttagc cagggaggat gcttactgag | |
4251 2701 aatcatttat tgtattgctg ccccagcaca gacaagtggc acgacagtat gtttttatgc | |
4252 2761 tccctggtat cagtgtatga ctgtatcagg aaaggtgtac tgtgaaaggc agacatgaac | |
4253 2821 tcagaacatt tgtatcccac aactggaaca ccagcggaat tcagcaaact tcatacgaag | |
4254 2881 acagttaata ccataatatg aatgtatagt taaaaacagt acggagatag gtttttttaa | |
4255 2941 ctgaaggctg atgtaccttt acgtctggca aacatggtcc aaaggcttcc aagagaagat | |
4256 3001 tttcattttt gacagcttct tcaaagtccg caaaagaaag tttgccatca tggtcatagt | |
4257 3061 cctacacaag gagaagtctt tagcaaagac ctgcagcaat tgcctgttta tttaacagat | |
4258 3121 atttcattca tgtgcattta ttgattgatt gatagatttt acgcaaaaat cttccttggg | |
4259 3181 ccattagtct ccaaggtaag tagagtatgc ctctacttac agcataaaag atggaacaag | |
4260 3241 ctcaactatc tagtctagct ttgctaacag aattcctgat aaggcaaaat gttaacgtgg | |
4261 3301 gaagagctcg gactgagaac cctggggaca aatctcaaca atggctgcac aaggataaaa | |
4262 3361 gtagaagaaa atgttcagat gcattctgtc tatgtattta cattgtgagt atacctacat | |
4263 3421 ccatgaatta ctttatgcga gtggttttat tgtagacata cttctgccct gtctttttca | |
4264 3481 tgtgtagaca tagtagcaca tggagtatgc cactgccagc ctgcttctgg ctgtggaatg | |
4265 3541 ttcctctgta ggtggaaaag aagcatcctt gtgtttttag tatttctgta atttgaaaac | |
4266 3601 ctcctgtttc tacaagcata gcagcttaga gcaacaaatg ctacagtaag cacttcttta | |
4267 3661 atccttataa aggcattaag taaaagtaat aatttaagaa aaaaaaaaaa aaaa | |
4268 // | |
4269 | |
4270 LOCUS NM_001031172 2851 bp mRNA linear VRT 11-JAN-2017 | |
4271 DEFINITION Gallus gallus VPS51, GARP complex subunit (VPS51), mRNA. | |
4272 ACCESSION NM_001031172 XM_420916 | |
4273 VERSION NM_001031172.1 | |
4274 KEYWORDS RefSeq. | |
4275 SOURCE Gallus gallus (chicken) | |
4276 ORGANISM Gallus gallus | |
4277 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
4278 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
4279 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
4280 Phasianidae; Phasianinae; Gallus. | |
4281 REFERENCE 1 (bases 1 to 2851) | |
4282 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
4283 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
4284 P, Hayashizaki Y and Buerstedde JM. | |
4285 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
4286 gene function analysis | |
4287 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
4288 PUBMED 15642098 | |
4289 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
4290 NCBI review. The reference sequence was derived from AJ720609.1. | |
4291 On Aug 8, 2005 this sequence version replaced gi:50747587. | |
4292 | |
4293 ##Evidence-Data-START## | |
4294 Transcript exon combination :: AJ720609.1 [ECO:0000332] | |
4295 RNAseq introns :: mixed/partial sample support | |
4296 SAMEA2201357, SAMEA2201358 | |
4297 [ECO:0000350] | |
4298 ##Evidence-Data-END## | |
4299 FEATURES Location/Qualifiers | |
4300 source 1..2851 | |
4301 /organism="Gallus gallus" | |
4302 /mol_type="mRNA" | |
4303 /db_xref="taxon:9031" | |
4304 /chromosome="5" | |
4305 /map="5" | |
4306 /breed="Leghorn" | |
4307 gene 1..2851 | |
4308 /gene="VPS51" | |
4309 /gene_synonym="ANG2; ANG3; C11orf2; C11orf3; C5H11ORF2; | |
4310 FFR" | |
4311 /note="VPS51, GARP complex subunit" | |
4312 /db_xref="CGNC:3056" | |
4313 /db_xref="GeneID:422984" | |
4314 CDS 33..2396 | |
4315 /gene="VPS51" | |
4316 /gene_synonym="ANG2; ANG3; C11orf2; C11orf3; C5H11ORF2; | |
4317 FFR" | |
4318 /note="protein fat-free homolog; another new gene 2 | |
4319 protein; vacuolar protein sorting 51 homolog; VPS51 | |
4320 vacuolar protein sorting 51 homolog" | |
4321 /codon_start=1 | |
4322 /product="vacuolar protein sorting-associated protein 51 | |
4323 homolog" | |
4324 /protein_id="NP_001026343.1" | |
4325 /db_xref="CGNC:3056" | |
4326 /db_xref="GeneID:422984" | |
4327 /translation="MAEVEAAGSGTETGGGSESGNATGSGSGWRRPHGPLQRYYGPSA | |
4328 AEAAEATPDPADINGPHFDPEVFLTKVRSECRLGELLSREATLGREIRALDSDMQTLL | |
4329 YENYNKFISATDTIRKMKVDFRRMEAEMDDLASNMAAISASSARVSAALQDRHRRGAQ | |
4330 LAGVQALLRKLQSLVEVPGRLRRWAAPGADPARALHCYARARAVLRHYRHLPSFRAIE | |
4331 DESHSIMAELAQRLRARLRDDTLDPKELTECVEMLLQLEEPPEELCEEFLSQAGARLE | |
4332 AELAALEAELPPSDPSGTASTPPPASDILDFVDRGSSAFVSNLCLLAASYRSLFEGRP | |
4333 GSGDGRLEAFASTLTTRYFELLERRLALERGLGDTSLLVRALDRFHRRLRALLELLPA | |
4334 AGAEAGAALVARAARERVARYLRALQTFFLGCLGDVRQALAAPRPPGKDGPGLPDLLA | |
4335 TLSSSVLGQLKAVLAYVQLFTARDVAFASLPYFKGEFCVEAVREGLVVAFVRWLCRTA | |
4336 RGFADSPAERGAPAAPPALLLLLARLCLDYEATTISYILTLTDEQFPPEDTGPAVTPG | |
4337 PALCAEARGAAQRLLDHYVQVQGAAVAQMLRKSVETRDWLGTVEPRNVRAVMKRVVED | |
4338 ITAIDVQVGQLFEEGVRRAQSSDSSRRAFSVYSSSRAPGRYAPSYTPSAPMDTHLLSN | |
4339 IQKLFSERIDIFSPVEFNKVSVLTGIIKISLKTLLECVRLRTLGRFGLQQVQVDGHYL | |
4340 QLYLWRFAADERVVQGLLDEVAASAAHRCLDPVPMEHSVVELICERG" | |
4341 ORIGIN | |
4342 1 aagctgtcag ctggaccgga agtgtcggcg tgatggcgga ggtggaagcg gcggggtcgg | |
4343 61 ggaccgagac tggcggcggc tccgagtctg ggaacgcaac agggagcggg agtgggtggc | |
4344 121 ggcgacccca cggtccgctc cagcggtatt atggaccgtc tgcggccgaa gcggcagagg | |
4345 181 caaccccgga ccctgctgat atcaacgggc cccacttcga cccggaagtt tttctcacca | |
4346 241 aggtgcgcag tgagtgtcgc ctgggggagt tgttgtcccg tgaagctacg ctggggcggg | |
4347 301 agatccgtgc tctcgacagt gatatgcaaa cgctgctcta tgagaactac aacaagttca | |
4348 361 tttctgccac agacactatc cgaaagatga aggttgactt ccggcgcatg gaggcagaga | |
4349 421 tggatgattt ggcctccaac atggcagcca tcagtgcctc cagtgcccgt gtcagtgctg | |
4350 481 cgctgcagga ccggcaccgc cgcggtgctc agctggctgg ggtgcaggcg ctgctgcgga | |
4351 541 aactgcaatc ccttgtggag gtgccagggc ggctgcggcg gtgggcagca ccaggagctg | |
4352 601 atcctgcacg ggccctgcac tgctacgccc gtgcccgtgc tgtgctgcgc cactaccgcc | |
4353 661 acctgccctc cttccgtgcc atcgaggatg agagccactc catcatggct gagctggccc | |
4354 721 agcgcctccg tgcacgcctc cgggatgaca ccttggaccc gaaggaactc actgagtgtg | |
4355 781 tggagatgct cctgcagctg gaggaaccac ccgaggagct gtgtgaggag ttcctgagcc | |
4356 841 aggctggtgc ccgccttgaa gccgagctgg cggcgctgga ggctgagctg cccccatctg | |
4357 901 acccctctgg cactgcttcc acgccacctc ctgcctccga catcctcgac tttgttgacc | |
4358 961 gcggcagctc agccttcgtg agcaacctgt gcctccttgc ggcctcgtac cgcagcctct | |
4359 1021 ttgaggggcg tcccgggtcc ggggatggcc gcctggaggc ctttgcctcc accctcacca | |
4360 1081 cccgctactt tgagctgctg gagcgacgcc tggccctgga gcggggtctg ggcgacacgt | |
4361 1141 cactgttggt gcgggcactc gaccgttttc accgccgcct ccgtgctctc cttgagctgc | |
4362 1201 tgcctgcggc tggggctgaa gcaggtgccg cactggtggc ccgagcagca cgtgaacggg | |
4363 1261 tggcccgcta cctgcgggcg ctgcagacct tctttctggg gtgcctgggt gatgtgcgcc | |
4364 1321 aggcactggc tgcaccccgt cctcctggca aggatggccc tggactgcct gacctcttgg | |
4365 1381 ccacgctctc ctcctccgtt cttggtcagc tcaaggctgt cctggcctac gtgcagctct | |
4366 1441 tcactgccag ggatgttgcc tttgccagct tgccctactt caagggggag ttctgtgtcg | |
4367 1501 aggcggtgcg tgaaggactg gtggtggcct tcgtgcgctg gctctgccgt actgctcggg | |
4368 1561 gctttgctga cagcccagct gagcgaggtg cccctgcagc acccccagca ctgctgctgc | |
4369 1621 tccttgcccg tctctgcctt gactacgaag ccaccaccat cagctacatc ctcactctta | |
4370 1681 ctgatgagca gttccctcct gaggacacag gaccagcggt gacgccaggg ccagcactgt | |
4371 1741 gtgctgaggc acggggagcg gcgcagcggc tgctcgacca ctacgtacag gtgcagggcg | |
4372 1801 ctgcggtggc acagatgctg cggaagagcg tggagacacg ggactggttg ggcaccgtgg | |
4373 1861 agccccgcaa tgtccgtgct gtcatgaagc gtgtggttga ggacatcact gccatcgatg | |
4374 1921 tccaggtggg gcagctcttt gaggagggag tgcggcgggc gcagagcagc gactcgagcc | |
4375 1981 gacgtgcctt ctctgtgtac agcagctcac gggcaccggg acgctatgcc cctagctaca | |
4376 2041 ctcccagtgc ccccatggac acccacctgc tcagcaacat ccagaagctc ttctccgaac | |
4377 2101 gcattgacat cttcagccct gttgagttca acaaggtgtc agtgctgaca gggatcatca | |
4378 2161 agatcagcct gaagacactg ctggagtgtg tgcggctgcg gacgctgggg cgctttgggc | |
4379 2221 tgcagcaggt gcaggtggac ggccactacc tacagctcta cctctggcgc tttgctgctg | |
4380 2281 acgagcgtgt ggtgcagggg ctgctggatg aggtggctgc cagtgctgcc caccgctgcc | |
4381 2341 ttgaccctgt ccctatggag cacagcgtcg tcgagctcat ctgtgagcgt gggtaggacc | |
4382 2401 tgagagcacc caggaaacac ctggggacat gggttgatgc acgggtgagg gggcacagga | |
4383 2461 gtcatctatg tgactgtaga gcacagcaga gctgggggca tatctgggag gggaatgtgt | |
4384 2521 cttggatcct gccacaagga caggctttta cctcgtgtat ttagggacac cccatgtttt | |
4385 2581 cccacacatg cagtgacgta tacagacata ccacaccctc acacctgtaa ggtcaccctg | |
4386 2641 tgttcccccc ccgcagcccc agtaacaccc cacagtctct cccctcccca gtgatgccaa | |
4387 2701 cccgatgttg tccctgcagc cctaacgaca tgccacatca ttccacttcc ttggtgacat | |
4388 2761 ccccctacac gtgggacatg ctgcacgtag cccatgtgtc acagttgagg acaataaata | |
4389 2821 aaatgcatgc aagttaaaaa aaaaaaaaaa a | |
4390 // | |
4391 | |
4392 LOCUS NM_001031536 4463 bp mRNA linear VRT 11-JAN-2017 | |
4393 DEFINITION Gallus gallus trafficking protein particle complex 11 (TRAPPC11), | |
4394 mRNA. | |
4395 ACCESSION NM_001031536 XM_426304 | |
4396 VERSION NM_001031536.1 | |
4397 KEYWORDS RefSeq. | |
4398 SOURCE Gallus gallus (chicken) | |
4399 ORGANISM Gallus gallus | |
4400 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
4401 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
4402 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
4403 Phasianidae; Phasianinae; Gallus. | |
4404 REFERENCE 1 (bases 1 to 4463) | |
4405 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
4406 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
4407 P, Hayashizaki Y and Buerstedde JM. | |
4408 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
4409 gene function analysis | |
4410 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
4411 PUBMED 15642098 | |
4412 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
4413 NCBI review. The reference sequence was derived from AJ720895.1. | |
4414 On Aug 8, 2005 this sequence version replaced gi:50746836. | |
4415 | |
4416 ##Evidence-Data-START## | |
4417 Transcript exon combination :: AJ720895.1 [ECO:0000332] | |
4418 RNAseq introns :: mixed/partial sample support | |
4419 SAMEA2201357, SAMEA2201358 | |
4420 [ECO:0000350] | |
4421 ##Evidence-Data-END## | |
4422 FEATURES Location/Qualifiers | |
4423 source 1..4463 | |
4424 /organism="Gallus gallus" | |
4425 /mol_type="mRNA" | |
4426 /db_xref="taxon:9031" | |
4427 /chromosome="4" | |
4428 /map="4" | |
4429 /breed="Leghorn" | |
4430 gene 1..4463 | |
4431 /gene="TRAPPC11" | |
4432 /gene_synonym="C4H4ORF41; C4orf41; FOIGR; GRY; LGMD2S" | |
4433 /note="trafficking protein particle complex 11" | |
4434 /db_xref="CGNC:53450" | |
4435 /db_xref="GeneID:428748" | |
4436 CDS 99..3497 | |
4437 /gene="TRAPPC11" | |
4438 /gene_synonym="C4H4ORF41; C4orf41; FOIGR; GRY; LGMD2S" | |
4439 /note="UPF0636 protein C4orf41; gryzun homolog; foie gras | |
4440 homolog" | |
4441 /codon_start=1 | |
4442 /product="trafficking protein particle complex subunit 11" | |
4443 /protein_id="NP_001026707.1" | |
4444 /db_xref="CGNC:53450" | |
4445 /db_xref="GeneID:428748" | |
4446 /translation="MTPSQWDLPVELCCRPMAFVTLTGLDVVYNAVHRAVWDAFCANR | |
4447 RADRVPISFKVLPGDHEYPKCRTKRTSYEWYIPKGILKTGWMNKHLNLVPALVVVFYE | |
4448 LDWDEPQWKEKQSECATRVEIVRQSLQGRNTKVAVVLIQKKTPLPPGEDVIASERAAA | |
4449 LCNACDLSGKSLFVLPHTDHLVGYIIRLENAFYEHAQTYYYTEIRRVKSHKEFLNKTT | |
4450 HQLLFVRHQFKIAFFSELKQDTQNALKNYRTAYNLVHELRAHETNMLEIKTMAGFINY | |
4451 KICRLCFQHNTPLDAIAQFRKHIDLCKKKIGSAELAFEHAAWMSKQFQAFGDLFDEAI | |
4452 KLGLTAIQTQNPGFYYQQAAYYAQERKQLASMLCNHDSSVVYPNPDPLETQTGVLDFY | |
4453 GQRPWRQGTLSFDLSDPEKEKMGILSLQLKERNVLHSELIITLLSNAVAQFKKYKCPR | |
4454 MKSHLMVQMGEEYYFAKDYAKALKLLDYVMCEYRSEGWWTLLTSILTTALKCSYLMAQ | |
4455 IKDYITYSLELLGRASTLKDDQKSRIEKNLIKVLMNESPDPEPDCDAAAVKASQKLWS | |
4456 DRVSLAGSNVFTIEVQDFIPFVQCKAKFLAPSFHVDVPVQFDIYLRADCPHPIRFSKL | |
4457 CISFNNQDYNQYCVVEEAYQKSDILEQSSQGTMCLVPGKTRKFTFKFVAKTEDVGKKI | |
4458 EITSVDLILGSESGRCVILNWRGGGGDAASSQEALQAARSFRRRPKLPDNEVHWDSLA | |
4459 IQASTMIISRVPNISVQLRHEPPALTNEMYCLVVTIESHEETVAKDVKLTAGLKPGQD | |
4460 ANLTQKTQVTLRGTDTCDDSFPALLPDIPVGDLQPGEKLEKPIYIRCGTVGARMFLVY | |
4461 VSYLINTTVEGKEILCKCHRDETVTIETVFPFDVAIKFVSTKLEHLDRVFADIPFLLM | |
4462 TDILSASPWPLTIVTSQLQLSASMTSVDQLESYVENVVLQTGESASECFCLRCPPVTN | |
4463 SGGVATGCYIISWKRSSPVESVPVVSTVITLPHVIVESIPLHVKADLPSFGRVRESLP | |
4464 VRYHLQNKTNLVQDVEVSMEPSDAFMFSGLKQIRLRILPGTQQEVLYNFYPLMAGYQQ | |
4465 LPSLHINLLRFPNFTNQLLRRFIPTHIFVKPQGRQADENSIAAA" | |
4466 ORIGIN | |
4467 1 cccgccccgc ctcccgtgat cgtcgctggc gccggggctg ctgggccccc agctgctgct | |
4468 61 tcggcctccc gcttcggccg ggggccgcgg ggagcaggat gactccgagc cagtgggact | |
4469 121 tgccggtgga gctatgctgc cggcctatgg ccttcgtcac cctcaccggc ctggacgtgg | |
4470 181 tgtacaacgc cgtgcaccgg gccgtgtggg atgccttctg cgccaaccgg agggccgacc | |
4471 241 gcgtccccat ctccttcaaa gtgctgcccg gcgaccacga gtaccccaag tgccggacga | |
4472 301 agaggacctc ctacgagtgg tatattccaa aagggatcct aaagacgggt tggatgaaca | |
4473 361 aacacctgaa tttagttcct gcacttgtgg tggtgttcta tgaactggac tgggatgagc | |
4474 421 cacagtggaa agaaaagcag tcggaatgtg ccactcgggt tgaaattgtc aggcaaagtt | |
4475 481 tgcaaggaag aaatacaaaa gttgccgtgg tcttaattca gaagaaaact ccattacctc | |
4476 541 caggggaaga tgttattgca tcagagaggg cagcagcttt atgtaatgct tgtgaccttt | |
4477 601 ctggaaaatc cctctttgtg cttccacaca ctgatcatct cgttggctat attataaggt | |
4478 661 tggaaaacgc attctatgag catgcccaga cttactatta tacagaaata cgaagagtca | |
4479 721 aatctcataa ggaattcttg aacaaaacca ctcaccagct tctgtttgtt agacaccagt | |
4480 781 tcaaaatagc attcttcagt gagctgaaac aggatacaca gaatgctctc aaaaattaca | |
4481 841 ggactgcata taatctcgta catgaattaa gggctcatga aacaaacatg ctggaaatca | |
4482 901 agaccatggc aggatttata aactacaaga tctgtcgcct ctgttttcaa cacaatactc | |
4483 961 cactggatgc aattgctcag tttaggaagc acatagactt atgcaagaaa aagataggaa | |
4484 1021 gtgctgaact ggcttttgag catgctgcct ggatgtctaa acagtttcag gcttttggtg | |
4485 1081 acttgtttga tgaagcgatt aaactgggct tgacagcaat tcaaactcag aatccaggtt | |
4486 1141 tctactacca gcaagctgcc tactatgctc aggagcggaa acaactagca agtatgcttt | |
4487 1201 gtaaccatga ttcctctgtg gtatatccca acccggatcc cttggaaaca cagactggag | |
4488 1261 tgcttgactt ctatgggcag agaccatggc ggcagggaac attaagcttt gatctttctg | |
4489 1321 atcctgaaaa ggagaagatg gggattttat ccctccagct gaaagagaga aatgtccttc | |
4490 1381 actcagagct aataattacc ctgttgagta atgctgttgc gcagttcaag aaatacaaat | |
4491 1441 gtccaagaat gaaaagtcat ttgatggttc aaatgggtga agaatattac tttgctaaag | |
4492 1501 attacgccaa agctttgaag ctgttggact acgttatgtg tgaatatcgc agtgaaggat | |
4493 1561 ggtggactct tctcacttcc atactgacga cagctctcaa gtgttcatat ctgatggccc | |
4494 1621 agataaagga ttatataacg tactctttag aattattggg tagagcatct actcttaaag | |
4495 1681 atgatcagaa atctcgaata gaaaaaaatc tgataaaagt tctaatgaat gagagccctg | |
4496 1741 atcctgaacc tgattgtgat gctgctgcag tgaaagcatc acagaagttg tggtctgatc | |
4497 1801 gtgtttcttt ggcaggcagt aatgttttta caatagaggt ccaagatttc ataccatttg | |
4498 1861 tgcaatgcaa agcaaaattc cttgctccaa gttttcatgt tgatgtccct gtgcagtttg | |
4499 1921 atatttactt aagagctgat tgtcctcatc ctatcaggtt ttctaagctc tgcatcagtt | |
4500 1981 tcaataatca ggattacaac caatactgtg tggtagaaga agcctatcaa aaaagtgata | |
4501 2041 tcctagaaca gtcgtcacaa ggaacgatgt gcttagtccc tggtaaaaca cggaagttca | |
4502 2101 cgttcaaatt cgttgcaaaa actgaagatg taggaaagaa gattgagatc acctctgtgg | |
4503 2161 atttgatctt gggtagcgaa tctggccgat gtgtgattct gaattggcgt ggaggaggtg | |
4504 2221 gagatgctgc ttcgtctcaa gaagcactgc aggcagcacg ttccttcagg cggagaccca | |
4505 2281 agcttccgga taatgaagtt cattgggaca gtttggctat tcaagcaagc actatgatta | |
4506 2341 tttctagggt gccaaacatt tctgttcagc ttcgtcatga acctcctgcc ctgactaatg | |
4507 2401 aaatgtactg tttggttgtg actatcgagt cacatgagga gacagtggcc aaagatgtta | |
4508 2461 agcttactgc aggtttaaag ccagggcaag atgccaactt gactcagaaa actcaagtaa | |
4509 2521 ctcttcgagg aacagataca tgcgatgact cctttcccgc attgcttcct gatatccctg | |
4510 2581 taggagatct gcaaccaggg gaaaagctgg aaaaaccaat atacattcgt tgtggaacag | |
4511 2641 ttggtgcaag gatgtttctt gtctatgtct cttacttgat caacacgact gttgaaggga | |
4512 2701 aagaaatcct ctgcaaatgc caccgggatg aaactgtaac tatagaaaca gtatttcctt | |
4513 2761 ttgatgttgc catcaaattt gtttccacaa agctggagca cttggacaga gtttttgcag | |
4514 2821 atataccatt tttactgatg acagacatcc tgagtgcttc tccttggccc ctcactattg | |
4515 2881 taaccagcca gctacagctg tcagcttcca tgacctcggt agatcagctg gaatcttatg | |
4516 2941 tggaaaatgt tgttttacag acaggtgaga gtgccagtga gtgcttttgc ctgcgatgtc | |
4517 3001 ctccagttac taatagtggt ggagtggcaa ctggatgtta tatcatttcc tggaagagaa | |
4518 3061 gttcacctgt ggaaagtgta cctgttgtta gtacagtcat cactctgcca catgtgattg | |
4519 3121 tagagagcat tcccctccat gttaaagcag atctgccatc atttggtcga gttcgagaat | |
4520 3181 ccctccctgt cagatatcac ctgcaaaata agaccaattt agtccaggat gtagaggtgt | |
4521 3241 caatggaacc cagcgacgca ttcatgttct ctggccttaa gcagatccgg ttaagaatcc | |
4522 3301 ttcctggcac gcagcaggaa gtattatata acttctatcc tctgatggct ggatatcaac | |
4523 3361 agttaccatc tcttcatatt aacttgctgc gattcccaaa cttcactaat cagctgctca | |
4524 3421 gacgattcat acctacacac atctttgtga agcctcaggg tcgtcaagca gatgaaaact | |
4525 3481 caattgcagc tgcgtaactc caagacttgc acctctgcac ttaaagaaga tgggaagttg | |
4526 3541 cacagaatac ataatgtttg ctttggaaac atggctttga tcaaaccata agaattattt | |
4527 3601 gtttttaatt acatctctta acagaactaa tgtttaaaaa aaaaaaagtc tttcatagac | |
4528 3661 cctccttaag gaggaaacat ggggaaaagt tggtgcttta tgtaacagga acattatttt | |
4529 3721 gaaggtaacg ctgaatgtca aactcttaaa agtattactt tataggcata ttaaatgtct | |
4530 3781 tgagtgctta agtgaagaaa tgcaaatatg ttttaccaaa actaaaagac gttttcataa | |
4531 3841 ttaacagtaa gttgaagtgc taggtttgca ctttacaaca ctgaaaatga ttatccttta | |
4532 3901 caaaaacgtg ttctgtgcca cttgtgtgga gggcaaagca agctgtgtag tagcatagga | |
4533 3961 ggctacaagt gatgaacttg tgctgttggg atcaagtggc ttactagttg tttaaaaggg | |
4534 4021 taaatctgaa agacgcttct tctgggtaag ccatacatct ggatttgagt tcagcatctg | |
4535 4081 gtctaatgaa cagagagatt cattcataac aggtggactg tccaacctca actcgatgtg | |
4536 4141 gctttgaatt acttttgcac gcacagcttc ccgattgagg aggtcttgat gacatgcccc | |
4537 4201 ctgctgtgtc agtaaaaaga aagacatcct actgttgtac agctacagat gaactggtgt | |
4538 4261 ttaaaataca ataaatcctg tacatattta aaaagaacga acaacgaaca ttgtgaaaac | |
4539 4321 ttcagttgtt taactttcta aataatgaca ttttgcttgg agaatatctt atttattgtc | |
4540 4381 aaagtgaagt tctaataaat agcttgtaac agtgcttctg aaaaaaaaaa aaaaaaaaaa | |
4541 4441 aaaaaaataa aaaaaaaaaa aaa | |
4542 // | |
4543 | |
4544 LOCUS NM_001012804 4592 bp mRNA linear VRT 12-JAN-2017 | |
4545 DEFINITION Gallus gallus protein kinase C alpha (PRKCA), mRNA. | |
4546 ACCESSION NM_001012804 XM_415682 | |
4547 VERSION NM_001012804.1 | |
4548 KEYWORDS RefSeq. | |
4549 SOURCE Gallus gallus (chicken) | |
4550 ORGANISM Gallus gallus | |
4551 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
4552 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
4553 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
4554 Phasianidae; Phasianinae; Gallus. | |
4555 REFERENCE 1 (bases 1 to 4592) | |
4556 AUTHORS Guo D, Standley C, Bellve K, Fogarty K and Bao ZZ. | |
4557 TITLE Protein kinase Calpha and integrin-linked kinase mediate the | |
4558 negative axon guidance effects of Sonic hedgehog | |
4559 JOURNAL Mol. Cell. Neurosci. 50 (1), 82-92 (2012) | |
4560 PUBMED 22521536 | |
4561 REMARK GeneRIF: PKCalpha directly phosphorylates integrin-linked kinase on | |
4562 threonine-173 and -181 in vitro. Dominant negative PKCalpha | |
4563 disrupts RGC axon pathfinding at the optic chiasm. | |
4564 REFERENCE 2 (bases 1 to 4592) | |
4565 AUTHORS Tunsophon S and Nemere I. | |
4566 TITLE Protein kinase C isotypes in signal transduction for the | |
4567 1,25D3-MARRS receptor (ERp57/PDIA3) in steroid hormone-stimulated | |
4568 phosphate uptake | |
4569 JOURNAL Steroids 75 (4-5), 307-313 (2010) | |
4570 PUBMED 20079367 | |
4571 REMARK GeneRIF: PKCalpha and PKCbeta are both involved in | |
4572 steroid-stimulated phosphate uptake. | |
4573 REFERENCE 3 (bases 1 to 4592) | |
4574 AUTHORS Suh HN, Lee YJ and Han HJ. | |
4575 TITLE Interleukin-6 promotes 2-deoxyglucose uptake through p44/42 MAPKs | |
4576 activation via Ca2+/PKC and EGF receptor in primary cultured | |
4577 chicken hepatocytes | |
4578 JOURNAL J. Cell. Physiol. 218 (3), 643-652 (2009) | |
4579 PUBMED 19006119 | |
4580 REMARK GeneRIF: IL-6 stimulates the 2-deoxyglucose uptake through p44/42 | |
4581 MAPKs activation via Ca(2+)/PKC and EGF receptor in primary | |
4582 cultured chicken hepatocytes. | |
4583 REFERENCE 4 (bases 1 to 4592) | |
4584 AUTHORS Lee SH, Lee MY, Lee JH and Han HJ. | |
4585 TITLE A potential mechanism for short time exposure to hypoxia-induced | |
4586 DNA synthesis in primary cultured chicken hepatocytes: Correlation | |
4587 between Ca(2+)/PKC/MAPKs and PI3K/Akt/mTOR | |
4588 JOURNAL J. Cell. Biochem. 104 (5), 1598-1611 (2008) | |
4589 PUBMED 18646054 | |
4590 REMARK GeneRIF: Short time exposure to hypoxia increases DNA synthesis in | |
4591 primary cultured chicken hepatocytes through cooperation of | |
4592 Ca2+/PKC, p38 MAPK, p44/42 MAPKs, and PI3K/Akt pathways. | |
4593 REFERENCE 5 (bases 1 to 4592) | |
4594 AUTHORS Pan JQ, Tan X, Li JC, Sun WD, Huang GQ and Wang XL. | |
4595 TITLE Reduced PKCalpha expression in pulmonary arterioles of broiler | |
4596 chickens is associated with early feed restriction | |
4597 JOURNAL Res. Vet. Sci. 84 (3), 434-439 (2008) | |
4598 PUBMED 17707446 | |
4599 REMARK GeneRIF: Early time feed restriction inhibits pulmonary vascular | |
4600 remodeling in broilers, which may be partly attributed to reduced | |
4601 PKCalpha expression in pulmonary arterioles. | |
4602 REFERENCE 6 (bases 1 to 4592) | |
4603 AUTHORS Suh HN, Lee SH, Lee MY, Lee YJ, Lee JH and Han HJ. | |
4604 TITLE Role of interleukin-6 in the control of DNA synthesis of | |
4605 hepatocytes: involvement of PKC, p44/42 MAPKs, and PPARdelta | |
4606 JOURNAL Cell. Physiol. Biochem. 22 (5-6), 673-684 (2008) | |
4607 PUBMED 19088449 | |
4608 REMARK GeneRIF: IL-6 stimulates the proliferation of primary cultured | |
4609 chicken hepatocytes through PKC, p44/42 MAPKs, and PPARdelta | |
4610 pathways. | |
4611 REFERENCE 7 (bases 1 to 4592) | |
4612 AUTHORS Lee YA, Kang SS, Baek SH, Jung JC, Jin EJ, Tak EN and Sonn JK. | |
4613 TITLE Redifferentiation of dedifferentiated chondrocytes on chitosan | |
4614 membranes and involvement of PKCalpha and P38 MAP kinase | |
4615 JOURNAL Mol. Cells 24 (1), 9-15 (2007) | |
4616 PUBMED 17846494 | |
4617 REMARK GeneRIF: p38 MAP kinase activities are required for chondrocyte | |
4618 redifferentiation in a model system of dedifferentiated | |
4619 chondrocytes | |
4620 GeneRIF: PKC and p38 MAP kinase activities are required for | |
4621 chondrocyte redifferentiation in a model system of dedifferentiated | |
4622 chondrocytes. | |
4623 REFERENCE 8 (bases 1 to 4592) | |
4624 AUTHORS Wang W and Kirsch T. | |
4625 TITLE Annexin V/beta5 integrin interactions regulate apoptosis of growth | |
4626 plate chondrocytes | |
4627 JOURNAL J. Biol. Chem. 281 (41), 30848-30856 (2006) | |
4628 PUBMED 16914549 | |
4629 REMARK GeneRIF: binding of annexin V to active PKCalpha stimulates | |
4630 apoptotic events in growth plate chondrocytes and binding of | |
4631 annexin V to beta5 integrin controls these interactions and | |
4632 ultimately apoptosis | |
4633 REFERENCE 9 (bases 1 to 4592) | |
4634 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
4635 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
4636 P, Hayashizaki Y and Buerstedde JM. | |
4637 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
4638 gene function analysis | |
4639 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
4640 PUBMED 15642098 | |
4641 REFERENCE 10 (bases 1 to 4592) | |
4642 AUTHORS Takezaki N, Figueroa F, Zaleska-Rutczynska Z, Takahata N and Klein | |
4643 J. | |
4644 TITLE The phylogenetic relationship of tetrapod, coelacanth, and lungfish | |
4645 revealed by the sequences of forty-four nuclear genes | |
4646 JOURNAL Mol. Biol. Evol. 21 (8), 1512-1524 (2004) | |
4647 PUBMED 15128875 | |
4648 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
4649 NCBI review. The reference sequence was derived from AJ851529.1. | |
4650 On Mar 14, 2005 this sequence version replaced gi:50757860. | |
4651 | |
4652 ##Evidence-Data-START## | |
4653 Transcript exon combination :: AJ851529.1 [ECO:0000332] | |
4654 RNAseq introns :: mixed/partial sample support | |
4655 SAMEA2201357, SAMEA2201358 | |
4656 [ECO:0000350] | |
4657 ##Evidence-Data-END## | |
4658 FEATURES Location/Qualifiers | |
4659 source 1..4592 | |
4660 /organism="Gallus gallus" | |
4661 /mol_type="mRNA" | |
4662 /db_xref="taxon:9031" | |
4663 /chromosome="18" | |
4664 /map="18" | |
4665 /breed="Leghorn" | |
4666 gene 1..4592 | |
4667 /gene="PRKCA" | |
4668 /note="protein kinase C alpha" | |
4669 /db_xref="CGNC:50506" | |
4670 /db_xref="GeneID:417430" | |
4671 CDS 68..2092 | |
4672 /gene="PRKCA" | |
4673 /EC_number="2.7.11.1" | |
4674 /codon_start=1 | |
4675 /product="protein kinase C alpha type" | |
4676 /protein_id="NP_001012822.1" | |
4677 /db_xref="CGNC:50506" | |
4678 /db_xref="GeneID:417430" | |
4679 /translation="MADVFPGSEPGAAPDAARRFARKGALRQKNVHEVKEHKFIARFF | |
4680 KQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKH | |
4681 KFKIHTYGSPTFCDHCGSLLYGLLHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRG | |
4682 RIYLKAEVTGDKLEVTVREAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTFRST | |
4683 LNPHWNESFTFKLKPTDKDRRLSVEVWDWDRTTRNDFMGSLSFGVSELMKMPASGWYK | |
4684 LLNQEEGEYYNVPIPDADEDGNAELRQKFEKAKLGPAGNKVITPSEDRNSSVPSNNLD | |
4685 RVKLTDFNFLMVLGKGSFGKVMLADRKNTEELYAIKILKKDVVIQDDDVECTMVEKRV | |
4686 LALQDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEIS | |
4687 VGLFFLHNRGIVYRDLKLDNVMLDSEGHIKIADFGMCKEHMLDGVTTRTFCGTPDYIA | |
4688 PEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKE | |
4689 AVSICKGLMTKHPAKRLGCGLEGERDIREHAFFRRIDWEKLENREIQPPFKPKVCGKG | |
4690 AENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPLLENVA" | |
4691 ORIGIN | |
4692 1 ggttcggcgg ccgccggacg gttgcgtgac gaggcgggca gatccttctg gatacgagcg | |
4693 61 gagagccatg gccgacgtgt tcccgggctc cgagcccggc gcggccccgg acgcggcgcg | |
4694 121 gcgctttgct cgcaaagggg ccctgaggca gaagaacgtg cacgaggtga aggagcacaa | |
4695 181 attcatcgcg cgcttcttca agcagcccac cttctgcagc cactgcaccg acttcatctg | |
4696 241 gggatttggg aaacaaggat ttcagtgcca agtttgctgt tttgtggttc ataagagatg | |
4697 301 ccatgagttc gttaccttct cctgtcctgg agctgacaag ggacctgaca ccgatgaccc | |
4698 361 caggagcaag cacaaattta agatccacac ctatgggagc ccaaccttct gtgaccactg | |
4699 421 tgggtccctt ctttatgggc tcctacacca agggatgaaa tgtgacactt gtgatatgaa | |
4700 481 tgtgcataag caatgtgtga taaacgtccc gagcctctgt ggcatggatc acactgagaa | |
4701 541 aaggggaagg atttatctga aggctgaagt cactggtgac aaactggaag taacagtgcg | |
4702 601 agaagcaaaa aacctaattc ccatggatcc aaatgggctt tcagatcctt atgttaaact | |
4703 661 gaaacttatc ccagatccca agaatgaaag taaacaaaaa acaaaaacct tccgttctac | |
4704 721 cctgaatcca cactggaatg agtcattcac atttaaatta aaacctacag acaaagatcg | |
4705 781 acggctctct gtagaggtct gggactggga tcgaacaacc aggaatgatt ttatgggctc | |
4706 841 tctttcattt ggggtgtcag agctcatgaa gatgccagcc agtggatggt acaagctgct | |
4707 901 gaatcaagaa gaaggtgaat attataatgt tccaattcca gatgctgacg aggatggaaa | |
4708 961 tgcagagctc cggcagaagt tcgagaaagc caaacttggg ccagctggta acaaagtcat | |
4709 1021 tactccatca gaagacagga attcaagtgt gccatccaac aatctggaca gggtgaaact | |
4710 1081 gacagatttc aactttctta tggttcttgg aaaaggaagc tttggaaagg tgatgctggc | |
4711 1141 ggacaggaag aatacagagg agctctatgc aatcaaaata ctgaaaaaag atgtggtgat | |
4712 1201 tcaggatgat gatgttgagt gtacaatggt tgaaaaacga gtgctagcac tgcaggataa | |
4713 1261 accaccattc ctgacacagc ttcactcatg tttccaaaca gttgaccgcc tgtattttgt | |
4714 1321 tatggagtat gtgaatggtg gggatctcat gtaccacatt cagcaagtag gaaaatttaa | |
4715 1381 ggagccacaa gcagtgttct atgcagctga gatctcagtt gggttattct ttctccataa | |
4716 1441 tagagggatt gtttatagag atctgaaatt ggataatgtg atgttggatt cagaaggaca | |
4717 1501 cattaaaatt gctgactttg gaatgtgcaa agaacatatg ttagatggag taacaaccag | |
4718 1561 gaccttctgt ggcaccccag attacatcgc accggagatc attgcttatc agccctatgg | |
4719 1621 gaagtctgtg gattggtggg catatggagt gctgctctac gagatgttag ctggccagcc | |
4720 1681 tccatttgat ggagaagatg aagatgaact tttccagtcc ataatggaac ataatgtttc | |
4721 1741 ctatccaaaa tcgctgtcca aagaagctgt ctccatctgc aaggggctaa tgactaaaca | |
4722 1801 tcccgcaaag cgccttggct gcggcctcga aggtgaaaga gacatcaggg aacacgcttt | |
4723 1861 cttcaggaga attgactggg agaaactgga aaacagagag atccagccac ctttcaagcc | |
4724 1921 caaagtgtgt ggcaaaggtg ctgaaaactt cgataaattc ttcacgcgag gacagccggt | |
4725 1981 gttgaccccg ccagaccagc tggtcattgc taacatagat caatccgatt ttgaagggtt | |
4726 2041 ctcctatgtc aacccccagt ttgtacatcc cctcctagaa aatgtagcat gaaacagcag | |
4727 2101 aacaggaaca aatcccgcag tggggaacgg ttcttaaccc taaaattttt aggtttttgc | |
4728 2161 cttgattccg tttgggcctg aaaattatag ggttagaaag tgtaagatgg gagaaaggcc | |
4729 2221 acttagtgag gattttgact ttgcaaccaa aacgtcttaa tgggagataa attagcatac | |
4730 2281 agtgcccatt tctcctacta gaagtcacca tgactcgtct gaagttcccc atttttggta | |
4731 2341 cattctgtag ttctgtagct ccccgctgtc cttttgctcc gtttttcact ccgctgctgt | |
4732 2401 tacaaataat ccaagacccg acctgagaag cacctccagt actcagtcct tgcaggggac | |
4733 2461 cagctccccg ctcctatggg caccatgggg agagcagcgc acgggactgg agagcgccgg | |
4734 2521 ggaggagagg cattgcagaa tgtggtggaa agcagttgtt accaaaaccc gacaaataaa | |
4735 2581 tacgagttgg gagtgggagg gcagggggga tgaaatccta ttagagccca aagcttcgtg | |
4736 2641 aaccaatcct gtaagcaaca ccaaatttaa acacgctccg gcagtggcca gatctctaga | |
4737 2701 tctttgctaa gtagcatgtg ataaactcga gggtgaagtt ttgtctttaa taataataat | |
4738 2761 aatagtaata attttaataa tatttttgtg aattttaatc tccgtgagat tattctgtga | |
4739 2821 tccagggtgc cattgtttgt tcagttgatt tcatttgcac cactcctcaa gctcactgtt | |
4740 2881 gactggttct aataacacca acgttttact atgagatttg ttaacctgga atgtaaaaca | |
4741 2941 gaactgtaat cccttacatc ttatttactt gtgtgtgttg tagtctgcag tatagggcag | |
4742 3001 taaattgaag gaagtattgt gtatgctaaa ttaacaaaaa cgcagtccca ggtgactccc | |
4743 3061 tgatttttcc agaacaactc atgaaaatga attgagattt agttctacag taatcaattc | |
4744 3121 taactcagaa aacttggggc tgtacaataa ccaagcttga aagaagcacc tgaagcttgt | |
4745 3181 tttattggca gaatggaatt taacacattt tacatacgct tcatgcaatg aattttgcat | |
4746 3241 gtttagtaat aactcttaat aataagagtt aataataagc agttctatat tgacattacc | |
4747 3301 atatcaagca tacagagtat tacaaaagtt ttataaaaca aattgtgctt tatttgtgga | |
4748 3361 agtacttgtt ctgaacgaca tcatttaggt ttagctcaat gttttcttgc tgttgttttg | |
4749 3421 ggttgttttt ttctagtttt tggatattgt taatgactta gggtatcatc tgttttttta | |
4750 3481 aacgtagatc tacttttaaa caataattgc tacctgcagg ttttatacaa gtttcaatta | |
4751 3541 ggcttttgtt tcatgtctgc tgattactga cagggaaaga aatagatttt atttgcaatg | |
4752 3601 atgaacgctg taattaatgc aatcttctcc tctcctatct cacttagata caaattttga | |
4753 3661 tatttcctct taccaactta ccagaagatc ttaattcaaa tatcagtaaa tatttttgtg | |
4754 3721 cttactttgg ttttgttaca gcatgtaaaa tagtaggcgg tgcgttttcc ttttcttccc | |
4755 3781 ttcagcctcg ttaatggtag cagccatagg cactctttgt ctgtcggatg tgcatgatga | |
4756 3841 tgccagaagc atgatgtctc tgttgctgca tgcagactga atacagtttt tccagcatgt | |
4757 3901 aaacatattc aaaaagtcag atatttgcca taaaagactt acatttatac tagaatatgt | |
4758 3961 aaccggaggg tgggggtggg agcggggggg gaggaatcta ctttctaatc atcttttatt | |
4759 4021 acaataaaac attgagcctg tgccaaagat tctgctagaa agatccagtc ctgcagattg | |
4760 4081 gacggcgatg atgtgcagga gtgaccccgt ggcacatggg acagttggtg agcgaaccgc | |
4761 4141 agctggatgt gagcagaagc ggccgtgcgg tgctcctgca ccacggatgc cttccaaagc | |
4762 4201 cgtcctttgg cgcctgggat ttgcagcact ccagttgtgt gaccagccct gcttcctttg | |
4763 4261 tggtcacagc cctaaggttg gagcatcccc agagagggct cagcccgtgt tggatggacc | |
4764 4321 cggcgctgac acatggcatc ccccaacgaa cagctcccca gattgttgcc taaataaaca | |
4765 4381 gaactcaaac attttaatac attttaggag tacagttttt caactatccg gtgtcagata | |
4766 4441 tgttatcagc caaatttggg cattcgtttt cctctttgtg tattatatac ctgaagatta | |
4767 4501 tggtatgttg ttccccataa agcatgtgga ctagtgcagc aaaaaaaaaa aaaaaaaaaa | |
4768 4561 aaaaaaaaaa aaaaacaaaa aaaaaaaaaa aa | |
4769 // | |
4770 | |
4771 LOCUS NM_001006355 1767 bp mRNA linear VRT 11-JAN-2017 | |
4772 DEFINITION Gallus gallus ras-related protein Rab-18-B (RAB18), mRNA. | |
4773 ACCESSION NM_001006355 XM_418585 | |
4774 VERSION NM_001006355.1 | |
4775 KEYWORDS RefSeq. | |
4776 SOURCE Gallus gallus (chicken) | |
4777 ORGANISM Gallus gallus | |
4778 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
4779 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
4780 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
4781 Phasianidae; Phasianinae; Gallus. | |
4782 REFERENCE 1 (bases 1 to 1767) | |
4783 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
4784 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
4785 P, Hayashizaki Y and Buerstedde JM. | |
4786 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
4787 gene function analysis | |
4788 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
4789 PUBMED 15642098 | |
4790 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
4791 NCBI review. The reference sequence was derived from AJ719773.1. | |
4792 On Jan 13, 2005 this sequence version replaced gi:50732330. | |
4793 | |
4794 ##Evidence-Data-START## | |
4795 Transcript exon combination :: AJ719773.1, AJ455751.1 [ECO:0000332] | |
4796 RNAseq introns :: single sample supports all introns | |
4797 SAMEA2201366, SAMN03354473 | |
4798 [ECO:0000348] | |
4799 ##Evidence-Data-END## | |
4800 FEATURES Location/Qualifiers | |
4801 source 1..1767 | |
4802 /organism="Gallus gallus" | |
4803 /mol_type="mRNA" | |
4804 /db_xref="taxon:9031" | |
4805 /chromosome="2" | |
4806 /map="2" | |
4807 /breed="Leghorn" | |
4808 gene 1..1767 | |
4809 /gene="RAB18" | |
4810 /note="ras-related protein Rab-18-B" | |
4811 /db_xref="CGNC:5610" | |
4812 /db_xref="GeneID:420483" | |
4813 CDS 64..684 | |
4814 /gene="RAB18" | |
4815 /note="RAB18, member RAS oncogene family" | |
4816 /codon_start=1 | |
4817 /product="ras-related protein Rab-18" | |
4818 /protein_id="NP_001006355.1" | |
4819 /db_xref="CGNC:5610" | |
4820 /db_xref="GeneID:420483" | |
4821 /translation="MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVD | |
4822 FKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNW | |
4823 LNELETYCTRNDIVKMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQC | |
4824 AFEELVEKIIQTPGLWESESQNKGVKLSNKEEGHGGGACGGYCSML" | |
4825 mat_peptide 64..672 | |
4826 /gene="RAB18" | |
4827 /product="Ras-related protein Rab-18" | |
4828 /experiment="experimental evidence, no additional details | |
4829 recorded" | |
4830 /note="propagated from UniProtKB/Swiss-Prot (Q5ZLG1.1)" | |
4831 misc_feature 172..198 | |
4832 /gene="RAB18" | |
4833 /experiment="experimental evidence, no additional details | |
4834 recorded" | |
4835 /note="propagated from UniProtKB/Swiss-Prot (Q5ZLG1.1); | |
4836 Region: Effector region. {ECO:0000250}" | |
4837 misc_feature 670..672 | |
4838 /gene="RAB18" | |
4839 /experiment="experimental evidence, no additional details | |
4840 recorded" | |
4841 /note="Cysteine methyl ester. {ECO:0000255}; propagated | |
4842 from UniProtKB/Swiss-Prot (Q5ZLG1.1); methylation site" | |
4843 ORIGIN | |
4844 1 gccgcagcct gtgtagggag cgtctgtcgg tcggggccgg gcagggccgg gcgcgccgac | |
4845 61 gggatggacg aggacgtgtt gaccacgctg aagattctca ttatcggcga gagcggcgtc | |
4846 121 ggcaagtcca gccttctgct gcgattcaca gatgatacat ttgacccaga acttgcagca | |
4847 181 acaattggtg tagacttcaa ggtgaaaact atttcagttg atggaaacaa agctaaacta | |
4848 241 gcaatatggg atactgcggg tcaggagcgg ttcagaacac taacacccag ttactacaga | |
4849 301 ggtgcacagg gtgttattct ggtttatgat gttacaagaa gagatacttt tgtcaagctg | |
4850 361 gataactggt taaatgaact ggaaacgtac tgcacaagga atgacatagt gaaaatgctt | |
4851 421 gttggaaaca agattgataa ggaaaaccgt gaagttgaca gaaacgaagg tctcaaattt | |
4852 481 gcaagaaaac attccatgtt gttcatagag gcaagtgcaa aaacctgcga cggtgtacag | |
4853 541 tgtgcctttg aagaacttgt ggaaaaaatc attcagactc ctggactgtg ggagagtgag | |
4854 601 agccaaaaca aaggtgtaaa attatcaaac aaggaagaag gacatggagg aggcgcatgt | |
4855 661 ggtggatatt gttctatgtt ataaactttg ggaggcttat tctttgcata tttaaacaga | |
4856 721 tagtgacatc tttctgtaaa taaatccatt aaatgctatt tttagggacc ttgcagtttg | |
4857 781 cacatacttg ttttgtatca tggcagtgaa cacttgtagg aaaaatgttc tgcagctttc | |
4858 841 ccagtttgag aatgttatgg taagcatgcc caatttgcca tcttcaggtt tttataaagt | |
4859 901 agcataaata atgtgcagga acaaatgcac taaaagtttt atgactgtat acatccatca | |
4860 961 tgtaagtatt ctaaacaaat ccatctaaca catgcacatt actacattgt ttgctttctg | |
4861 1021 tctcattttt aaatactctt gaaattacag aactacgtag tgcacacaga ccttgaaaac | |
4862 1081 agcgtaagct ataaatgtta catttcatct cttctagtag atgctttttt gatattaaaa | |
4863 1141 acaacgtgat tatacagttc ttagataaat gctgaatttt aatttcagct gagctgtcaa | |
4864 1201 aaatacaaat tggcataggc cataattgat atcagcacct tctggaagag atgccgtgaa | |
4865 1261 agcttccttt gcaaagctga gggatgccct tttttctttt taatcatcac ttcagttgat | |
4866 1321 ggcttaactg gagttttaat cctgtgatat ttatatacta aatttgtggt actcttgcac | |
4867 1381 tctaggtttt tatgatgcag tttactctag gtctgctgta gaaagtcttc atttttggca | |
4868 1441 aggagtctaa atgacatctt tgttctttca ttgtgaatca gcttgccact cttcagtaca | |
4869 1501 gatgcctcat tttcttaaat gtttataact atctcaaact gtagctcact atggctgtga | |
4870 1561 agatctgtat tatgtctgct ttgtgtggct acctgtttgg aaatataact tcctatcaca | |
4871 1621 gacactaaat gggaagctcc ggggctactg tatggaaaat actacaatga gtattcactt | |
4872 1681 gaattaactg tatcaaagcc aatggtttgt ttcagaagac ttgtatagac taataaattt | |
4873 1741 tttttccaca gtaaaaaaaa aaaaaaa | |
4874 // | |
4875 | |
4876 LOCUS NM_204172 1574 bp mRNA linear VRT 11-JAN-2017 | |
4877 DEFINITION Gallus gallus limb development membrane protein 1 (LMBR1), mRNA. | |
4878 ACCESSION NM_204172 | |
4879 VERSION NM_204172.1 | |
4880 KEYWORDS RefSeq. | |
4881 SOURCE Gallus gallus (chicken) | |
4882 ORGANISM Gallus gallus | |
4883 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
4884 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
4885 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
4886 Phasianidae; Phasianinae; Gallus. | |
4887 REFERENCE 1 (bases 1 to 1574) | |
4888 AUTHORS Huang Y, Chen W, Li N, Deng X, Kang X and Liu X. | |
4889 TITLE Identification of an alternative splicing isoform of chicken Lmbr1 | |
4890 JOURNAL Mol. Biol. Rep. 38 (7), 4397-4403 (2011) | |
4891 PUBMED 21161408 | |
4892 REMARK GeneRIF: Chicken Lmbr1 was alternatively spliced to generate | |
4893 multiple splice forms. | |
4894 REFERENCE 2 (bases 1 to 1574) | |
4895 AUTHORS Huang Y, Du X, Deng X, Qiu X, Wang C, Chen W, Li N and Wu C. | |
4896 TITLE Single nucleotide polymorphisms in chicken lmbr1 gene were | |
4897 associated with chicken growth and carcass traits | |
4898 JOURNAL Sci. China, C, Life Sci. 50 (1), 62-69 (2007) | |
4899 PUBMED 17393084 | |
4900 REMARK GeneRIF: Lmbr1 gene could be a genetic locus or linked to a major | |
4901 gene significantly affecting growth and carcass traits in chickens. | |
4902 REFERENCE 3 (bases 1 to 1574) | |
4903 AUTHORS Huang YQ, Deng XM, Du ZQ, Qiu X, Du X, Chen W, Morisson M, Leroux | |
4904 S, Ponce de Leon FA, Da Y and Li N. | |
4905 TITLE Single nucleotide polymorphisms in the chicken Lmbr1 gene are | |
4906 associated with chicken polydactyly | |
4907 JOURNAL Gene 374, 10-18 (2006) | |
4908 PUBMED 16650944 | |
4909 REFERENCE 4 (bases 1 to 1574) | |
4910 AUTHORS Maas SA and Fallon JF. | |
4911 TITLE Isolation of the chicken Lmbr1 coding sequence and characterization | |
4912 of its role during chick limb development | |
4913 JOURNAL Dev. Dyn. 229 (3), 520-528 (2004) | |
4914 PUBMED 14991708 | |
4915 REMARK GeneRIF: Lmbr1 is not required for normal chick limb development | |
4916 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
4917 NCBI review. The reference sequence was derived from AB105057.1. | |
4918 | |
4919 Sequence Note: This sequence has been modified as follows: removed | |
4920 22 bp suspected to be vector contamination from the 3' end. | |
4921 | |
4922 ##Evidence-Data-START## | |
4923 Transcript exon combination :: AB105057.1 [ECO:0000332] | |
4924 RNAseq introns :: mixed/partial sample support | |
4925 SAMEA2201357, SAMEA2201358 | |
4926 [ECO:0000350] | |
4927 ##Evidence-Data-END## | |
4928 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
4929 1-1574 AB105057.1 1-1574 | |
4930 FEATURES Location/Qualifiers | |
4931 source 1..1574 | |
4932 /organism="Gallus gallus" | |
4933 /mol_type="mRNA" | |
4934 /db_xref="taxon:9031" | |
4935 /chromosome="2" | |
4936 /map="2" | |
4937 gene 1..1574 | |
4938 /gene="LMBR1" | |
4939 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT; | |
4940 ZRS" | |
4941 /note="limb development membrane protein 1" | |
4942 /db_xref="CGNC:48990" | |
4943 /db_xref="GeneID:373986" | |
4944 misc_feature 59..61 | |
4945 /gene="LMBR1" | |
4946 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT; | |
4947 ZRS" | |
4948 /note="upstream in-frame stop codon" | |
4949 CDS 65..1531 | |
4950 /gene="LMBR1" | |
4951 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT; | |
4952 ZRS" | |
4953 /note="limb region 1 homolog; differentiation-related gene | |
4954 14 protein" | |
4955 /codon_start=1 | |
4956 /product="limb region 1 protein homolog" | |
4957 /protein_id="NP_989503.1" | |
4958 /db_xref="CGNC:48990" | |
4959 /db_xref="GeneID:373986" | |
4960 /translation="MEADEVSIREQNFHSQVREYTICFLLFAVLYIVSYFIITRYKRK | |
4961 ADEQEDEDAIVNRISLFLSTFTLAVSAGAVLLLPFSIISNEILLSFPQNYYIQWLNGS | |
4962 LIHGLWNLASLFSNLCLFVLMPFAFFFLESEGFAGLKKGIRARILETLVMLILLALLI | |
4963 LGIVWVASALIDNDAASMESLYDLWEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTV | |
4964 MGQLLVKPTILEDLDEQMYIITLEEEAIQRKLNGISSTLENQTVELERELEKVKCKKT | |
4965 NLERRKKASAWERNLVYPAVMILLLIETSISVLLVAFNILYLLVDETAMPKGSGGPGI | |
4966 GNASLSTFGFVGAALEIILIFYLMVSSVVGFYSLRFFENFIPRKDDTTMTKIIGNCVS | |
4967 ILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFAIMTTLCLVRKFT | |
4968 SAVREELLKALGLDKLHLSNNPRDSETKPSANGHQKTL" | |
4969 misc_feature 119..181 | |
4970 /gene="LMBR1" | |
4971 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT; | |
4972 ZRS" | |
4973 /experiment="experimental evidence, no additional details | |
4974 recorded" | |
4975 /note="propagated from UniProtKB/Swiss-Prot (Q7ZUA6.1); | |
4976 transmembrane region" | |
4977 misc_feature 248..310 | |
4978 /gene="LMBR1" | |
4979 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT; | |
4980 ZRS" | |
4981 /experiment="experimental evidence, no additional details | |
4982 recorded" | |
4983 /note="propagated from UniProtKB/Swiss-Prot (Q7ZUA6.1); | |
4984 transmembrane region" | |
4985 misc_feature 392..454 | |
4986 /gene="LMBR1" | |
4987 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT; | |
4988 ZRS" | |
4989 /experiment="experimental evidence, no additional details | |
4990 recorded" | |
4991 /note="propagated from UniProtKB/Swiss-Prot (Q7ZUA6.1); | |
4992 transmembrane region" | |
4993 misc_feature 515..577 | |
4994 /gene="LMBR1" | |
4995 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT; | |
4996 ZRS" | |
4997 /experiment="experimental evidence, no additional details | |
4998 recorded" | |
4999 /note="propagated from UniProtKB/Swiss-Prot (Q7ZUA6.1); | |
5000 transmembrane region" | |
5001 misc_feature 623..685 | |
5002 /gene="LMBR1" | |
5003 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT; | |
5004 ZRS" | |
5005 /experiment="experimental evidence, no additional details | |
5006 recorded" | |
5007 /note="propagated from UniProtKB/Swiss-Prot (Q7ZUA6.1); | |
5008 transmembrane region" | |
5009 misc_feature 950..1012 | |
5010 /gene="LMBR1" | |
5011 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT; | |
5012 ZRS" | |
5013 /experiment="experimental evidence, no additional details | |
5014 recorded" | |
5015 /note="propagated from UniProtKB/Swiss-Prot (Q7ZUA6.1); | |
5016 transmembrane region" | |
5017 misc_feature 1079..1141 | |
5018 /gene="LMBR1" | |
5019 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT; | |
5020 ZRS" | |
5021 /experiment="experimental evidence, no additional details | |
5022 recorded" | |
5023 /note="propagated from UniProtKB/Swiss-Prot (Q7ZUA6.1); | |
5024 transmembrane region" | |
5025 misc_feature 1211..1273 | |
5026 /gene="LMBR1" | |
5027 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT; | |
5028 ZRS" | |
5029 /experiment="experimental evidence, no additional details | |
5030 recorded" | |
5031 /note="propagated from UniProtKB/Swiss-Prot (Q7ZUA6.1); | |
5032 transmembrane region" | |
5033 misc_feature 1340..1402 | |
5034 /gene="LMBR1" | |
5035 /gene_synonym="ACHP; C7orf2; DIF14; LSS; PPD2; THYP; TPT; | |
5036 ZRS" | |
5037 /experiment="experimental evidence, no additional details | |
5038 recorded" | |
5039 /note="propagated from UniProtKB/Swiss-Prot (Q7ZUA6.1); | |
5040 transmembrane region" | |
5041 ORIGIN | |
5042 1 acgcggggag caggcgcggc ggcggcggcc gccattgcgc gcgggggccg cgggactatg | |
5043 61 aaggatggag gcggacgagg tgtcgatccg cgagcagaac ttccacagcc aagtgcggga | |
5044 121 gtacacgatc tgttttctcc tatttgctgt tctctacata gtgtcctact tcataatcac | |
5045 181 aagatacaaa agaaaagcag atgagcaaga ggatgaagat gccatagtta acagaatatc | |
5046 241 gctgttcttg agcaccttca ctctagcagt ttcagctggt gcagtcctgc ttctgccttt | |
5047 301 ctcaataatc agcaatgaga tcctgctttc ttttccacaa aactactata ttcagtggtt | |
5048 361 aaatggctca ctaattcatg gtttatggaa tcttgcttct cttttttcca atttatgttt | |
5049 421 gtttgtgttg atgccctttg cctttttctt cttggagtcg gaaggatttg ctggcttaaa | |
5050 481 aaaggggatc agagcacgca ttctggagac ccttgtaatg ctcatacttc ttgcactgct | |
5051 541 tatccttgga atcgtatggg tggcttcagc tctcatagac aatgatgctg ccagtatgga | |
5052 601 gtctttgtac gacctctggg aattctacct cccatattta tattcctgta tatcactgat | |
5053 661 gggatgcttg ttacttctgt tatgcacgcc agtgggactt tcacggatgt ttacagtaat | |
5054 721 gggtcagttg ctggtgaagc caacaattct tgaggaccta gatgagcaga tgtatatcat | |
5055 781 cactttagag gaagaagcaa ttcagaggaa gcttaatggg atatcttcca cattggaaaa | |
5056 841 ccagacagtg gagttggaac gggagcttga aaaagtgaag tgcaagaaaa caaatctaga | |
5057 901 acgtcggaaa aaagcttctg cttgggagag gaatttagtg tatccagctg ttatgatatt | |
5058 961 gctactgatt gagacatcca tctcagtcct attagttgct ttcaacatcc tttacctgtt | |
5059 1021 ggttgatgag actgcaatgc caaaaggatc agggggacct ggaataggaa atgcatccct | |
5060 1081 atccaccttt ggttttgtgg gagcagcact tgaaatcatt ttgattttct atctcatggt | |
5061 1141 atcctctgtc gtcggcttct acagccttcg tttttttgaa aatttcattc ccaggaagga | |
5062 1201 tgatacaact atgacaaaga taattggaaa ctgtgtctca atcttggtgc tgagctcggc | |
5063 1261 tttgccagtg atgtcaagga cactgggaat tactcgattt gatctgcttg gagacttcgg | |
5064 1321 aaggtttaac tggctgggaa acttctatat tgtattatct tacaacttgc tctttgctat | |
5065 1381 catgacaaca ttgtgtctgg tcagaaagtt cacttctgct gtgcgagaag agctcctgaa | |
5066 1441 ggcattagga ttagataaac ttcatctgtc gaacaatcca agagactcag agacaaagcc | |
5067 1501 gtctgcaaat gggcatcaga aaacactgtg attgacaatc acctgcaatc aacagagctg | |
5068 1561 aaaacatcaa cctc | |
5069 // | |
5070 | |
5071 LOCUS NM_204212 2751 bp mRNA linear VRT 11-JAN-2017 | |
5072 DEFINITION Gallus gallus hexokinase 2 (HK2), mRNA. | |
5073 ACCESSION NM_204212 | |
5074 VERSION NM_204212.1 | |
5075 KEYWORDS RefSeq. | |
5076 SOURCE Gallus gallus (chicken) | |
5077 ORGANISM Gallus gallus | |
5078 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
5079 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
5080 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
5081 Phasianidae; Phasianinae; Gallus. | |
5082 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
5083 NCBI review. The reference sequence was derived from AB083370.1. | |
5084 | |
5085 ##Evidence-Data-START## | |
5086 Transcript exon combination :: AB083370.1 [ECO:0000332] | |
5087 RNAseq introns :: single sample supports all introns | |
5088 SAMEA2201357, SAMEA2201358 | |
5089 [ECO:0000348] | |
5090 ##Evidence-Data-END## | |
5091 FEATURES Location/Qualifiers | |
5092 source 1..2751 | |
5093 /organism="Gallus gallus" | |
5094 /mol_type="mRNA" | |
5095 /db_xref="taxon:9031" | |
5096 gene 1..2751 | |
5097 /gene="HK2" | |
5098 /gene_synonym="hexokinase-2" | |
5099 /note="hexokinase 2" | |
5100 /db_xref="CGNC:49018" | |
5101 /db_xref="GeneID:374044" | |
5102 CDS 1..2751 | |
5103 /gene="HK2" | |
5104 /gene_synonym="hexokinase-2" | |
5105 /EC_number="2.7.1.1" | |
5106 /codon_start=1 | |
5107 /product="hexokinase-2" | |
5108 /protein_id="NP_989543.1" | |
5109 /db_xref="CGNC:49018" | |
5110 /db_xref="GeneID:374044" | |
5111 /translation="MIASHLLAYFFTELNHDQAQKVDKYLYHMRLSEDTLQEVSERFR | |
5112 KEMEKGLGADTNPTASVKMLPSFVRSTPDGTEDGDFLALDLGGTNFRVLRVKVSDNGL | |
5113 QKVEMESQIYEIHEDLMRGSGMQLFDHIAECLGNFMEKLKIKDKKLPLGFTFSFPCHQ | |
5114 TKLDESILVNWTKGFKCSSVEGKDVVSLLRRAIKKRGDFDIDIVAVVNDTVGTMMSCG | |
5115 YDDQNCEVGLIVGTGTNACYMEEMRHIDLVEGDEGRMCINMEWGAFGDDGALNDIRTE | |
5116 FDHEIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKEGLLFQGKLSSDLRTTGHF | |
5117 ETRFVSAIEKEKEGLQKAHEILTKLGLEPSHEDCLATHRICQIVSTRSANLCGATLAA | |
5118 RLRRIKEYKGVDPLRSTVGVDGSVYKKYPHFARRLHKTVRKLLPDCEIRFVRSEDGSG | |
5119 KGAAMVTAVAYRLAAQHKARQKILEALKLSHEQLLEVKRRMRVEMEKGLGKETHAEAT | |
5120 VKMLPTYVCSTPDGTEKGDFLALDLGGTNFRVLLVRVRNGMRRGVEMHNKIYSIPLEV | |
5121 MQGTGEELFDHIVHCISDFLEYMGMKGVSLPLGFTFSFPCKQTNLDEGILLKWTKGFK | |
5122 ATGCEGEDVVSLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGYEDPYCEVGLIVGTGS | |
5123 NACYMEEMRNVELVEGDEGRMCVNMEWGAFGDNGCLDDIQTEFDLAVDELSLNPGKQR | |
5124 FEKMISGMYLGEIVRNILMDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDCLALL | |
5125 QVRSILQHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAAVVDKIRENRGLDFLKV | |
5126 TVGVDGTLYKLHPHFSAIMQDTVRQLSPCCEVTFLQSEDGSGKGAALITAVACRIREA | |
5127 GQ" | |
5128 ORIGIN | |
5129 1 atgatcgcgt cccatctgct cgcctatttc ttcacggagc tcaaccatga ccaggcgcag | |
5130 61 aaggtggaca aatacctgta ccacatgcgg ctctccgagg acacactgca ggaggtgtcc | |
5131 121 gagcgcttcc gcaaggagat ggagaagggg ctgggagccg acaccaaccc caccgcctcc | |
5132 181 gtcaagatgc tgccctcctt cgtcaggtcc accccggacg ggacagagga cggagacttc | |
5133 241 ttggcactgg acctgggcgg caccaacttt cgtgtgctga gggtgaaggt gtccgacaac | |
5134 301 ggcctgcaga aggtggagat ggagagccag atctacgaga tccacgagga cctcatgcga | |
5135 361 ggcagtggga tgcagctctt tgaccacatc gccgagtgcc tgggcaactt catggagaag | |
5136 421 ctgaaaatca aggacaagaa gctgcccctt ggcttcacct tctccttccc gtgtcaccag | |
5137 481 accaagctgg atgagagcat cctcgtcaac tggacaaagg gattcaagtg cagcagcgtg | |
5138 541 gaggggaagg acgtggtgtc cctgctgcgc agggccatca aaaagcgcgg ggacttcgac | |
5139 601 atcgacatcg tggcggtggt aaacgacacc gttggcacca tgatgtcctg tggctatgat | |
5140 661 gaccagaact gtgaagtcgg actcatcgtg gggacgggca ccaacgcctg ctacatggag | |
5141 721 gagatgaggc acatcgacct ggtggagggg gacgagggcc ggatgtgcat caacatggag | |
5142 781 tggggcgcct tcggggacga cggcgcgctc aacgacatca ggaccgagtt cgaccatgag | |
5143 841 atagacatgg gctcgctcaa ccccggcaag cagctgttcg agaagatgat cagcgggatg | |
5144 901 tacatgggcg agctggtgcg cctcatcctg gtgaagatgg ccaaggaggg gctcctcttc | |
5145 961 caagggaagc tctcttcgga tctgcgcacc accggacact tcgagaccag atttgtctcc | |
5146 1021 gctattgaga aggagaaaga ggggctgcag aaagcccacg agatcctcac caagctgggc | |
5147 1081 ctggagccat cccacgagga ctgcctggcc acccaccgca tctgccagat cgtctccacc | |
5148 1141 cgctcggcca acctctgtgg ggccacgctg gccgcccgtc tgcgccgcat caaggagtat | |
5149 1201 aagggggtgg acccgctgcg ctccaccgtc ggcgtggatg gctccgtcta caagaagtac | |
5150 1261 ccgcactttg cccgacgcct ccataagaca gtgaggaagc tgctgcccga ctgcgagatc | |
5151 1321 cgattcgtga ggtcggaaga tggcagtggt aaaggggcgg ccatggtgac ggcggtggcc | |
5152 1381 taccggctgg cggcccagca caaggcccgg cagaagatcc tggaggcgct gaagctgagc | |
5153 1441 cacgagcagc tcctggaggt gaagcggagg atgagggttg aaatggagaa ggggttgggc | |
5154 1501 aaggagacgc acgcggaggc cacggtgaag atgctgccca catacgtgtg ctcaactcca | |
5155 1561 gacgggacag aaaaaggaga tttcctcgct ctggacctgg gggggacgaa cttccgtgtg | |
5156 1621 ctgctggtgc gggtgcggaa cgggatgcgg cgcggcgtgg agatgcacaa caagatctac | |
5157 1681 tccatccccc tggaggtgat gcaggggaca ggcgaggagc tcttcgacca catcgtccac | |
5158 1741 tgcatctccg acttcctgga atacatgggg atgaagggag tgtcgctccc gctgggcttc | |
5159 1801 accttctcct tcccatgcaa gcagaccaac ctggatgagg ggattctcct caagtggacg | |
5160 1861 aagggtttca aagccacggg ctgcgaaggg gaggacgtgg tgagcctgct gaaggaggca | |
5161 1921 atccaccgca gagaggagtt tgacctggac gtggtggcag tggtgaacga cacggtgggc | |
5162 1981 accatgatga cctgtggcta cgaagacccc tactgtgaag tcgggctgat agttggcaca | |
5163 2041 ggcagcaacg cctgctacat ggaggagatg cggaacgtgg agctggtgga gggcgacgag | |
5164 2101 ggccgcatgt gtgtcaacat ggagtggggt gcgtttgggg acaacggctg cttggatgac | |
5165 2161 atccagaccg agttcgattt ggccgtagat gagctgtccc tcaaccctgg gaagcagaga | |
5166 2221 tttgagaaga tgatcagcgg gatgtacctg ggggagatcg tccgcaacat cctgatggac | |
5167 2281 ttcaccaagc gagggctgct cttccgcggc cgcatctcag agcggctcaa gaccagaggg | |
5168 2341 atcttcgaga caaagttcct gtcccagata gaaagcgact gcctggccct gctgcaggtg | |
5169 2401 cgctccatcc tccagcacct gggcttggag agcacgtgtg atgacagcat catcgtcaag | |
5170 2461 gaggtgtgca ccgtggtggc ccggcgtgcc gcgcagctct gcggggccgg aatggccgcc | |
5171 2521 gtggtggata agatccgcga gaaccgtggg ctggacttcc tcaaggtgac ggtcggagtg | |
5172 2581 gatgggacgc tctacaaact gcacccacac ttctcggcca tcatgcagga cacggtgagg | |
5173 2641 cagctgtccc cgtgctgcga ggtgacgttc ctgcagtcgg aggacggcag cggtaaaggc | |
5174 2701 gcggcgctca tcacggccgt ggcgtgccgg atccgtgagg ccggtcagtg a | |
5175 // | |
5176 | |
5177 LOCUS NM_001348012 2521 bp mRNA linear VRT 04-JAN-2017 | |
5178 DEFINITION Gallus gallus ubiquitin specific peptidase 7 (USP7), transcript | |
5179 variant 2, mRNA. | |
5180 ACCESSION NM_001348012 | |
5181 VERSION NM_001348012.1 | |
5182 KEYWORDS RefSeq. | |
5183 SOURCE Gallus gallus (chicken) | |
5184 ORGANISM Gallus gallus | |
5185 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
5186 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
5187 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
5188 Phasianidae; Phasianinae; Gallus. | |
5189 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
5190 preliminary review. The reference sequence was derived from | |
5191 AADN04000130.1. | |
5192 | |
5193 Transcript Variant: This variant (2) differs in the 3' coding | |
5194 region and contains a distinct 3' UTR, compared to variant 1. The | |
5195 resulting isoform (2) has a shorter and distinct C-terminus, | |
5196 compared to isoform 1. | |
5197 | |
5198 Sequence Note: This RefSeq record was created from transcript and | |
5199 genomic sequence data to make the sequence consistent with the | |
5200 reference genome assembly. The genomic coordinates used for the | |
5201 transcript record were based on transcript alignments. | |
5202 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
5203 1-240 AADN04000130.1 5955168-5955407 | |
5204 241-345 AADN04000130.1 5978477-5978581 | |
5205 346-544 AADN04000130.1 5983587-5983785 | |
5206 545-683 AADN04000130.1 5985141-5985279 | |
5207 684-772 AADN04000130.1 5988319-5988407 | |
5208 773-881 AADN04000130.1 5989123-5989231 | |
5209 882-1012 AADN04000130.1 5994344-5994474 | |
5210 1013-1067 AADN04000130.1 5997303-5997357 | |
5211 1068-1148 AADN04000130.1 5998393-5998473 | |
5212 1149-1239 AADN04000130.1 5998561-5998651 | |
5213 1240-1322 AADN04000130.1 5999425-5999507 | |
5214 1323-1432 AADN04000130.1 6000453-6000562 | |
5215 1433-1589 AADN04000130.1 6000975-6001131 | |
5216 1590-1734 AADN04000130.1 6002153-6002297 | |
5217 1735-1865 AADN04000130.1 6002875-6003005 | |
5218 1866-2000 AADN04000130.1 6004074-6004208 | |
5219 2001-2102 AADN04000130.1 6004362-6004463 | |
5220 2103-2521 AADN04000130.1 6005189-6005607 | |
5221 FEATURES Location/Qualifiers | |
5222 source 1..2521 | |
5223 /organism="Gallus gallus" | |
5224 /mol_type="mRNA" | |
5225 /db_xref="taxon:9031" | |
5226 /chromosome="14" | |
5227 /map="14" | |
5228 /breed="Red Jungle Fowl" | |
5229 gene 1..2521 | |
5230 /gene="USP7" | |
5231 /gene_synonym="UBP" | |
5232 /note="ubiquitin specific peptidase 7" | |
5233 /db_xref="CGNC:5523" | |
5234 /db_xref="GeneID:395126" | |
5235 CDS 162..2225 | |
5236 /gene="USP7" | |
5237 /gene_synonym="UBP" | |
5238 /EC_number="3.4.19.12" | |
5239 /note="isoform 2 is encoded by transcript variant 2; | |
5240 ubiquitin carboxyl-terminal hydrolase 7; ubiquitin | |
5241 specific protease 7; ubiquitin thioesterase 7; ubiquitin | |
5242 specific peptidase 7 (herpes virus-associated); | |
5243 deubiquitinating enzyme 7; ubiquitin-specific-processing | |
5244 protease 7" | |
5245 /codon_start=1 | |
5246 /product="ubiquitin carboxyl-terminal hydrolase 7 isoform | |
5247 2" | |
5248 /protein_id="NP_001334941.1" | |
5249 /db_xref="CGNC:5523" | |
5250 /db_xref="GeneID:395126" | |
5251 /translation="MNHHQQQQHQKPGEQQLSEPEDMEMEAGDADDPPRITQNPVING | |
5252 NVAMADGHNNTEEDMEDDTSWRSEATFQFTVERFNRLSESVLSPPCFVRNLPWKIMVM | |
5253 PRLYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYKDDEKSFSRRISHLFFH | |
5254 KENDWGFSNFMAWSEVTDPEKGFIEEDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKN | |
5255 QGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGT | |
5256 KKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQC | |
5257 KHVDYRSERIEDYYDIQLSIKGKKNIFESFIDYVAVEQLDGDNKYDAGEHGLQEAEKG | |
5258 VKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYIL | |
5259 HAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVR | |
5260 HCTNAYMLVYIRESKLSEVLQPVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQ | |
5261 VQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSTLTEFVQNLSQTMGFPQDQIRLWP | |
5262 MQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPEMAATGATLPKFDKD | |
5263 RKLMC" | |
5264 misc_feature 318..785 | |
5265 /gene="USP7" | |
5266 /gene_synonym="UBP" | |
5267 /experiment="experimental evidence, no additional details | |
5268 recorded" | |
5269 /note="propagated from UniProtKB/Swiss-Prot (Q6U7I1.1); | |
5270 Region: Interaction with p53/TP53. | |
5271 {ECO:0000250|UniProtKB:Q93009}" | |
5272 misc_feature 369..776 | |
5273 /gene="USP7" | |
5274 /gene_synonym="UBP" | |
5275 /experiment="experimental evidence, no additional details | |
5276 recorded" | |
5277 /note="propagated from UniProtKB/Swiss-Prot (Q6U7I1.1); | |
5278 Region: Necessary for nuclear localization. | |
5279 {ECO:0000250|UniProtKB:Q93009}" | |
5280 ORIGIN | |
5281 1 ccctgcccgc cggagcccag ccgcagcccc ccgaggcggg cgcccaaccc cggcagctgc | |
5282 61 ccgtgccccg ccgctcctcc gccccgtccc ctcccgacgc agccccgcag ccccccacgg | |
5283 121 gaaaggccca ggccgccgcc gagcccgagt cccatcccga catgaaccac catcagcagc | |
5284 181 agcagcacca gaagcccggg gagcagcagc tgagcgagcc cgaggacatg gagatggaag | |
5285 241 ctggagatgc agatgatcct ccaagaatta ctcaaaaccc tgtcattaat gggaatgtag | |
5286 301 caatggctga tggacacaac aacactgaag aagacatgga agatgataca agttggcggt | |
5287 361 cagaggctac ctttcagttc acagtcgaac gcttcaacag attgagtgag tcagttctca | |
5288 421 gccctccctg ctttgtacgg aatttgccat ggaagatcat ggtcatgcca cgactctacc | |
5289 481 cagacagacc tcaccaaaaa agcgtaggat tcttcctcca gtgcaatgca gaatctgatt | |
5290 541 ccacgtcatg gtcttgtcat gcacaagcag ttctcaagat aataaactac aaagatgatg | |
5291 601 aaaaatcatt cagtcgtcgt attagtcact tgttctttca taaggaaaat gactggggct | |
5292 661 tttccaactt tatggcctgg agtgaagtta ctgatcctga aaagggcttt atagaagagg | |
5293 721 acaaggttac ttttgaagtc tatgttcaag cagatgctcc ccatggagtg gcgtgggatt | |
5294 781 caaagaagca cacaggatat gttggcttaa agaaccaggg agcaacttgt tacatgaaca | |
5295 841 gtttgttaca gactttattt ttcacaaatc aactacgaaa ggctgtgtac atgatgccca | |
5296 901 ctgaaggaga tgattcatcc aaaagtgttc ctttagcatt gcaaagagtg ttttatgagc | |
5297 961 tgcaacatag tgacaaacca gttggaacta aaaagctaac aaagtctttt gggtgggaaa | |
5298 1021 ctttagacag cttcatgcaa catgatgtcc aggagttatg tcgagtgctg cttgataacg | |
5299 1081 tggaaaataa aatgaaaggc acatgtgtag aaggcactat tcctaaattg ttcagaggaa | |
5300 1141 agatggtgtc ttatatccaa tgcaaacatg tagactatcg atctgaacga atagaagatt | |
5301 1201 attatgatat ccagctaagt ataaagggaa agaaaaatat ttttgagtcc ttcattgact | |
5302 1261 atgttgcagt ggagcagttg gatggtgata acaagtatga tgcaggagag catggcttgc | |
5303 1321 aggaggcaga gaaaggtgtg aagttcctaa cgttgccacc agtactacat ctgcagctca | |
5304 1381 tgagatttat gtatgatcct cagactgatc aaaacatcaa gataaatgat aggtttgagt | |
5305 1441 ttcctgaaca gttgccacta gatgaatttt tgcaaaaaac agatcctaaa gatccagcaa | |
5306 1501 attacattct tcatgcagtt ctagtacaca gtggagataa ccatggtgga cattatgttg | |
5307 1561 tttacttaaa tccaaagggt gatggaaaat ggtgtaaatt tgatgatgac gttgtatcaa | |
5308 1621 gatgtaccaa ggaagaggcg attgaacaca actatggagg ccacgacgac gacttatctg | |
5309 1681 tacggcactg cactaacgcg tacatgttgg tttacatcag ggaatcgaaa ttaagtgaag | |
5310 1741 tcttgcagcc tgttacggac catgatattc ctcagcaact tgtggaaagg ctacaagaag | |
5311 1801 agaaaagaat agaggctcag aagaggaagg agaggcagga agctcacctc tacatgcaag | |
5312 1861 tgcagatagt agcagaggat cagttctgcg gccaccaagg caatgacatg tatgatgaag | |
5313 1921 aaaaagtgaa atacaccgtt ttcaaagtat taaaaaactc cacgttgaca gaatttgttc | |
5314 1981 aaaacctctc tcaaacaatg ggatttcccc aggatcagat cagattatgg ccaatgcaag | |
5315 2041 ctagaagtaa tggaacaaaa agacctgcaa tgttagataa tgaagcagat ggcaataaaa | |
5316 2101 caatgattga gctcagcgac aatgaaaatc catggacaat atttttggaa acagtagatc | |
5317 2161 cagagatggc tgctactgga gcaacattac ccaagtttga taaagatcgt aagcttatgt | |
5318 2221 gctaaatctt gagtaaatgc aaaattcttt ggacatatct caagaaatgc tgtgcgctcc | |
5319 2281 tgtttttcaa tgctgttgtt gatgtactca tcaagctaca gagctggaat tagtttttct | |
5320 2341 tatacacttt ttgccctcac ttctacttaa gtggaaggca tgtttcaaat gttactggaa | |
5321 2401 taactgaata atttattttc tataaatata tgcagattta cataaaatca gtatttaagg | |
5322 2461 atgttttaag gatattaatc aaatgaataa aggaaggcct tttttttttt tactgcttaa | |
5323 2521 a | |
5324 // | |
5325 | |
5326 LOCUS NM_204182 1454 bp mRNA linear VRT 04-JAN-2017 | |
5327 DEFINITION Gallus gallus creatine kinase, mitochondrial 1A (CKMT1A), mRNA. | |
5328 ACCESSION NM_204182 XM_429227 | |
5329 VERSION NM_204182.2 | |
5330 KEYWORDS RefSeq. | |
5331 SOURCE Gallus gallus (chicken) | |
5332 ORGANISM Gallus gallus | |
5333 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
5334 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
5335 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
5336 Phasianidae; Phasianinae; Gallus. | |
5337 REFERENCE 1 (bases 1 to 1454) | |
5338 AUTHORS Muhlebach SM, Wirz T, Brandle U and Perriard JC. | |
5339 TITLE Evolution of the creative kinases. The chicken acidic type | |
5340 mitochondrial creatine kinase gene as the first nonmammalian gene | |
5341 JOURNAL J. Biol. Chem. 271 (20), 11920-11929 (1996) | |
5342 PUBMED 8662608 | |
5343 REFERENCE 2 (bases 1 to 1454) | |
5344 AUTHORS Hossle JP, Schlegel J, Wegmann G, Wyss M, Bohlen P, Eppenberger HM, | |
5345 Wallimann T and Perriard JC. | |
5346 TITLE Distinct tissue specific mitochondrial creatine kinases from | |
5347 chicken brain and striated muscle with a conserved CK framework | |
5348 JOURNAL Biochem. Biophys. Res. Commun. 151 (1), 408-416 (1988) | |
5349 PUBMED 2831887 | |
5350 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
5351 preliminary review. The reference sequence was derived from | |
5352 CO421284.1, BU295295.1, BU118323.1 and BU339387.1. | |
5353 On Jan 4, 2017 this sequence version replaced gi:45383751. | |
5354 | |
5355 ##RefSeq-Attributes-START## | |
5356 gene product(s) localized to mito. :: inferred from homology | |
5357 ##RefSeq-Attributes-END## | |
5358 COMPLETENESS: complete on the 3' end. | |
5359 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
5360 1-145 CO421284.1 9-153 | |
5361 146-754 BU295295.1 1-609 | |
5362 755-1440 BU118323.1 1-686 | |
5363 1441-1454 BU339387.1 617-630 | |
5364 FEATURES Location/Qualifiers | |
5365 source 1..1454 | |
5366 /organism="Gallus gallus" | |
5367 /mol_type="mRNA" | |
5368 /db_xref="taxon:9031" | |
5369 /chromosome="10" | |
5370 /map="10" | |
5371 gene 1..1454 | |
5372 /gene="CKMT1A" | |
5373 /gene_synonym="CKMT1; CKMT1B; mia-CK; U-MtCK" | |
5374 /note="creatine kinase, mitochondrial 1A" | |
5375 /db_xref="CGNC:48997" | |
5376 /db_xref="GeneID:374002" | |
5377 CDS 61..1314 | |
5378 /gene="CKMT1A" | |
5379 /gene_synonym="CKMT1; CKMT1B; mia-CK; U-MtCK" | |
5380 /EC_number="2.7.3.2" | |
5381 /note="creatine kinase U-type, mitochondrial; creatine | |
5382 kinase, ubiquitous mitochondrial; ubiquitous mitochondrial | |
5383 creatine kinase; acidic-type mitochondrial creatine | |
5384 kinase; creatine kinase, mitochondrial 1B" | |
5385 /codon_start=1 | |
5386 /product="creatine kinase U-type, mitochondrial precursor" | |
5387 /protein_id="NP_989513.2" | |
5388 /db_xref="CGNC:48997" | |
5389 /db_xref="GeneID:374002" | |
5390 /translation="MASTFARALSARRSAGLLAMVGAGSLAAGFLLARDTVSAGERQR | |
5391 RRYPPSAEYPDLRKHNNCMASNLTPAIYARLCDKATPNGWTLDQCIQTGVDNPGHPFI | |
5392 KTVGMVAGDEETYEVFAELFDPVIQERHNGYNPRTMKHVTDLDASKIKFGHFDERYVL | |
5393 SSRVRTGRSIRGLSLPPACTRAERREVEKVTVEALNGLTGDLSGRYYRLSEMTEKEQQ | |
5394 QLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKTFLIWINEEDHTRVISMEKG | |
5395 GNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPL | |
5396 LSKDSRFPKILENLRLQKRGTGGVDTAATGNVFDISNLDRLGKSEVELVQLVIDGVNY | |
5397 LIDCERRLEKGQDIRIPSPVPQFRH" | |
5398 transit_peptide 61..177 | |
5399 /gene="CKMT1A" | |
5400 /gene_synonym="CKMT1; CKMT1B; mia-CK; U-MtCK" | |
5401 /experiment="experimental evidence, no additional details | |
5402 recorded" | |
5403 /note="Mitochondrion. {ECO:0000269|PubMed:2831887}; | |
5404 propagated from UniProtKB/Swiss-Prot (P70079.1)" | |
5405 mat_peptide 178..1311 | |
5406 /gene="CKMT1A" | |
5407 /gene_synonym="CKMT1; CKMT1B; mia-CK; U-MtCK" | |
5408 /product="Creatine kinase U-type, mitochondrial" | |
5409 /experiment="experimental evidence, no additional details | |
5410 recorded" | |
5411 /note="propagated from UniProtKB/Swiss-Prot (P70079.1)" | |
5412 ORIGIN | |
5413 1 ccgttcccat tcccatcacc tcctccgccg gcccccgccg cgctcgctcc ccgctccgcg | |
5414 61 atggccagca ccttcgcccg cgctctctcc gcccgccgct ctgccgggct cctggccatg | |
5415 121 gtgggcgccg gctctctcgc cgccggcttt ctgctcgccc gggacacggt cagcgccggc | |
5416 181 gagcggcagc ggcggcgcta cccgcccagt gctgagtacc ccgacctgcg gaaacacaac | |
5417 241 aactgcatgg ccagcaacct gacgccagcc atctacgcac ggctctgtga caaagccacc | |
5418 301 cccaacggct ggaccttgga ccagtgcatt cagaccggcg tggacaaccc aggccaccct | |
5419 361 ttcatcaaga cagtgggcat ggtggctggt gatgaggaga cgtatgaggt gtttgcagag | |
5420 421 ctgtttgacc ccgtgatcca ggagcggcac aacgggtaca acccccgcac catgaagcac | |
5421 481 gtcacggacc tggacgcctc caagattaag tttggccact tcgatgagcg ctacgtgctc | |
5422 541 tcatcccggg tccggaccgg gcgcagcatc cgtgggctga gccttccacc cgcctgcacc | |
5423 601 cgtgccgagc ggcgggaggt ggagaaggtg acggtggagg ctctgaatgg cctcacaggg | |
5424 661 gatctgtcgg gccgctacta ccgtctcagc gagatgacag agaaggagca gcagcagctc | |
5425 721 attgatgacc acttcctctt tgacaagccg gtgtcccctc tcctgacggc agcaggaatg | |
5426 781 gcccgggact ggcccgacgc ccgaggcatc tggcacaaca atgagaagac cttcctgatc | |
5427 841 tggatcaacg aggaggacca cacgcgcgtc atctccatgg agaagggtgg taacatgaag | |
5428 901 cgcgtctttg agcggttctg ccggggcctg aaggaggtgg agcgactaat ccaggagcga | |
5429 961 ggctgggagt tcatgtggaa tgagaggctg ggctacatcc tgacctgccc ctccaacctg | |
5430 1021 ggcaccgggc tgcgggcagg tgtccacatc aagctgccac tgctcagcaa ggacagccgc | |
5431 1081 ttccccaaga tcctggagaa cctgcggcta cagaagcgtg ggacaggcgg tgtggacaca | |
5432 1141 gcagccaccg gcaatgtctt cgacatctcc aacctggacc ggctggggaa gtcagaggtg | |
5433 1201 gaactggtgc agctggtgat agacggtgtg aactacctga tcgactgcga gcggcggctg | |
5434 1261 gagaagggtc aggacattcg catcccctcc ccagtaccac agttccggca ctgagccacg | |
5435 1321 ccgaggcagc gccagccctg caggacccag cttcccccat agcttatgcc atcaatgcgc | |
5436 1381 ccagcatgtc gctgtgctgt tacacacaga gccaggccag accccataaa catgtgctgc | |
5437 1441 tgtagcctta aaaa | |
5438 // | |
5439 | |
5440 LOCUS NM_204788 1295 bp mRNA linear VRT 04-JAN-2017 | |
5441 DEFINITION Gallus gallus aminomethyltransferase (AMT), mRNA. | |
5442 ACCESSION NM_204788 NM_001347941 | |
5443 VERSION NM_204788.2 | |
5444 KEYWORDS RefSeq. | |
5445 SOURCE Gallus gallus (chicken) | |
5446 ORGANISM Gallus gallus | |
5447 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
5448 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
5449 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
5450 Phasianidae; Phasianinae; Gallus. | |
5451 REFERENCE 1 (bases 1 to 1295) | |
5452 AUTHORS Han JY, Park TS, Kim JN, Kim MA, Lim D, Lim JM and Kim H. | |
5453 TITLE Gene expression profiling of chicken primordial germ cell ESTs | |
5454 JOURNAL BMC Genomics 7, 220 (2006) | |
5455 PUBMED 16939661 | |
5456 REMARK Publication Status: Online-Only | |
5457 REFERENCE 2 (bases 1 to 1295) | |
5458 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
5459 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
5460 TITLE A comprehensive collection of chicken cDNAs | |
5461 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
5462 PUBMED 12445392 | |
5463 REFERENCE 3 (bases 1 to 1295) | |
5464 AUTHORS Abdrakhmanov I, Lodygin D, Geroth P, Arakawa H, Law A, Plachy J, | |
5465 Korn B and Buerstedde JM. | |
5466 TITLE A large database of chicken bursal ESTs as a resource for the | |
5467 analysis of vertebrate gene function | |
5468 JOURNAL Genome Res. 10 (12), 2062-2069 (2000) | |
5469 PUBMED 11116100 | |
5470 REFERENCE 4 (bases 1 to 1295) | |
5471 AUTHORS Okamura-Ikeda K, Fujiwara K and Motokawa Y. | |
5472 TITLE Molecular cloning of a cDNA encoding chicken T-protein of the | |
5473 glycine cleavage system and expression of the functional protein in | |
5474 Escherichia coli. Effect of mRNA secondary structure in the | |
5475 translational initiation region on expression | |
5476 JOURNAL J. Biol. Chem. 267 (26), 18284-18290 (1992) | |
5477 PUBMED 1526969 | |
5478 REFERENCE 5 (bases 1 to 1295) | |
5479 AUTHORS Okamura-Ikeda K, Fujiwara K, Yamamoto M, Hiraga K and Motokawa Y. | |
5480 TITLE Isolation and sequence determination of cDNA encoding T-protein of | |
5481 the glycine cleavage system | |
5482 JOURNAL J. Biol. Chem. 266 (8), 4917-4921 (1991) | |
5483 PUBMED 2002038 | |
5484 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
5485 preliminary review. The reference sequence was derived from | |
5486 BG711851.1, AJ393058.1, DR418126.1, BU129545.1, AJ441868.1 and | |
5487 CR385258.1. | |
5488 On or before Jan 4, 2017 this sequence version replaced | |
5489 gi:1126305163, gi:45382156. | |
5490 | |
5491 ##RefSeq-Attributes-START## | |
5492 gene product(s) localized to mito. :: inferred from homology | |
5493 ##RefSeq-Attributes-END## | |
5494 COMPLETENESS: complete on the 3' end. | |
5495 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
5496 1-46 BG711851.1 1-46 | |
5497 47-57 AJ393058.1 1-11 | |
5498 58-78 DR418126.1 83-103 | |
5499 79-126 BU129545.1 27-74 | |
5500 127-324 AJ441868.1 47-244 | |
5501 325-1295 CR385258.1 1-971 | |
5502 FEATURES Location/Qualifiers | |
5503 source 1..1295 | |
5504 /organism="Gallus gallus" | |
5505 /mol_type="mRNA" | |
5506 /db_xref="taxon:9031" | |
5507 /chromosome="12" | |
5508 /map="12" | |
5509 gene 1..1295 | |
5510 /gene="AMT" | |
5511 /gene_synonym="GCVT" | |
5512 /note="aminomethyltransferase" | |
5513 /db_xref="CGNC:49377" | |
5514 /db_xref="GeneID:395566" | |
5515 CDS 86..1264 | |
5516 /gene="AMT" | |
5517 /gene_synonym="GCVT" | |
5518 /EC_number="2.1.2.10" | |
5519 /note="T-protein; aminomethyltransferase, mitochondrial; | |
5520 glycine cleavage system T protein" | |
5521 /codon_start=1 | |
5522 /product="aminomethyltransferase, mitochondrial precursor" | |
5523 /protein_id="NP_990119.2" | |
5524 /db_xref="CGNC:49377" | |
5525 /db_xref="GeneID:395566" | |
5526 /translation="MLRAGCRAALARRHLSSAPEGLKQTPLDALHRARGGRMVPFAGW | |
5527 SLPVQYGRGHLESHLHTRRHCSLFDVSHMLQTRVYGRDRVRFLESLVVGDIAELRPGQ | |
5528 GTLTLLTNERGGIVDDLIVTNTAEDHLYVVSNAGCADKDRAVMEGRAAELRAAGGDVH | |
5529 LEVSDNALLALQGPSMAQVLQAGLPDDLTKLTFMTSTATTVFGVPGCRVTRCGYTGED | |
5530 GVEISVPAGRAVELAERLLGCPEVWPAGLAARDSLRLEAGLCLYGNDIDESTTPVEAG | |
5531 LLWTLGKRRRTAMDFPGAAIIMEQVKEKPKRKRVGLTSVGPPLRPPAAILGPEGTPVG | |
5532 TVTSGCPSPSLGKNIAMGYVQAAHSRPGTTLTVEVRKKQHPALVTKMPFVPTHYYMAK | |
5533 " | |
5534 ORIGIN | |
5535 1 gcggcatgtc ccaggcgccc cggcggggcg ggccgagccg tgccgagccg tgccgagccg | |
5536 61 cgctgagccg ggccggggcc ggaggatgct gcgggcgggg tgccgcgccg cgttggcccg | |
5537 121 acgccacctg agctcggcgc cggaggggct gaagcagacg ccgctggacg cgctgcaccg | |
5538 181 ggcccgcggc gggaggatgg tgccgttcgc cggctggagc ctgcccgtgc agtacggccg | |
5539 241 cgggcacctc gagtcgcacc tgcacacccg gcggcactgc tcgctgttcg acgtgtccca | |
5540 301 catgctgcag acgcgggtgt acgggaggga ccgcgtccgc ttcctggaga gcctggtggt | |
5541 361 gggggacatc gccgagctgc gcccgggaca gggcaccctg acgctgctca ccaacgagcg | |
5542 421 cggcggcatc gtggatgacc tcatcgtcac caacacggcc gaggaccacc tctacgtggt | |
5543 481 gtccaacgcg ggctgcgccg acaaggaccg agccgtcatg gagggcagag cagcagaact | |
5544 541 gagggcggcc ggtggcgacg tgcacctgga ggtgtcggac aacgcgctgc tggcgctgca | |
5545 601 agggccctcc atggcacagg tgctgcaggc cgggctgccg gatgacctga ccaagctgac | |
5546 661 cttcatgacc agcacagcca ccaccgtctt tggcgtgccg ggctgccgtg tgacacgctg | |
5547 721 cggctacacc ggcgaggacg gtgtggagat ctcagtgcct gcagggcgag cagtggagct | |
5548 781 ggctgagcgg ctgctgggct gccccgaggt gtggccggca gggctggcag cccgggacag | |
5549 841 cctgcgcctg gaggccgggc tctgcctcta cggcaacgac atcgatgaga gcaccacgcc | |
5550 901 agtggaggct gggctgctgt ggaccctggg gaagcgccgg cgcacagcca tggacttccc | |
5551 961 cggtgcagcc atcatcatgg agcaggtgaa ggagaagcca aagcggaagc gtgtggggct | |
5552 1021 gacatcggtg gggccccccc tccggccgcc tgccgccatc ctgggccccg agggcacacc | |
5553 1081 cgtgggcacg gtgaccagcg gctgcccctc gccctccctg ggcaagaaca tcgccatggg | |
5554 1141 ctacgtgcag gctgcgcaca gccgccccgg caccacgctc accgttgagg tgaggaagaa | |
5555 1201 gcagcacccg gcgctggtca ccaagatgcc cttcgtgccc acacattatt acatggccaa | |
5556 1261 gtgagacccg gccccattaa agcccctcgc tcatc | |
5557 // | |
5558 | |
5559 LOCUS NM_001347945 1440 bp mRNA linear VRT 04-JAN-2017 | |
5560 DEFINITION Gallus gallus dynactin subunit 2 (DCTN2), mRNA. | |
5561 ACCESSION NM_001347945 | |
5562 VERSION NM_001347945.1 | |
5563 KEYWORDS RefSeq. | |
5564 SOURCE Gallus gallus (chicken) | |
5565 ORGANISM Gallus gallus | |
5566 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
5567 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
5568 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
5569 Phasianidae; Phasianinae; Gallus. | |
5570 REFERENCE 1 (bases 1 to 1440) | |
5571 AUTHORS Froman DP, Kirby JD and Rhoads DD. | |
5572 TITLE An expressed sequence tag analysis of the chicken reproductive | |
5573 tract transcriptome | |
5574 JOURNAL Poult. Sci. 85 (8), 1438-1441 (2006) | |
5575 PUBMED 16903475 | |
5576 REFERENCE 2 (bases 1 to 1440) | |
5577 AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R, | |
5578 Burnside J, Aggrey SE, Simon J and Cogburn LA. | |
5579 TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs | |
5580 from single and multiple tissue cDNA libraries and CAP3 assembly of | |
5581 a chicken gene index | |
5582 JOURNAL Physiol. Genomics 25 (3), 514-524 (2006) | |
5583 PUBMED 16554550 | |
5584 REFERENCE 3 (bases 1 to 1440) | |
5585 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
5586 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
5587 TITLE A comprehensive collection of chicken cDNAs | |
5588 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
5589 PUBMED 12445392 | |
5590 REFERENCE 4 (bases 1 to 1440) | |
5591 AUTHORS Valetti C, Wetzel DM, Schrader M, Hasbani MJ, Gill SR, Kreis TE and | |
5592 Schroer TA. | |
5593 TITLE Role of dynactin in endocytic traffic: effects of dynamitin | |
5594 overexpression and colocalization with CLIP-170 | |
5595 JOURNAL Mol. Biol. Cell 10 (12), 4107-4120 (1999) | |
5596 PUBMED 10588646 | |
5597 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
5598 preliminary review. The reference sequence was derived from | |
5599 DT659451.1, CD215977.1, BU131902.1 and DR427218.1. | |
5600 | |
5601 ##RefSeq-Attributes-START## | |
5602 inferred exon combination :: based on alignments, homology | |
5603 ##RefSeq-Attributes-END## | |
5604 COMPLETENESS: complete on the 3' end. | |
5605 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
5606 1-21 DT659451.1 1-21 | |
5607 22-486 CD215977.1 1-465 | |
5608 487-1216 BU131902.1 1-730 | |
5609 1217-1440 DR427218.1 1-224 c | |
5610 FEATURES Location/Qualifiers | |
5611 source 1..1440 | |
5612 /organism="Gallus gallus" | |
5613 /mol_type="mRNA" | |
5614 /db_xref="taxon:9031" | |
5615 /breed="Leghorn" | |
5616 gene 1..1440 | |
5617 /gene="DCTN2" | |
5618 /gene_synonym="P50" | |
5619 /note="dynactin subunit 2" | |
5620 /db_xref="CGNC:49387" | |
5621 /db_xref="GeneID:395587" | |
5622 CDS 34..1248 | |
5623 /gene="DCTN2" | |
5624 /gene_synonym="P50" | |
5625 /note="dynamitin; p50 dynamitin; dynactin 2 (p50)" | |
5626 /codon_start=1 | |
5627 /product="dynactin subunit 2" | |
5628 /protein_id="NP_001334874.1" | |
5629 /db_xref="CGNC:49387" | |
5630 /db_xref="GeneID:395587" | |
5631 /translation="MADPKYADLPGIARNEPDVYETSDLPEDDQAEFEAELEELTSTS | |
5632 VEHLIINPNAAFEKFKDKRLGTDGVDFSDRISKSRTTGYESGEYEILGEGLGAKETPQ | |
5633 QRYQRLQHEVQELIRDVEQIQSAVKESAAEEELTPMALARQLEGLKQQLVSCHLQKLL | |
5634 GPTAAIDFADPEGALAKRLQQQLEVAKCKKAAPAKSPPKAPAPTTDALTFELFWRPEQ | |
5635 DQFSQTAKIAELEKRLAQLEAMVRCEPDSQNPLLVGLKGTSLVETVQILQAKVNILDA | |
5636 AVLDQVEARLQSVLGKVNEIAKHKAIVQDADTQSKIHQVYEMMQRWDHMASSLPDVVQ | |
5637 RLLTLRDLHEQASRFVQVLVHLDTTQQEVAAALKDNTVLLAEVQKTMKENLAVVEDNF | |
5638 AEVEARIKRLQK" | |
5639 ORIGIN | |
5640 1 ccccgcccgg ccctgacggc ccccgccgca gccatggccg accccaaata cgcggacctg | |
5641 61 cccggcatcg cccggaatga gcccgacgtg tacgagacca gcgacctccc cgaggatgac | |
5642 121 caggccgagt tcgaggcgga gctggaggag ctcaccagca ccagcgtgga gcacctcatc | |
5643 181 atcaacccca acgccgcctt cgagaagttc aaggacaaac gcctgggcac cgatggcgtg | |
5644 241 gatttctccg accgcatcag caagagcaga accactggct atgagtctgg ggagtatgaa | |
5645 301 attctgggag aggggttggg tgccaaggag accccccagc agcggtacca gcggctgcag | |
5646 361 cacgaggtgc aggagctgat ccgtgatgtg gagcagatcc agagcgccgt gaaggagtcg | |
5647 421 gcggccgagg aagagctgac gcccatggct ttggcccggc agctggaggg gctgaagcag | |
5648 481 cagttggttt cgtgccatct gcagaagctg ttgggcccca ctgccgccat cgacttcgcg | |
5649 541 gaccctgagg gtgccttggc gaagcgcctg cagcagcagc tggaagtagc caagtgcaag | |
5650 601 aaggcagcgc cagcaaagag cccccccaaa gcccctgcgc ccaccactga cgcgctcacc | |
5651 661 ttcgaactgt tctggaggcc agagcaggac cagttctccc agactgccaa gatagcagag | |
5652 721 ctggagaagc gcctggcaca gctggaggcc atggtgcgct gtgagcctga cagccagaat | |
5653 781 cctctgctag ttgggctgaa gggcaccagc ctcgtggaga ccgtgcagat cctgcaggcc | |
5654 841 aaggttaaca tcctggacgc agctgtgctg gaccaagtgg aggcccggct gcagagcgtc | |
5655 901 ctggggaagg tgaatgagat tgccaagcac aaagcgattg tgcaggatgc cgacacgcag | |
5656 961 agcaagatcc atcaggtcta cgagatgatg cagcgctggg accacatggc cagcagtctg | |
5657 1021 cccgacgtgg tgcagcggct gctgacgctc cgggacctac atgagcaggc ctcacgattt | |
5658 1081 gtgcaggtgc tggtgcacct ggacaccaca cagcaggagg tggctgctgc tctgaaggat | |
5659 1141 aacactgtgc tgctggcaga ggtccagaag acaatgaagg agaacctggc tgttgtagag | |
5660 1201 gacaactttg ctgaagtaga ggcccgcatc aagcggctgc agaagtgaga gcagctctgc | |
5661 1261 gcccatctct gagggcccgc gttgttcagc cccctcgcct gatgccccct ggaatccccc | |
5662 1321 caaccccgca ggaaccagcc cctgctcctg tgtacctggc tgtgttcccc tctgctcccc | |
5663 1381 ccccctccat tccccccagg gccgtgtgac tgcctctcac acccagatga tccaaataaa | |
5664 // | |
5665 | |
5666 LOCUS NM_204471 4742 bp mRNA linear VRT 04-JAN-2017 | |
5667 DEFINITION Gallus gallus ubiquitin specific peptidase 7 (USP7), transcript | |
5668 variant 1, mRNA. | |
5669 ACCESSION NM_204471 | |
5670 VERSION NM_204471.2 | |
5671 KEYWORDS RefSeq. | |
5672 SOURCE Gallus gallus (chicken) | |
5673 ORGANISM Gallus gallus | |
5674 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
5675 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
5676 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
5677 Phasianidae; Phasianinae; Gallus. | |
5678 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
5679 preliminary review. The reference sequence was derived from | |
5680 AADN04000130.1. | |
5681 On Dec 29, 2016 this sequence version replaced gi:45383222. | |
5682 | |
5683 Transcript Variant: This variant (1) represents the longer | |
5684 transcript and encodes the longer isoform (1). | |
5685 | |
5686 Sequence Note: This RefSeq record was created from transcript and | |
5687 genomic sequence data to make the sequence consistent with the | |
5688 reference genome assembly. The genomic coordinates used for the | |
5689 transcript record were based on transcript alignments. | |
5690 COMPLETENESS: complete on the 3' end. | |
5691 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
5692 1-240 AADN04000130.1 5955168-5955407 | |
5693 241-345 AADN04000130.1 5978477-5978581 | |
5694 346-544 AADN04000130.1 5983587-5983785 | |
5695 545-683 AADN04000130.1 5985141-5985279 | |
5696 684-772 AADN04000130.1 5988319-5988407 | |
5697 773-881 AADN04000130.1 5989123-5989231 | |
5698 882-1012 AADN04000130.1 5994344-5994474 | |
5699 1013-1067 AADN04000130.1 5997303-5997357 | |
5700 1068-1148 AADN04000130.1 5998393-5998473 | |
5701 1149-1239 AADN04000130.1 5998561-5998651 | |
5702 1240-1322 AADN04000130.1 5999425-5999507 | |
5703 1323-1432 AADN04000130.1 6000453-6000562 | |
5704 1433-1589 AADN04000130.1 6000975-6001131 | |
5705 1590-1734 AADN04000130.1 6002153-6002297 | |
5706 1735-1865 AADN04000130.1 6002875-6003005 | |
5707 1866-2000 AADN04000130.1 6004074-6004208 | |
5708 2001-2102 AADN04000130.1 6004362-6004463 | |
5709 2103-2208 AADN04000130.1 6005189-6005294 | |
5710 2209-2301 AADN04000130.1 6005686-6005778 | |
5711 2302-2369 AADN04000130.1 6006631-6006698 | |
5712 2370-2470 AADN04000130.1 6007274-6007374 | |
5713 2471-2624 AADN04000130.1 6008728-6008881 | |
5714 2625-2692 AADN04000130.1 6010185-6010252 | |
5715 2693-2801 AADN04000130.1 6011375-6011483 | |
5716 2802-2879 AADN04000130.1 6011582-6011659 | |
5717 2880-2980 AADN04000130.1 6011958-6012058 | |
5718 2981-3080 AADN04000130.1 6012505-6012604 | |
5719 3081-3200 AADN04000130.1 6013395-6013514 | |
5720 3201-3272 AADN04000130.1 6014776-6014847 | |
5721 3273-3363 AADN04000130.1 6015728-6015818 | |
5722 3364-4742 AADN04000130.1 6018426-6019804 | |
5723 FEATURES Location/Qualifiers | |
5724 source 1..4742 | |
5725 /organism="Gallus gallus" | |
5726 /mol_type="mRNA" | |
5727 /db_xref="taxon:9031" | |
5728 /chromosome="14" | |
5729 /map="14" | |
5730 /breed="Red Jungle Fowl" | |
5731 gene 1..4742 | |
5732 /gene="USP7" | |
5733 /gene_synonym="UBP" | |
5734 /note="ubiquitin specific peptidase 7" | |
5735 /db_xref="CGNC:5523" | |
5736 /db_xref="GeneID:395126" | |
5737 CDS 162..3470 | |
5738 /gene="USP7" | |
5739 /gene_synonym="UBP" | |
5740 /EC_number="3.4.19.12" | |
5741 /note="isoform 1 is encoded by transcript variant 1; | |
5742 ubiquitin carboxyl-terminal hydrolase 7; ubiquitin | |
5743 specific protease 7; ubiquitin thioesterase 7; ubiquitin | |
5744 specific peptidase 7 (herpes virus-associated); | |
5745 deubiquitinating enzyme 7; ubiquitin-specific-processing | |
5746 protease 7" | |
5747 /codon_start=1 | |
5748 /product="ubiquitin carboxyl-terminal hydrolase 7 isoform | |
5749 1" | |
5750 /protein_id="NP_989802.2" | |
5751 /db_xref="CGNC:5523" | |
5752 /db_xref="GeneID:395126" | |
5753 /translation="MNHHQQQQHQKPGEQQLSEPEDMEMEAGDADDPPRITQNPVING | |
5754 NVAMADGHNNTEEDMEDDTSWRSEATFQFTVERFNRLSESVLSPPCFVRNLPWKIMVM | |
5755 PRLYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYKDDEKSFSRRISHLFFH | |
5756 KENDWGFSNFMAWSEVTDPEKGFIEEDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKN | |
5757 QGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGT | |
5758 KKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQC | |
5759 KHVDYRSERIEDYYDIQLSIKGKKNIFESFIDYVAVEQLDGDNKYDAGEHGLQEAEKG | |
5760 VKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYIL | |
5761 HAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVR | |
5762 HCTNAYMLVYIRESKLSEVLQPVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQ | |
5763 VQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSTLTEFVQNLSQTMGFPQDQIRLWP | |
5764 MQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPEMAATGATLPKFDKD | |
5765 HDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCERAGFPQETNLILYEEVKP | |
5766 NLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIF | |
5767 CDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHN | |
5768 YEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLNSQFREEEITVYPDK | |
5769 HGCVRDLLEECKKVVELSEKGSGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRI | |
5770 EEIPLDQVDIDKENEMLITVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQTMLDI | |
5771 QEKEFEKFKFAIVMMGRHQYLNEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKR | |
5772 SRYTYLEKAIKIHN" | |
5773 misc_feature 318..785 | |
5774 /gene="USP7" | |
5775 /gene_synonym="UBP" | |
5776 /experiment="experimental evidence, no additional details | |
5777 recorded" | |
5778 /note="propagated from UniProtKB/Swiss-Prot (Q6U7I1.1); | |
5779 Region: Interaction with p53/TP53. | |
5780 {ECO:0000250|UniProtKB:Q93009}" | |
5781 misc_feature 369..776 | |
5782 /gene="USP7" | |
5783 /gene_synonym="UBP" | |
5784 /experiment="experimental evidence, no additional details | |
5785 recorded" | |
5786 /note="propagated from UniProtKB/Swiss-Prot (Q6U7I1.1); | |
5787 Region: Necessary for nuclear localization. | |
5788 {ECO:0000250|UniProtKB:Q93009}" | |
5789 ORIGIN | |
5790 1 ccctgcccgc cggagcccag ccgcagcccc ccgaggcggg cgcccaaccc cggcagctgc | |
5791 61 ccgtgccccg ccgctcctcc gccccgtccc ctcccgacgc agccccgcag ccccccacgg | |
5792 121 gaaaggccca ggccgccgcc gagcccgagt cccatcccga catgaaccac catcagcagc | |
5793 181 agcagcacca gaagcccggg gagcagcagc tgagcgagcc cgaggacatg gagatggaag | |
5794 241 ctggagatgc agatgatcct ccaagaatta ctcaaaaccc tgtcattaat gggaatgtag | |
5795 301 caatggctga tggacacaac aacactgaag aagacatgga agatgataca agttggcggt | |
5796 361 cagaggctac ctttcagttc acagtcgaac gcttcaacag attgagtgag tcagttctca | |
5797 421 gccctccctg ctttgtacgg aatttgccat ggaagatcat ggtcatgcca cgactctacc | |
5798 481 cagacagacc tcaccaaaaa agcgtaggat tcttcctcca gtgcaatgca gaatctgatt | |
5799 541 ccacgtcatg gtcttgtcat gcacaagcag ttctcaagat aataaactac aaagatgatg | |
5800 601 aaaaatcatt cagtcgtcgt attagtcact tgttctttca taaggaaaat gactggggct | |
5801 661 tttccaactt tatggcctgg agtgaagtta ctgatcctga aaagggcttt atagaagagg | |
5802 721 acaaggttac ttttgaagtc tatgttcaag cagatgctcc ccatggagtg gcgtgggatt | |
5803 781 caaagaagca cacaggatat gttggcttaa agaaccaggg agcaacttgt tacatgaaca | |
5804 841 gtttgttaca gactttattt ttcacaaatc aactacgaaa ggctgtgtac atgatgccca | |
5805 901 ctgaaggaga tgattcatcc aaaagtgttc ctttagcatt gcaaagagtg ttttatgagc | |
5806 961 tgcaacatag tgacaaacca gttggaacta aaaagctaac aaagtctttt gggtgggaaa | |
5807 1021 ctttagacag cttcatgcaa catgatgtcc aggagttatg tcgagtgctg cttgataacg | |
5808 1081 tggaaaataa aatgaaaggc acatgtgtag aaggcactat tcctaaattg ttcagaggaa | |
5809 1141 agatggtgtc ttatatccaa tgcaaacatg tagactatcg atctgaacga atagaagatt | |
5810 1201 attatgatat ccagctaagt ataaagggaa agaaaaatat ttttgagtcc ttcattgact | |
5811 1261 atgttgcagt ggagcagttg gatggtgata acaagtatga tgcaggagag catggcttgc | |
5812 1321 aggaggcaga gaaaggtgtg aagttcctaa cgttgccacc agtactacat ctgcagctca | |
5813 1381 tgagatttat gtatgatcct cagactgatc aaaacatcaa gataaatgat aggtttgagt | |
5814 1441 ttcctgaaca gttgccacta gatgaatttt tgcaaaaaac agatcctaaa gatccagcaa | |
5815 1501 attacattct tcatgcagtt ctagtacaca gtggagataa ccatggtgga cattatgttg | |
5816 1561 tttacttaaa tccaaagggt gatggaaaat ggtgtaaatt tgatgatgac gttgtatcaa | |
5817 1621 gatgtaccaa ggaagaggcg attgaacaca actatggagg ccacgacgac gacttatctg | |
5818 1681 tacggcactg cactaacgcg tacatgttgg tttacatcag ggaatcgaaa ttaagtgaag | |
5819 1741 tcttgcagcc tgttacggac catgatattc ctcagcaact tgtggaaagg ctacaagaag | |
5820 1801 agaaaagaat agaggctcag aagaggaagg agaggcagga agctcacctc tacatgcaag | |
5821 1861 tgcagatagt agcagaggat cagttctgcg gccaccaagg caatgacatg tatgatgaag | |
5822 1921 aaaaagtgaa atacaccgtt ttcaaagtat taaaaaactc cacgttgaca gaatttgttc | |
5823 1981 aaaacctctc tcaaacaatg ggatttcccc aggatcagat cagattatgg ccaatgcaag | |
5824 2041 ctagaagtaa tggaacaaaa agacctgcaa tgttagataa tgaagcagat ggcaataaaa | |
5825 2101 caatgattga gctcagcgac aatgaaaatc catggacaat atttttggaa acagtagatc | |
5826 2161 cagagatggc tgctactgga gcaacattac ccaagtttga taaagatcat gatgtaatgt | |
5827 2221 tgtttctgaa gatgtatgat ccgaaaactc ggagtttgaa ttattgtgga catatctaca | |
5828 2281 cacctatatc ctgtaaaata cgtgacttgc ttccagttat gtgtgagaga gcaggatttc | |
5829 2341 cacaagaaac taaccttatc ctctatgagg aagttaaacc caatttaaca gaaaggattc | |
5830 2401 aagactatga tgtgtctctt gataaagctc ttgatgaact catggatggt gacatcatag | |
5831 2461 tgtttcagaa ggatgaccca gaaaacgata acagtgagct gccaacagct aaggaatact | |
5832 2521 tcagagacct ctatcatcgt gtggatgtca ttttctgtga taaaaccatc cccaacgacc | |
5833 2581 ctggttttgt tgttactttg tccaatagga tgaattactt tcaggttgca aagacagttg | |
5834 2641 cacaaagact taatacagat ccaatgctat tacagttttt caagtctcaa ggttataggg | |
5835 2701 acggccctgg taatcccctt aggcacaatt atgaaggtac tttaagagat cttctgcagt | |
5836 2761 tcttcaagcc taggcaacct aaaaagcttt actatcaaca gctcaaaatg aaaataactg | |
5837 2821 attttgaaaa cagaagaagt tttaaatgca tatggctaaa tagccaattt agggaagagg | |
5838 2881 aaataacagt atatccagat aagcatgggt gtgtgcggga cctcttagaa gaatgtaaaa | |
5839 2941 aagttgtaga gctctctgaa aaaggttcag ggaaattaag gctgctagaa attgtaagtt | |
5840 3001 acaaaataat tggcgtccat caggaagatg agctgttaga gtgtttgtca cccgcaacaa | |
5841 3061 gtcgaacgtt tcgaatagag gaaattcctc tggaccaggt agatatagat aaagaaaatg | |
5842 3121 agatgctaat cacagtggca catttccaca aggaggtttt tgggacattt ggaattccgt | |
5843 3181 tcttgctgag gatacaccag ggcgaacact tcagagaggt tatgaagcgg attcagacaa | |
5844 3241 tgctggacat acaggaaaaa gaatttgaaa agtttaaatt tgcaattgta atgatgggcc | |
5845 3301 gacaccaata tctcaatgaa gatgagtatg aagtgaactt gaaagatttt gagccccaac | |
5846 3361 caggcaacat gtctcatcca aggccgtggc tagggcttga ccatttcaat aaagccccaa | |
5847 3421 agagaagtcg ctacacttac cttgaaaaag ctattaaaat ccataactga cttaataaac | |
5848 3481 cagattgtcg aggcaaggga caaaataagt gtgtgtgtgc acctttttaa caactgtaga | |
5849 3541 actttggtac acgtgcacta tatctgaagt cttcagcaag aggatttgct gctgatgtta | |
5850 3601 attttatttt gttgaggctg ttcagtttgg cttctctgta tctattgact gccctttttg | |
5851 3661 agcaaaatga aggtgttttt ataaagcttg gatgccaatg agagttattt tatggtaaac | |
5852 3721 gtaatgcaag gcaattgtca gcataatgag ggaagagttt agtagaacaa ttgacattgg | |
5853 3781 caaaatattt gtctgtagta cgtttataga tggcataagc tggctggctg cctttcctgg | |
5854 3841 tatggtgttc accatcactg cagctagtaa gtcttatgtt tagactcaca tcagatttat | |
5855 3901 ttccttcagt tatactttaa atgacatttt tgtgcatttg taaatgcaaa aaactcacat | |
5856 3961 catcaataaa tagcaatctc tacttcattg tgtacattgt tggcacttat ttgggatttt | |
5857 4021 tgtctcctcc agctgcatag aatctttttt aataaactag ttttcattta atttagtcac | |
5858 4081 tacttcgcat cccgttttgc caagcggatg ccctgactcc tataatgaga tatttgggtc | |
5859 4141 tttttatgaa aatttcaacc attgttgaat acagttgcaa tttattatgc catcttctgg | |
5860 4201 cagatagaat gacactcaga gttggcaaaa gcaagtgaaa ggattataaa tatcattaat | |
5861 4261 ttagttaacg tgggaagaga cggggaaaac acgagaaata gccttttagc acagaggggc | |
5862 4321 atgctcacta gtgtttagta agctgttgac tttgtataaa aaaggaggaa aaaaaaagaa | |
5863 4381 aaaaaagaag aaatgaaatt gtatatttaa tgaatgaaca tgtacaattt aacacttgga | |
5864 4441 ggataatttt gttgggtgag tctgcaagtg aatttcactg atgttgatat tcattgtgtg | |
5865 4501 tagttttctt tcagtcccca gactgcttcc ttttattttg gagctaatgc cagccgcgtg | |
5866 4561 tctagttttg agtgcagtaa agatagaatc agcaattcac acttaacttt acattctttt | |
5867 4621 ccagtatttt attttgtttc tgtagctgca gtgtacaaca actcttcctg tatattgcct | |
5868 4681 ttttttgctg gaaaatgttg tatgttgaat aaaattttct ataaaatttt ccttcggtga | |
5869 4741 gt | |
5870 // | |
5871 | |
5872 LOCUS NM_001006211 3002 bp mRNA linear VRT 04-JAN-2017 | |
5873 DEFINITION Gallus gallus SBDS ribosome assembly guanine nucleotide exchange | |
5874 factor (SBDS), mRNA. | |
5875 ACCESSION NM_001006211 XM_415725 | |
5876 VERSION NM_001006211.2 | |
5877 KEYWORDS RefSeq. | |
5878 SOURCE Gallus gallus (chicken) | |
5879 ORGANISM Gallus gallus | |
5880 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
5881 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
5882 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
5883 Phasianidae; Phasianinae; Gallus. | |
5884 REFERENCE 1 (bases 1 to 3002) | |
5885 AUTHORS Wu G, Liu L, Qi Y, Sun Y, Yang N, Xu G, Zhou H and Li X. | |
5886 TITLE Splenic gene expression profiling in White Leghorn layer inoculated | |
5887 with the Salmonella enterica serovar Enteritidis | |
5888 JOURNAL Anim. Genet. 46 (6), 617-626 (2015) | |
5889 PUBMED 26358731 | |
5890 REFERENCE 2 (bases 1 to 3002) | |
5891 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
5892 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
5893 P, Hayashizaki Y and Buerstedde JM. | |
5894 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
5895 gene function analysis | |
5896 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
5897 PUBMED 15642098 | |
5898 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
5899 preliminary review. The reference sequence was derived from | |
5900 AADN04000064.1. | |
5901 On Dec 21, 2016 this sequence version replaced gi:57525275. | |
5902 | |
5903 Sequence Note: The RefSeq transcript and protein were derived from | |
5904 genomic sequence to make the sequence consistent with the reference | |
5905 genome assembly. The genomic coordinates used for the transcript | |
5906 record were based on alignments. | |
5907 | |
5908 ##Evidence-Data-START## | |
5909 Transcript exon combination :: AJ720650.1, HAEL01010610.1 | |
5910 [ECO:0000332] | |
5911 RNAseq introns :: single sample supports all introns | |
5912 SAMEA2201360, SAMEA2201368 | |
5913 [ECO:0000348] | |
5914 ##Evidence-Data-END## | |
5915 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
5916 1-167 AADN04000064.1 41929-42095 c | |
5917 168-297 AADN04000064.1 41185-41314 c | |
5918 298-498 AADN04000064.1 40398-40598 c | |
5919 499-663 AADN04000064.1 39997-40161 c | |
5920 664-3002 AADN04000064.1 37075-39413 c | |
5921 FEATURES Location/Qualifiers | |
5922 source 1..3002 | |
5923 /organism="Gallus gallus" | |
5924 /mol_type="mRNA" | |
5925 /db_xref="taxon:9031" | |
5926 /chromosome="19" | |
5927 /map="19" | |
5928 /breed="Red Jungle Fowl" | |
5929 gene 1..3002 | |
5930 /gene="SBDS" | |
5931 /note="SBDS ribosome assembly guanine nucleotide exchange | |
5932 factor" | |
5933 /db_xref="CGNC:749" | |
5934 /db_xref="GeneID:417477" | |
5935 CDS 40..792 | |
5936 /gene="SBDS" | |
5937 /note="shwachman-Bodian-Diamond syndrome protein homolog" | |
5938 /codon_start=1 | |
5939 /product="ribosome maturation protein SBDS" | |
5940 /protein_id="NP_001006211.1" | |
5941 /db_xref="CGNC:749" | |
5942 /db_xref="GeneID:417477" | |
5943 /translation="MSIFTPTNQIRLTNVAVVRARRAGKRFEIACYRNKVMGWRSGAE | |
5944 KDIDEVLQTHTVFVNVSKGQVAKKEDLVRAFGTDDQTEICKVILSKGELQVSDKERQT | |
5945 QLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKPNKSTKQQALEVIRQ | |
5946 LKETMQIERAHMRLRFILPVKEGKKLKEKLKPLIKVIENEDFHDQLEIVCLIDPGCFR | |
5947 EIDELIRSETKGKGTLEVLSLKDVEEGDEKLE" | |
5948 misc_feature 43..45 | |
5949 /gene="SBDS" | |
5950 /experiment="experimental evidence, no additional details | |
5951 recorded" | |
5952 /note="N-acetylserine. {ECO:0000250}; propagated from | |
5953 UniProtKB/Swiss-Prot (Q5ZIY4.1); acetylation site" | |
5954 ORIGIN | |
5955 1 gtgagtgacg cgggggtgca gcccggcaga gctgccgcca tgtccatctt cacccccacc | |
5956 61 aaccagatcc gcctcaccaa tgtggccgtg gtgcgggccc ggcgcgccgg aaagcgtttc | |
5957 121 gagatcgcct gttaccgcaa caaagtcatg ggctggcgta gcggagcgga gaaggatatt | |
5958 181 gacgaggtcc tgcagaccca cacagtgttt gtcaatgttt ccaaaggcca ggtggcaaag | |
5959 241 aaggaagacc tcgtccgggc atttggaaca gatgaccaaa cagaaatctg taaagtgatt | |
5960 301 ctatcaaaag gggagctgca ggtatcagac aaagaacgac agacacagct ggagcagatg | |
5961 361 tttagggaca ttgcaactat tgtggctgac aaatgtgtga atcctgagac aaagaggccg | |
5962 421 tacactgtaa tccttataga aagagccatg aaggatattc actactctgt caaaccaaac | |
5963 481 aagagcacta agcaacaggc actggaagtg atcagacagt taaaggagac catgcaaatt | |
5964 541 gaacgtgctc acatgaggtt acgatttatt cttccagtaa aggaggggaa aaaactgaaa | |
5965 601 gagaagctca agccactgat taaagttatt gagaatgaag actttcatga tcagttagaa | |
5966 661 attgtgtgcc ttattgaccc gggctgcttc agagagattg atgagctgat ccggtctgag | |
5967 721 accaaaggga aaggaacgct ggaagtgctc agtctgaaag atgtggagga aggagatgaa | |
5968 781 aagcttgaat aacaaaaacc cttctggagc actgcgacta cttcaacaat gtttaactga | |
5969 841 cactagccac tcttttctgt ttggccttct tgtttttctc caacctcttg ctgccaaata | |
5970 901 ccttctgaca cactaacccg ttgggatttt tccatgcagt gtgtttttta atcatttttc | |
5971 961 acttgcttgg tttgcaggtg atttgcctgt aggaacattt tgtgtcagag ttgcactagt | |
5972 1021 gagaattgag ttaagacttg atagggaatt tagctttggt gaatgttagg ggttgctgat | |
5973 1081 ggagagtgtt tgactgatat ggtgccaatc acttttgctt tgagttgtca gtgttgagtg | |
5974 1141 gaagactgta tgggccactg aggggtgggt gctgtacgtg aggagagaga cctttgggaa | |
5975 1201 agagagatac attttcactt tcagacaagt gcaaagtgtg catcgcatct gctgatctct | |
5976 1261 tggcagcatg aaaactgatg tagacatccg taattggctg cttaatcatt acagtagttt | |
5977 1321 aaaggaccat tcttgtatat ttccttcact gggtataaca gtacttgcta acttagaaaa | |
5978 1381 aatgttcacc aaataattta ttcataaaat atatttagct acattggtaa aaaaaaaaaa | |
5979 1441 aataataatt atcatctatt tatgtattac agatacagaa agaaataact atttttgtta | |
5980 1501 tagcatagga gctatccctg gctgcagtgg tgcatttgga ggctgacggc gtaggctgca | |
5981 1561 tttctgagct gttgtcattc atgggatgaa atgaagcgga tctctcccag acagtggcct | |
5982 1621 ctggccattg tgctagacgg gcttttgttg ggccctcatt ccctcgtggt agctgtcctt | |
5983 1681 tatcctgtgg ctttttatgc ttctttctag cacagcattt ccagccagct cccgaggcac | |
5984 1741 agcattctgt atagttttgt taaggcttgt ttcagctgtg cgaaacgaat gctttcaagt | |
5985 1801 ttaactcggg gatctcaaac aagaggggaa aagaggacag aagctggaaa gatactaaaa | |
5986 1861 atacaagaaa aatacaggcc cggtacatac ccctgggtgc ctgaaggcta agccagaagg | |
5987 1921 agtttaaggg gagcctttgg tgttcatgtg cctgtttcca tgctgataat acacagcgaa | |
5988 1981 tcaggatttg caagctggcc aaccactaga tctctgcttc acatgaatat gttatgttca | |
5989 2041 ttccttgctg cgtaatttta gagtaaatca ccttttatat gacaattaaa cagagctctg | |
5990 2101 gtttgtactc ttcacatggc cttttccttt gtaccactaa cagatgtgag ttttctaggg | |
5991 2161 ttgacgtggg aagatccgaa gtcaaccaga gaaagatttg aaatgttaga tgcagaggaa | |
5992 2221 cctaggtcct tagtcaggga cttcctcttt gaagttgcag cctgttgaca agagcttgtg | |
5993 2281 caaggttgga ttcaatttct ttagccacgt tttgggagga cttgccactg tggagcctga | |
5994 2341 gttttgctga agggttgtga aatggagaat cttgaactac ttaatcaatt ttaaaatgct | |
5995 2401 ttcctgttgc ccctgagata atctgctgtc ctgtttaaat gctgcctagg aaagtttggg | |
5996 2461 ggtgtaatca gtgcatttgt gaggtggaca aagtttaaac atggatatct gtacatgtgt | |
5997 2521 ggataggcag gcaagtttcc tcatatgtac aagcccttaa ctgcttgtct ttcaaatggc | |
5998 2581 catctcctca tgcattattg atgaaaagga tggtaatgct ggtatttaac ctgtcactgg | |
5999 2641 cacttagaat taagatgtaa tccataaatc tgcaaaggag acgctgagca agaacctcac | |
6000 2701 aacattgtgt tggtttattt ggtttcacaa ctctgtaatt tctttggttt ttatgcactt | |
6001 2761 agagcccaat aggatggctg caggttaagg accttgagtt acagaaacat aatctaagct | |
6002 2821 gattcatgag cttggtgcta ggaagtcagt ttccatgtag tctttttcta caaatgaagt | |
6003 2881 gttaaggatt ttctctggta gagggagctt gattttattt ataaacatgc ttgcatttct | |
6004 2941 tgtcatgttt gtatttcagc aagaacggat ggtaagcatc aaaataaatc tcagcattgg | |
6005 3001 ca | |
6006 // | |
6007 | |
6008 LOCUS NM_001318995 976 bp mRNA linear VRT 04-JAN-2017 | |
6009 DEFINITION Gallus gallus Major histocompatibility complex class II beta chain | |
6010 BLB2, (similar to HLA class II, D beta chain) (BLB2), mRNA. | |
6011 ACCESSION NM_001318995 NM_001044694 XM_015295014 | |
6012 VERSION NM_001318995.2 | |
6013 KEYWORDS RefSeq. | |
6014 SOURCE Gallus gallus (chicken) | |
6015 ORGANISM Gallus gallus | |
6016 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
6017 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
6018 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
6019 Phasianidae; Phasianinae; Gallus. | |
6020 REFERENCE 1 (bases 1 to 976) | |
6021 AUTHORS Wu G, Liu L, Qi Y, Sun Y, Yang N, Xu G, Zhou H and Li X. | |
6022 TITLE Splenic gene expression profiling in White Leghorn layer inoculated | |
6023 with the Salmonella enterica serovar Enteritidis | |
6024 JOURNAL Anim. Genet. 46 (6), 617-626 (2015) | |
6025 PUBMED 26358731 | |
6026 REFERENCE 2 (bases 1 to 976) | |
6027 AUTHORS Chen F, Pan L, Chao W, Dai Y and Yu W. | |
6028 TITLE Character of chicken polymorphic major histocompatibility complex | |
6029 class II alleles of 3 Chinese local breeds | |
6030 JOURNAL Poult. Sci. 91 (5), 1097-1104 (2012) | |
6031 PUBMED 22499866 | |
6032 REFERENCE 3 (bases 1 to 976) | |
6033 AUTHORS Hosomichi K, Miller MM, Goto RM, Wang Y, Suzuki S, Kulski JK, | |
6034 Nishibori M, Inoko H, Hanzawa K and Shiina T. | |
6035 TITLE Contribution of mutation, recombination, and gene conversion to | |
6036 chicken MHC-B haplotype diversity | |
6037 JOURNAL J. Immunol. 181 (5), 3393-3399 (2008) | |
6038 PUBMED 18714011 | |
6039 REMARK Erratum:[J Immunol. 2010 May 1;184(9):5415] | |
6040 REFERENCE 4 (bases 1 to 976) | |
6041 AUTHORS Worley K, Gillingham M, Jensen P, Kennedy LJ, Pizzari T, Kaufman J | |
6042 and Richardson DS. | |
6043 TITLE Single locus typing of MHC class I and class II B loci in a | |
6044 population of red jungle fowl | |
6045 JOURNAL Immunogenetics 60 (5), 233-247 (2008) | |
6046 PUBMED 18389232 | |
6047 REFERENCE 5 (bases 1 to 976) | |
6048 AUTHORS Xu R, Li K, Chen G, Xu H, Qiang B, Li C and Liu B. | |
6049 TITLE Characterization of genetic polymorphism of novel MHC B-LB II | |
6050 alleles in Chinese indigenous chickens | |
6051 JOURNAL J Genet Genomics 34 (2), 109-118 (2007) | |
6052 PUBMED 17469783 | |
6053 REFERENCE 6 (bases 1 to 976) | |
6054 AUTHORS Li L, Johnson LW, Livant EJ and Ewald SJ. | |
6055 TITLE The MHC of a broiler chicken line: serology, B-G genotypes, and | |
6056 B-F/B-LB sequences | |
6057 JOURNAL Immunogenetics 49 (3), 215-224 (1999) | |
6058 PUBMED 9914335 | |
6059 REFERENCE 7 (bases 1 to 976) | |
6060 AUTHORS Pharr GT, Dodgson JB, Hunt HD and Bacon LD. | |
6061 TITLE Class II MHC cDNAs in 15I5 B-congenic chickens | |
6062 JOURNAL Immunogenetics 47 (5), 350-354 (1998) | |
6063 PUBMED 9510552 | |
6064 REFERENCE 8 (bases 1 to 976) | |
6065 AUTHORS Li L, Johnson LW and Ewald SJ. | |
6066 TITLE Molecular characterization of major histocompatibility complex (B) | |
6067 haplotypes in broiler chickens | |
6068 JOURNAL Anim. Genet. 28 (4), 258-267 (1997) | |
6069 PUBMED 9345722 | |
6070 REFERENCE 9 (bases 1 to 976) | |
6071 AUTHORS Sung AM, Nordskog AW, Lamont SJ and Warner CM. | |
6072 TITLE Isolation and characterization of cDNA clones for chicken major | |
6073 histocompatibility complex class II molecules | |
6074 JOURNAL Anim. Genet. 24 (4), 227-233 (1993) | |
6075 PUBMED 8239067 | |
6076 REFERENCE 10 (bases 1 to 976) | |
6077 AUTHORS Xu YX, Pitcovski J, Peterson L, Auffray C, Bourlet Y, Gerndt BM, | |
6078 Nordskog AW, Lamont SJ and Warner CM. | |
6079 TITLE Isolation and characterization of three class II MHC genomic clones | |
6080 from the chicken | |
6081 JOURNAL J. Immunol. 142 (6), 2122-2132 (1989) | |
6082 PUBMED 2493505 | |
6083 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
6084 preliminary review. The reference sequence was derived from | |
6085 AADN04000554.1. | |
6086 On Jul 14, 2016 this sequence version replaced gi:974987246. | |
6087 | |
6088 Sequence Note: The RefSeq transcript and protein were derived from | |
6089 genomic sequence to make the sequence consistent with the reference | |
6090 genome assembly. The genomic coordinates used for the transcript | |
6091 record were based on alignments. | |
6092 | |
6093 Publication Note: This RefSeq record includes a subset of the | |
6094 publications that are available for this gene. Please see the Gene | |
6095 record to access additional publications. | |
6096 | |
6097 ##Evidence-Data-START## | |
6098 RNAseq introns :: single sample supports all introns SAMEA2201358, | |
6099 SAMEA2201376 [ECO:0000348] | |
6100 ##Evidence-Data-END## | |
6101 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
6102 1-125 AADN04000554.1 96847-96971 | |
6103 126-395 AADN04000554.1 97178-97447 | |
6104 396-677 AADN04000554.1 97534-97815 | |
6105 678-788 AADN04000554.1 97898-98008 | |
6106 789-812 AADN04000554.1 98102-98125 | |
6107 813-976 AADN04000554.1 98219-98382 | |
6108 FEATURES Location/Qualifiers | |
6109 source 1..976 | |
6110 /organism="Gallus gallus" | |
6111 /mol_type="mRNA" | |
6112 /db_xref="taxon:9031" | |
6113 /chromosome="16" | |
6114 /map="16" | |
6115 /breed="Red Jungle Fowl" | |
6116 gene 1..976 | |
6117 /gene="BLB2" | |
6118 /gene_synonym="B-L; B-LB; B-LB2; B-LB21; B-LBII; GSP-BLB2; | |
6119 S19" | |
6120 /note="Major histocompatibility complex class II beta | |
6121 chain BLB2, (similar to HLA class II, D beta chain)" | |
6122 /db_xref="CGNC:54352" | |
6123 /db_xref="GeneID:101747454" | |
6124 CDS 35..826 | |
6125 /gene="BLB2" | |
6126 /gene_synonym="B-L; B-LB; B-LB2; B-LB21; B-LBII; GSP-BLB2; | |
6127 S19" | |
6128 /note="major histocompatibility complex class II B; MHC | |
6129 class II beta chain 2; B-LB21 major; MHC Class II beta 1 | |
6130 and 2 domains; major histocompatibility class II antigen | |
6131 B-L beta; MHC class II antigen beta chain; B-L beta chain; | |
6132 MHC class II beta 1 domain; MHC class II antigen B-F minor | |
6133 heavy chain; BLB major; B-L beta minor; Bl-Beta II | |
6134 protein; MHC class II B-L beta chain" | |
6135 /codon_start=1 | |
6136 /product="uncharacterized protein LOC101747454 precursor" | |
6137 /protein_id="NP_001305924.2" | |
6138 /db_xref="CGNC:54352" | |
6139 /db_xref="GeneID:101747454" | |
6140 /translation="MGSGSVPAAGAVLVALLALGARPAAGTRPSAFFFYGKIGECHYL | |
6141 NGTERVRFLDRQIYNRQQFAHFDSDVGKFVADTPLGERQAEYWNSNAELLENLMNEVD | |
6142 RVCRHNYGILESFTVQRSVEPKVRVSALQSGSLPETDRLACYVTGFYPPEIEVKWFLN | |
6143 GREETERVVSTDVMQNGDWTYQVLVVLETVPRRGDSYVCRVEHASLRQPISQAWEPPA | |
6144 DAGRSKLLTGVGGFVLGLVFLALGLFVFLRGQKGRPVAAAPGMLN" | |
6145 sig_peptide 35..112 | |
6146 /gene="BLB2" | |
6147 /gene_synonym="B-L; B-LB; B-LB2; B-LB21; B-LBII; GSP-BLB2; | |
6148 S19" | |
6149 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
6150 ORIGIN | |
6151 1 gtgccgggtc ccccatcgtc cggcggcagc agccatgggg agcgggagcg tcccggcggc | |
6152 61 gggggccgtg ctggtggcac tgctggcgct gggagcccgg ccggccgccg gcacgcggcc | |
6153 121 ctcggcgttc ttcttctacg gtaagatagg tgagtgccac tacctgaacg gcaccgagcg | |
6154 181 ggtgaggttt ctggacaggc aaatctacaa ccggcagcag ttcgcgcact tcgacagcga | |
6155 241 cgtggggaaa tttgtggccg atacaccgct gggtgagcgt caagctgaat actggaacag | |
6156 301 caacgccgag cttctggaga acctaatgaa tgaagtggac agggtctgcc ggcacaacta | |
6157 361 cgggattctg gagtccttca cggtgcagag gagcgtggag cccaaggtga gggtctcggc | |
6158 421 gctgcagtcg ggctccctgc ccgaaaccga ccgtctggcg tgctacgtga cgggcttcta | |
6159 481 cccgccggag atcgaggtga agtggttcct gaacgggcgg gaggagacgg agcgcgtggt | |
6160 541 gtccacggac gtgatgcaga acggggactg gacgtaccag gtgctggtgg tgctggagac | |
6161 601 cgtcccgcgg cgcggggaca gctacgtgtg ccgggtggag cacgccagcc tgcggcagcc | |
6162 661 catcagccag gcgtgggagc cgccggcgga cgcgggcagg agcaagctgc tgacgggcgt | |
6163 721 ggggggcttc gtgctggggc tcgtcttcct ggcgctgggg ctcttcgtgt tcctgcgcgg | |
6164 781 tcagaaaggg cgccccgtcg ccgccgctcc agggatgctg aattagctgc tgccccgccg | |
6165 841 agccgctgca cccgcacccc ccgctctccc ggccgtcgcc tcggctctcc ctcgggctgc | |
6166 901 caccgcgtcc gttggagatg tcgccacgat gcacgcttcg tccccatcct aataaacgcg | |
6167 961 ctgactttga ccccgc | |
6168 // | |
6169 | |
6170 LOCUS NM_001322804 2731 bp mRNA linear VRT 04-JAN-2017 | |
6171 DEFINITION Gallus gallus microsomal triglyceride transfer protein-like | |
6172 (MTTPL), mRNA. | |
6173 ACCESSION NM_001322804 XM_001232866 | |
6174 VERSION NM_001322804.1 | |
6175 KEYWORDS RefSeq. | |
6176 SOURCE Gallus gallus (chicken) | |
6177 ORGANISM Gallus gallus | |
6178 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
6179 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
6180 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
6181 Phasianidae; Phasianinae; Gallus. | |
6182 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
6183 NCBI review. The reference sequence was derived from KT899704.1. | |
6184 On Apr 13, 2016 this sequence version replaced gi:971401807. | |
6185 | |
6186 ##Evidence-Data-START## | |
6187 Transcript exon combination :: KT899704.1 [ECO:0000332] | |
6188 RNAseq introns :: single sample supports all introns | |
6189 SAMEA2201376 [ECO:0000348] | |
6190 ##Evidence-Data-END## | |
6191 FEATURES Location/Qualifiers | |
6192 source 1..2731 | |
6193 /organism="Gallus gallus" | |
6194 /mol_type="mRNA" | |
6195 /db_xref="taxon:9031" | |
6196 /chromosome="6" | |
6197 /map="6" | |
6198 /breed="Hy-Line Brown" | |
6199 gene 1..2731 | |
6200 /gene="MTTPL" | |
6201 /note="microsomal triglyceride transfer protein-like" | |
6202 /db_xref="CGNC:55368" | |
6203 /db_xref="GeneID:769580" | |
6204 CDS 30..2675 | |
6205 /gene="MTTPL" | |
6206 /note="microsomal triglyceride transfer protein large | |
6207 subunit-like protein" | |
6208 /codon_start=1 | |
6209 /product="microsomal triglyceride transfer protein-like | |
6210 precursor" | |
6211 /protein_id="NP_001309733.1" | |
6212 /db_xref="CGNC:55368" | |
6213 /db_xref="GeneID:769580" | |
6214 /translation="MGQWALWGYICLLCCSFLSTAKGSPWVLSFQPGMLYQYHYALAM | |
6215 QLGPVAGLSPSGGWLQAQAVVRIRQLHRDPSGDELLQVQIQDLKAQQKPEGPEGPPMD | |
6216 IALNEEVQSELQKPVFISWSSGKIKALHGDETEGTLITNLKRGVVSLLQLQPHASTIV | |
6217 EEDASGSCQVTYTVSNHSIVKTKDLLSCTKPKMGYASPNKMFGIQWQPSSRSLYVVKD | |
6218 SLLQSVLAEESHMLSLVLRSTTGVKISSRQELKLVSSTPSPAVAAEESLENVLASIEG | |
6219 QHQPLAIASLPFRRGCTHCPSLTAYLKTFDSQQAKMDISKAATTWQFQRFIQMLRSAK | |
6220 KRDVLQLLKRAPEKMLPFVVEAAVAAQSVPALAALSDFLDFSKEPGSLLETFLYAAAF | |
6221 SPRPTKELLRLVLDKLDGKQMAPEVRDTGMVALGSLVGKLCQQQLCGLQEVKHGMETI | |
6222 LTGLRSAEKEHEAVIHLLALGNAQLPSTIPTLLEHAEKGPTAVAAAAISALRQFRAWH | |
6223 ITSEVKRAMRRIFHEKRKSYEKTCRLAAAEILLDNTPLSMDVINILLAAHHLGTEAAT | |
6224 FLLLKVQSSLHANHHPARKIMSDIMRDPRINNYNHFSKAGISSSFSGPLTATKELLST | |
6225 FGLDLLFLEGGFLRKSVSDFSLLSQDWHLRAAQVTIEAQGMESMLGENTLEGEEGPEL | |
6226 TAGMSAIFFDVQLRPIIFFKGYTDLMAKVLLSSGEPTSVVKGNLLLMDHHQVIPLQSG | |
6227 LQAVVKLQGGLGLDISANVDVNIWEQELKTSVDTRGSLTIDFQAELDTPFLHTTLRSQ | |
6228 TEAETSIYFDTILRFSSSPVLMCLQLREDQVPYREVFTISTSAGNQSSTIRKGRQGTV | |
6229 PAQEFALHQANSEMCHLLLTAEEGA" | |
6230 sig_peptide 30..98 | |
6231 /gene="MTTPL" | |
6232 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
6233 ORIGIN | |
6234 1 tctcccttcc ccacctcccg gagcccagca tggggcagtg ggcactttgg ggctacatct | |
6235 61 gtctgctctg ctgctccttt ctgagcacag ccaaaggcag cccatgggtg ctttccttcc | |
6236 121 agccgggcat gctgtaccag taccactatg ccctggccat gcagctgggc cccgtggctg | |
6237 181 gcctgtcccc gtctgggggg tggctgcagg cacaggctgt ggtcaggatt cgtcagctcc | |
6238 241 acagggaccc cagcggggat gagctgctcc aggtgcagat ccaagacctg aaagcccagc | |
6239 301 agaagcctga gggtcctgaa ggtcctccca tggacattgc actgaatgag gaggtgcagt | |
6240 361 cagaactcca aaagccagtt ttcatctcct ggagcagcgg gaagatcaaa gccctgcatg | |
6241 421 gggatgaaac agaaggcacc ctgatcacca acctgaagcg aggtgttgtc agcctgctcc | |
6242 481 agctccagcc ccacgccagc accatcgtgg aggaagacgc ctctgggagc tgccaggtca | |
6243 541 catacaccgt gtccaaccac tccattgtaa agacaaaaga tctcctcagc tgcacaaagc | |
6244 601 caaaaatggg atatgcctct ccgaacaaaa tgtttggcat ccagtggcag ccctccagca | |
6245 661 gaagcctgta tgtggtgaag gacagcctgc tgcagtcggt gctggcagag gagagccaca | |
6246 721 tgctgtccct agtcttgagg tccaccactg gtgtcaaaat cagctcaagg caggagctca | |
6247 781 agctggtgtc ttcaacgccc agtcctgcag tggcagctga agagagcctt gagaacgtgc | |
6248 841 tggctagcat agagggacag caccagcccc tggccatagc cagcctgccc ttcaggaggg | |
6249 901 gctgcaccca ctgcccttcg ctgacggcct atctgaagac ctttgatagc cagcaagcca | |
6250 961 aaatggacat ctcaaaggct gcaactacgt ggcagttcca gaggttcatc cagatgctgc | |
6251 1021 gcagtgccaa gaagagagat gtgctgcagc tgctgaagag agcacctgag aagatgctac | |
6252 1081 cctttgtggt ggaggcagcg gtggccgcgc agtcggtgcc agccttggca gctctctcag | |
6253 1141 acttcctgga tttcagcaag gagcccgggt ccctactgga gacgttcctc tatgcagcag | |
6254 1201 ccttctctcc ccgacctaca aaagagctgc tgcgtttggt gctggacaag ctggatggga | |
6255 1261 agcagatggc acccgaggtc cgggacacag ggatggtggc cctgggctct ctggttggaa | |
6256 1321 agctgtgcca gcagcagctg tgcggactgc aggaggtgaa acacggcatg gaaaccatcc | |
6257 1381 taacagggct gagaagtgcc gagaaggagc acgaggcagt catccacctt ctggccctgg | |
6258 1441 ggaatgcgca gctccccagc accatcccca ccctcctgga gcacgcagag aaaggtccca | |
6259 1501 ccgccgtggc agctgcagcc atcagcgccc tgcggcaatt ccgtgcctgg cacatcacca | |
6260 1561 gcgaggtgaa aagagcaatg aggaggatct tccacgagaa gaggaagagc tacgagaaaa | |
6261 1621 catgccgctt ggccgctgca gaaatcctct tggataacac acccttgtcc atggatgtca | |
6262 1681 tcaacatcct gctggccgct caccatctgg gaacagaagc agcaacgttc ctgttactga | |
6263 1741 aggtgcagag cagcctgcat gccaaccacc acccagcaag gaagataatg agtgacatca | |
6264 1801 tgagagaccc tcggataaac aactacaacc acttttcgaa agctggcatc tcctcctcct | |
6265 1861 tctcaggacc tctgacagcc accaaggaac tgctctccac cttcgggctg gacctgctgt | |
6266 1921 ttttggaggg tgggttcctg agaaagagtg tctccgactt ctcgctgctc agccaagact | |
6267 1981 ggcatcttcg tgcggctcag gtcactatag aagcacaagg gatggagtct atgctgggag | |
6268 2041 aaaacacctt ggaaggggaa gaggggccag agctcacggc tgggatgtct gccatcttct | |
6269 2101 ttgatgtcca gttgcggccc atcatcttct tcaagggata tacagaccta atggccaagg | |
6270 2161 ttctgctgag cagtggggaa cccacaagcg tggtcaaagg gaacctcctg ctgatggacc | |
6271 2221 atcaccaggt catccctctg cagtctggtc tccaggcagt ggtcaaactc cagggtggac | |
6272 2281 tcgggcttga tatctcagcc aacgtggatg tgaacatctg ggagcaggaa ctgaagacca | |
6273 2341 gtgtcgacac caggggaagc ctcaccattg atttccaggc agaattggac acccctttcc | |
6274 2401 tccataccac cctgaggagc cagacagagg cagagacctc aatctacttc gacaccatcc | |
6275 2461 tgagattttc cagtagccct gtgctcatgt gcctgcagct gagggaggat caggtaccct | |
6276 2521 atagagaggt cttcaccatc tctacatctg ctgggaacca aagcagcact attcgaaaag | |
6277 2581 gccggcaggg cactgtgcct gcccaggagt ttgccctgca ccaggccaac tctgagatgt | |
6278 2641 gccacctgct gctgacagca gaggagggag cataggagag gagaccattt gggacagagc | |
6279 2701 ttctgcatcc ctgcctgcca tgcaccctgg t | |
6280 // | |
6281 | |
6282 LOCUS NM_001257371 2395 bp mRNA linear VRT 04-JAN-2017 | |
6283 DEFINITION Gallus gallus NME/NM23 family member 5 (NME5), mRNA. | |
6284 ACCESSION NM_001257371 XM_003642079 | |
6285 VERSION NM_001257371.2 | |
6286 KEYWORDS RefSeq. | |
6287 SOURCE Gallus gallus (chicken) | |
6288 ORGANISM Gallus gallus | |
6289 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
6290 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
6291 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
6292 Phasianidae; Phasianinae; Gallus. | |
6293 REFERENCE 1 (bases 1 to 2395) | |
6294 AUTHORS Savolainen P, Fitzsimmons C, Arvestad L, Andersson L and Lundeberg | |
6295 J. | |
6296 TITLE ESTs from brain and testis of White Leghorn and red junglefowl: | |
6297 annotation, bioinformatic classification of unknown transcripts and | |
6298 analysis of expression levels | |
6299 JOURNAL Cytogenet. Genome Res. 111 (1), 79-87 (2005) | |
6300 PUBMED 16093725 | |
6301 REFERENCE 2 (bases 1 to 2395) | |
6302 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
6303 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
6304 TITLE A comprehensive collection of chicken cDNAs | |
6305 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
6306 PUBMED 12445392 | |
6307 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
6308 preliminary review. The reference sequence was derived from | |
6309 BU273418.1, AADN04000142.1, CN228756.1 and CN235652.1. | |
6310 On Feb 11, 2016 this sequence version replaced gi:383387817. | |
6311 | |
6312 Sequence Note: This RefSeq record was created from transcript and | |
6313 genomic sequence data from different strains because no single | |
6314 transcript from the same strain was available for the full length | |
6315 of the gene. The extent of this transcript is supported by | |
6316 transcript alignments and orthologous data. | |
6317 | |
6318 ##Evidence-Data-START## | |
6319 Transcript exon combination :: BU273418.1, CO635606.1 [ECO:0000332] | |
6320 RNAseq introns :: single sample supports all introns | |
6321 SAMEA2201360, SAMEA2201361 | |
6322 [ECO:0000348] | |
6323 ##Evidence-Data-END## | |
6324 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
6325 1-60 BU273418.1 1-60 | |
6326 61-70 AADN04000142.1 732083-732092 | |
6327 71-88 BU273418.1 71-88 | |
6328 89-710 CN228756.1 1-622 | |
6329 711-937 CN235652.1 291-517 | |
6330 938-2395 AADN04000142.1 739902-741359 | |
6331 FEATURES Location/Qualifiers | |
6332 source 1..2395 | |
6333 /organism="Gallus gallus" | |
6334 /mol_type="mRNA" | |
6335 /db_xref="taxon:9031" | |
6336 /chromosome="13" | |
6337 /map="13" | |
6338 /breed="Leghorn" | |
6339 gene 1..2395 | |
6340 /gene="NME5" | |
6341 /note="NME/NM23 family member 5" | |
6342 /db_xref="CGNC:52876" | |
6343 /db_xref="GeneID:426732" | |
6344 misc_feature 71..73 | |
6345 /gene="NME5" | |
6346 /note="upstream in-frame stop codon" | |
6347 CDS 191..829 | |
6348 /gene="NME5" | |
6349 /EC_number="2.7.4.6" | |
6350 /note="non-metastatic cells 5, protein expressed in | |
6351 (nucleoside-diphosphate kinase)" | |
6352 /codon_start=1 | |
6353 /product="nucleoside diphosphate kinase homolog 5" | |
6354 /protein_id="NP_001244300.1" | |
6355 /db_xref="CGNC:52876" | |
6356 /db_xref="GeneID:426732" | |
6357 /translation="MQMLMPEPQIFVEKTLALIKPDVVAKEEEIEDLILRSGFMIVQK | |
6358 RKLQLSPEQCSIFYADQYGKMFFPNLAAYMSSGPSVAMILARHRAVSYWKELLGPSNS | |
6359 IKARMTHPHSLRAIYGTDDLRNGLHGSLSTSSAEREIRFMFPEVISEPIPAGQRARDY | |
6360 LNLHVNPTLLAGLTALCKEKPADPMTWLADWLMEHNPNKPRLQHHVTEEDQE" | |
6361 ORIGIN | |
6362 1 cccgccgcga ggggcgcgga ggccatcttg tggccgctgt gcccgctgcc cgcccggccc | |
6363 61 cgtcgtcgcc tagcaacggg gaggtgcgcg gcatggcggc ggggcgggcg cagcggggcc | |
6364 121 gctggcggcc gtgactggga gctgtggttc caggacaaag aagcacgcgg gttctaattc | |
6365 181 agaagcaaag atgcagatgc taatgccaga acctcagatt tttgtagaaa aaacactggc | |
6366 241 tctcatcaaa cctgacgttg tagctaagga ggaagagata gaggatctca tcctcagatc | |
6367 301 tggattcatg attgttcaga aacggaagct ccagttaagc ccagagcaat gtagcatctt | |
6368 361 ttatgcagac cagtatggaa aaatgttttt tcctaatcta gcagcctata tgagctctgg | |
6369 421 accttcagtt gccatgattc ttgccaggca tcgtgcagtc tcatactgga aggaattgct | |
6370 481 tggaccatca aacagcataa aagctaggat gactcaccct cacagtttaa gagcaatcta | |
6371 541 tgggactgat gatctgagga atggacttca tggcagtctc agcacttcct cagcagaaag | |
6372 601 agaaattcga ttcatgtttc cagaagtgat ctcggagcca attccagctg gacaaagagc | |
6373 661 tagagattat ttgaatcttc atgtaaatcc tacattacta gctgggctca cggcactttg | |
6374 721 taaagagaag ccagcagatc caatgacatg gcttgctgac tggctgatgg aacacaaccc | |
6375 781 taacaaacct aggttacaac atcacgtcac tgaagaagac caggagtaag atctcagtgg | |
6376 841 aaatcacctc aagtattcca agttacagat ggatgtcatc gttttcactg tatccctggg | |
6377 901 gaattagtat tatttgaagt aaatgttatt gtcataacta ctctcatgtc tttatggaat | |
6378 961 ccttatcctt actctttgcc aggatttaac agctgtagta acttttctat tgacttagag | |
6379 1021 agtgtagact tgcatgataa atttactgtg tcaggtgatt agaaaaggat gaaattatct | |
6380 1081 tcaggtgtta cctgaactgc tattttctct aattgtcttg atgtggctgc ctggggaaaa | |
6381 1141 taaaatcatt aagacaatca cagattccca agtgacattc agctggtcta tactctgtta | |
6382 1201 agcagacttt tttctagcac ttttttagga gacacaaatt gcattctggg agaaggtacc | |
6383 1261 tgaatgtaac ttagatacaa agggcatgtt accaacctga gaaatactgc tgttggctgc | |
6384 1321 atcactgagc tatggtaact cctgaagtgg tgacttgaga ctgttgtatt ttgacagtat | |
6385 1381 aatttgaaat tctgaattaa agccatcttg aatgtacatt ttccatctca gtgacaaaag | |
6386 1441 gcacagtggt tataaatcag tctctaattt ctattagaaa tcacaggagg gtgtatttta | |
6387 1501 gggactaatg ctgatattaa ttccaatatc tgtttaaaga aaggtgctta aatgcaacag | |
6388 1561 ctcatagtag gggtggtttt tttgtgctca tctactctta aaaggtatgc tgatttctgt | |
6389 1621 tgtttccctt gtattgcttt ttacatttga aatttactgt gttttatttg acagtttcaa | |
6390 1681 gggggtgggt taggggctgt gctgttcaac aggcagtggt taatcctgta ctctatttct | |
6391 1741 gaagtaattg gacaggtttg ggggaggata ggggactgtt tttcttaaaa gttatatttg | |
6392 1801 cgctgttaac ttcgaacttt gtatcttgtg gttttcgtgg attgcatgga gaaagcattg | |
6393 1861 gtcttacagc tctgagcctt gggcagactc atactaaaac aaagtcatag tttgctttat | |
6394 1921 gacaaacctt gcttctcaaa cttgaataat tagcagcaac ttcagtcaat agtctgtaac | |
6395 1981 attaaacttc taaattaact gtgcatcttc taagagaata aatccacact tgccacttca | |
6396 2041 gataacccat ctctacgaaa acaaaacaaa aaaacacaac agcctaacac tcagatatga | |
6397 2101 agaaagaata acaaggtcat tagaaataca gcaagcagat ctcttcataa ctaatttctt | |
6398 2161 ttgcgtgtgt ttattgttcc ctacacacgt ctgattgctg caattatagg acagctgtgc | |
6399 2221 tttgtggttt cctgttagcc aaaccaaaac acttctattt tgaacttgcc agaagctaaa | |
6400 2281 agccaatgga ttcacaatgt tttctccttc atttttgtta gttactgtgg cgtttgctta | |
6401 2341 cttagttact tagatgtgtt atagtttgac aataaatatt tcctttatgt tatgg | |
6402 // | |
6403 | |
6404 LOCUS NM_001292086 6644 bp mRNA linear VRT 04-JAN-2017 | |
6405 DEFINITION Gallus gallus LEO1 homolog, Paf1/RNA polymerase II complex | |
6406 component (LEO1), mRNA. | |
6407 ACCESSION NM_001292086 XM_001232677 | |
6408 VERSION NM_001292086.2 | |
6409 KEYWORDS RefSeq. | |
6410 SOURCE Gallus gallus (chicken) | |
6411 ORGANISM Gallus gallus | |
6412 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
6413 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
6414 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
6415 Phasianidae; Phasianinae; Gallus. | |
6416 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
6417 preliminary review. The reference sequence was derived from | |
6418 BU230505.1, BU260848.1, CN232844.1, BU431855.1 and AADN04000364.1. | |
6419 On Feb 11, 2016 this sequence version replaced gi:638280130. | |
6420 | |
6421 Sequence Note: This RefSeq record was created from transcript and | |
6422 genomic sequence data to make the sequence consistent with the | |
6423 reference genome assembly. The genomic coordinates used for the | |
6424 transcript record were based on transcript alignments. | |
6425 | |
6426 ##Evidence-Data-START## | |
6427 RNAseq introns :: mixed/partial sample support SAMEA2201357, | |
6428 SAMEA2201358 [ECO:0000350] | |
6429 ##Evidence-Data-END## | |
6430 | |
6431 ##RefSeq-Attributes-START## | |
6432 inferred exon combination :: based on alignments, homology | |
6433 ##RefSeq-Attributes-END## | |
6434 COMPLETENESS: complete on the 3' end. | |
6435 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
6436 1-611 BU230505.1 1-611 | |
6437 612-696 BU260848.1 576-660 | |
6438 697-1451 CN232844.1 1-755 | |
6439 1452-2081 BU431855.1 12-641 | |
6440 2082-6644 AADN04000364.1 1126269-1130831 | |
6441 FEATURES Location/Qualifiers | |
6442 source 1..6644 | |
6443 /organism="Gallus gallus" | |
6444 /mol_type="mRNA" | |
6445 /db_xref="taxon:9031" | |
6446 /chromosome="10" | |
6447 /map="10" | |
6448 /breed="Leghorn" | |
6449 gene 1..6644 | |
6450 /gene="LEO1" | |
6451 /note="LEO1 homolog, Paf1/RNA polymerase II complex | |
6452 component" | |
6453 /db_xref="CGNC:55225" | |
6454 /db_xref="GeneID:769405" | |
6455 CDS 17..1990 | |
6456 /gene="LEO1" | |
6457 /note="RNA polymerase-associated protein LEO1-like; Leo1, | |
6458 Paf1/RNA polymerase II complex component, homolog" | |
6459 /codon_start=1 | |
6460 /product="RNA polymerase-associated protein LEO1" | |
6461 /protein_id="NP_001279015.1" | |
6462 /db_xref="CGNC:55225" | |
6463 /db_xref="GeneID:769405" | |
6464 /translation="MADMEELFGSDADSEAEQKDTDSGSDSDSDQENAGSGSNASGSD | |
6465 SEQDDEREAAKPSNKELFGDDSEDEGASHHTGSDNHSERSYNRSEASGHSEHEDNDQS | |
6466 DVDQHSASEAAHDDEEDERGHGSDEGSHHSEGDGSEKAHSEDEKWGKEDKSDQSDDEE | |
6467 RQQNSDDEERQQNSDDEEKAQNSDEDERPQMSDDEERLQNSDEEKMQNSDDEERPQVS | |
6468 DEEKMQNSDDDERAQHSDEEKMQNSDDDERAQRSDEEEQEHKSGESARGSDSEDEVLR | |
6469 MKRKKPIASDSEADSDTEGQKEHADVMDLFGGADDISSGSDGEDKPPTPGQPIDENGL | |
6470 SQEQQEEEPIPETRIEVEIPKVNTDLGNDLYFVKLPNFLSVEPRPFDPQYYEDEFEDE | |
6471 EMLDEEGRTRLKLKVENTIRWRMRRDEEGNEIRESNARIVKWSDGSMSLHLGNEVFDV | |
6472 YKAPLQGDHTHLFIRQGTGLQGQAVFRTKLTFRPHSTDSATHRKMTLSLADRCSKTQK | |
6473 IRILPMAGRDPESQRTEMIKKEEERLRASIRRESQQRRMREKQHQRGLSANYLEPDRY | |
6474 EEEDEGDDAISLAAIKNRYKGGIREERARIYSSDSDEGSDEDKTQRLLKAKKLTSDEE | |
6475 GEPSGKRKAEDDDKASKKHKKYVISDEEEDDDD" | |
6476 ORIGIN | |
6477 1 ggcgcgtgca gcagccatgg ccgacatgga ggagctgttc ggcagcgacg ccgactcgga | |
6478 61 ggccgagcag aaagataccg attccggctc agactccgac tctgaccagg agaacgcggg | |
6479 121 ctccggcagc aacgcctcgg gcagcgacag cgagcaggac gacgagcggg aggcagcaaa | |
6480 181 gcccagcaac aaggagctgt tcggagacga cagcgaggat gaaggagcct cccatcacac | |
6481 241 gggcagcgac aaccactccg agaggtcgta caatcgctcc gaagcttcgg ggcactctga | |
6482 301 gcacgaagac aacgatcagt cggacgtgga ccagcacagc gcttcagaag cggctcatga | |
6483 361 cgatgaggag gacgagcggg ggcacggctc tgatgagggc agtcaccatt ctgagggaga | |
6484 421 tggttcagaa aaggcccatt cggaggatga gaagtggggc aaggaggaca aaagcgatca | |
6485 481 gtcagatgat gaggagcgac agcagaactc tgatgatgag gagagacagc agaactcgga | |
6486 541 cgatgaggag aaagcacaga actctgatga agatgagagg ccgcagatgt ctgacgatga | |
6487 601 ggagaggctc cagaactcgg atgaggagaa gatgcagaac tctgatgatg aggagaggcc | |
6488 661 gcaggtgtcg gacgaggaga agatgcaaaa ctcagatgat gatgaaagag cccagcactc | |
6489 721 tgatgaggag aagatgcaga actctgacga tgacgaaagg gcccagcgct ccgatgagga | |
6490 781 ggagcaggag cataaatctg gagagtctgc aagaggcagc gacagtgaag atgaagtcct | |
6491 841 gcgaatgaag cgaaagaaac caattgcatc agattcagag gcggacagtg atacagaagg | |
6492 901 ccagaaggaa cacgcagacg tcatggacct gtttggagga gcagatgaca tttcttcggg | |
6493 961 aagcgatggg gaagacaagc cgccaactcc aggacagccc attgatgaga atgggctgag | |
6494 1021 ccaagaacag caggaggaag agcctattcc agagacaaga atagaggtag aaataccaaa | |
6495 1081 agtaaacaca gacttgggta acgatttgta ttttgtgaag ctgcccaact tcctcagtgt | |
6496 1141 ggagcccaga ccatttgatc cccagtatta tgaggatgaa tttgaagatg aggagatgct | |
6497 1201 tgatgaggaa gggagaacga gattaaaact taaggtagaa aacacaatac ggtggcggat | |
6498 1261 gcggcgagat gaggaaggga atgagattag agaaagcaat gcccggatag tcaagtggtc | |
6499 1321 ggatggaagc atgtctctcc acttgggaaa tgaggtcttt gatgtgtaca aggcaccgct | |
6500 1381 gcagggagat cacacccatc tgtttatcag acaagggaca ggtctgcaag gacaggctgt | |
6501 1441 tttcaggaca aagttaacct tcaggccaca ctctacagac agtgccacgc acaggaagat | |
6502 1501 gactctgtct ctggcagata ggtgttcaaa gacccagaaa attcgtattt tgccaatggc | |
6503 1561 gggtcgtgat ccggagtctc agcgcacaga aatgattaag aaagaagagg agagattaag | |
6504 1621 agcttccatt cgcagagaat ctcagcagcg aagaatgagg gagaagcagc atcagcgtgg | |
6505 1681 tctgagtgct aattacttag aacccgatcg ctatgaagaa gaggacgagg gagacgatgc | |
6506 1741 gatcagtcta gcagctatca aaaacagata caaaggtggc atcagagagg aacgtgctag | |
6507 1801 aatctattct tcagacagtg atgaaggctc agatgaagat aaaacacaaa gactactcaa | |
6508 1861 ggcaaagaaa cttactagtg atgaggaagg ggagccttct ggaaagagaa aagcagagga | |
6509 1921 tgatgacaaa gcaagtaaga agcataagaa gtatgtcatc agtgatgaag aggaagatga | |
6510 1981 tgatgattaa cattgaggga gcactgaagt tgctttctat atatacatat ttatatataa | |
6511 2041 attgtacagt tctcttacag caaagatgta agtagccata ttggggttat tttgataaag | |
6512 2101 gagaattcca ttgaaatttg tgtttctggt gtgaataaaa gttggtttct ttctttttac | |
6513 2161 tttctcatat ttttacatct tatcttactg cagcagctgc tgcaatgggg atcatcatag | |
6514 2221 catcagtttt taaatcttgt acagtacatt tcagttttga aatctatagt acaaactggt | |
6515 2281 tgtacaactg aatagaactg aataaatcag tggtcttact gagttcatta ggagaaatca | |
6516 2341 taatcttcat atagaatgct taaattataa gttttctcag ccaggttatg gagatgaagg | |
6517 2401 ttaccatttg tacagaagat ttggaatatc atatgagtgg cacaacaccg tactgttttt | |
6518 2461 tcctgcactt tcctattacg tactgctggc tgtagatggt acattactgt gctgttatat | |
6519 2521 tttgatattt ttgactgaag gtatttctta tcatgtctac tctgagtaaa ctgtgaagtt | |
6520 2581 cctgtagtta gaatagtaaa ccaaccacaa gatgtttatt ttttcataaa ttgaacgaaa | |
6521 2641 atccacctct catctgagcg ttagcattaa taagaataat cacattagcg atggaactgt | |
6522 2701 caggatagaa gcacttgttt atacaaaacc aacgaatttc tgcaagttca tgaaaggctt | |
6523 2761 ctttaacaac tgcagtgagc cgccctgtga atacatatcc tgctaatagc attttgtaat | |
6524 2821 ctcatacaag ccttatgatg cattttccta ttgttctggg ttggctgaaa agacagcgga | |
6525 2881 ggagaatatt gtggacagag ttattgctgc ttttatgcta tttttaaaca ccttatttga | |
6526 2941 ttatgcaaat agcattgcaa aatgaggaga ggctacaaga aatgtctcat cttttccact | |
6527 3001 ctttaagatt atgtttccca cgtgtagttt cccttgttgg tgagatagca tttccatgtt | |
6528 3061 atctatgttg ttttttaact gccttttcac atagtcctag aaagcttgtg acttcatgga | |
6529 3121 ggtagcagga agaaagcaga aagcatagct taatgcctct ttaaatgcat tgagcggtgc | |
6530 3181 catggaaagt ttgctgagtg gatttatgtt tcgtaagata aagtagctta cagttatgta | |
6531 3241 agaataaatg ttactcatct ctctcctgcc cagatgaatt atgcttttct ataaaaactg | |
6532 3301 ttgagttaca gcttttaacc tggctgtctt gcctttgaaa tgtgtaatta ggcaaacagt | |
6533 3361 ttactgaagt actctacctc catttttctt gcctggaagg tgtgggaagc attctagctg | |
6534 3421 cagaggcaca gagctctgca cgcattaata tattctgctc agcagctgac tgcagtgtag | |
6535 3481 acacttgcaa atatgaaaac aaagtgaaaa atgtctactc tgaagtctga gtgcctgaga | |
6536 3541 agctgttctt ttgttgttgt tgttgttgtt tttgtacttg tttctaagag ttcctgcctc | |
6537 3601 tcttccctgt gcagataaaa cctttctcca tctgctccaa ttttgagtaa tcctcttagg | |
6538 3661 ttagacctct gctgggagtc tggctcctca catgtggtta cctgcttttc tgttgtaacc | |
6539 3721 tgctcaggaa gaagccagct gtagaaaaag ggagttgttt cttatgctat gtggttgcta | |
6540 3781 gactttcgtg tcaaagtctc ccagatacct cttgagcagc aatgcaaagt gtatggaaac | |
6541 3841 tcaccaccat ttcactgctg atgtgtttgc ttaatgtcag tttaattaaa gcattggtta | |
6542 3901 cttttactat attccaaagg gtgaaaatgt tttaatcact cttacaggtt tgatgctgac | |
6543 3961 taagccttta cttggtaagt gggctacttt agcttccaaa aaggaggctt ttgtggattt | |
6544 4021 aaaagattaa aaggagtgtt tttttctact gtcttctttt gtaaattgct cttctaaagt | |
6545 4081 cttattaaaa catagaattt tagaaagtgt tttctcagcc taaattggtt taacaatcac | |
6546 4141 cttttaatta aagtcacttg aacgaacttt gtcttatcca tagtatttgt tgcttgtgag | |
6547 4201 tgtggtgtac agttctgttt cactcatagg cagttttttt gctctccctt ttcccagcct | |
6548 4261 ccaagtatgt gacaattact tggaattgtt tttcttaccc aaatcagaaa tatgaagctg | |
6549 4321 gaactaaagt gcgtaaggag aaggaaagaa caagtaggtg aactgtattt acttttgtac | |
6550 4381 agactggcca gagtacttct tccagaaagg ttatgatttg gacaatttcc aaaaataaaa | |
6551 4441 atctgtttga agagctgata atgagctgag ttttagattt tctggctagt ggtagagtgt | |
6552 4501 aggatcagtt gtcttgaaac catcactgaa aggtgttcct agctatatag ttttgttgtt | |
6553 4561 tcaggtatat tgttcaactg tacgcttgcc aattgcagaa ctggagtttt ctttctagca | |
6554 4621 ctgagtaaca ttctcttcca tccttgccct gcaagttgac accattttca tgctagaggc | |
6555 4681 aagcctgatg gatcaggggc tgccctcaga agggtgcagc tgcccatgca gtccttgtct | |
6556 4741 ctttctagca gcaggtttgg caatacctgc ctggcttagc tcagagtgaa tttgctaaac | |
6557 4801 tcccaggaaa ctgattttct gctgtgctgg agttttgtgc cataggccag cagaactact | |
6558 4861 tcattggcca tgtgaacaag gtagccagct cagtaagttg gcctggtcat gaggacatca | |
6559 4921 ggggatatgg cagaaggatg ctctctttgg cagaggtgta aacttttact tgactgcctt | |
6560 4981 ttgaaaactt agcttgaccc tgcagaaggt agttgatagt tttctactgc tgtagctgcc | |
6561 5041 tcagctggca cactggtgtg tcggttgtga ctggaggtgg tgcaagaggt agaacaggac | |
6562 5101 agttctgtgt gtggcagcaa gttttaactc ggctcagatg tgaaactgca gccacaggaa | |
6563 5161 tgtgttaaac atgagatggt gactttccag tgaagtcata ggtatttatt tctcagccag | |
6564 5221 tgggcatagg agcccatggt gtcggcccat tctaatggag tgcttttctc taacagctta | |
6565 5281 atgctgctgg tcaagctgag tgttactgag tgcatagaga tggtcacatg ggaaagaaag | |
6566 5341 agagaatttt gtttctgata aatgttcttt taatattagt tataagaagt tttacatatt | |
6567 5401 agatttgtga aattcagcta cgctgttgta acacttagac acttgcctgt ggcttgactt | |
6568 5461 ggaagtgctt gtggagagca atgtgactaa cacctcgtgt tgcctagtga tgccctttca | |
6569 5521 cttgagctgg ggttttttta gtgcctgtct ggacatgaaa gacttagaga aaagctgcaa | |
6570 5581 acaagtgttg actgctagct tgtatcttta attgctttaa aactcgtggg cattctcatg | |
6571 5641 aattatataa gcttaagtag ttgagaaaat gacataaaat taagtaaatc cctgctgaaa | |
6572 5701 tcattctcag acagaatttg acaaaaaaaa atcctttcac aagtcttttt tgacattttt | |
6573 5761 tttctaaagg attttttatg gtttcaagac tggactgatg cttgggggga aaaaggagtt | |
6574 5821 actgaagtgg aagcttaact agaaagtttt tatttgttgc tttgttttct ccattatttc | |
6575 5881 gtgaagaatt gagagactgt agagccagtt taccaacaaa agtaacctca tgtcttttga | |
6576 5941 gttaggatga aattttctgg gaaagaatgg cattcctgca gttattgata gccatggaat | |
6577 6001 catatataca ctgtattctt catatattgt caattaaaca taaataaaat cctaggaaat | |
6578 6061 ggtaaaagca tcaactatca caccctcttt tttctatctt atgactgaat taactttctg | |
6579 6121 tgttttcatg cttttctcct caaaacactt cataatgtaa ctggaaaaga cacactaatc | |
6580 6181 ctagcgtgat gatctgtcag ttaccttgtg ggttttttcc tctttgtctg tcagtgtaaa | |
6581 6241 ggtgtatgat agacattctg tacagaacgg gctcttagaa caggatttgc tgttgagctc | |
6582 6301 tacagtaaac cttttatttt aattttgcat ggatgctcaa ggaccactct cattttcata | |
6583 6361 tgtaaaggaa ataaacttac gtttttggca acggcagtaa tcagcatctt tccttcaggt | |
6584 6421 gtttagtaca cttgtacata gtgatcgtgt ttgggaagtt gtcctgcttg gttggctgag | |
6585 6481 ggttgtattg tgagatgtgt aacctactat ctctgtaagc ccagtgctgt tgctcgttgt | |
6586 6541 atttaatgcc agcagcatca agttttgttt acaaatccgg aatcaggtaa ctgtatttaa | |
6587 6601 actatgtcag cttgtcatct cccagtctta tttttcagct taaa | |
6588 // | |
6589 | |
6590 LOCUS NM_204766 5992 bp mRNA linear VRT 04-JAN-2017 | |
6591 DEFINITION Gallus gallus myosin, heavy chain 15 (MYH15), mRNA. | |
6592 ACCESSION NM_204766 | |
6593 VERSION NM_204766.2 | |
6594 KEYWORDS RefSeq. | |
6595 SOURCE Gallus gallus (chicken) | |
6596 ORGANISM Gallus gallus | |
6597 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
6598 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
6599 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
6600 Phasianidae; Phasianinae; Gallus. | |
6601 REFERENCE 1 (bases 1 to 5992) | |
6602 AUTHORS Rossi AC, Mammucari C, Argentini C, Reggiani C and Schiaffino S. | |
6603 TITLE Two novel/ancient myosins in mammalian skeletal muscles: MYH14/7b | |
6604 and MYH15 are expressed in extraocular muscles and muscle spindles | |
6605 JOURNAL J. Physiol. (Lond.) 588 (PT 2), 353-364 (2010) | |
6606 PUBMED 19948655 | |
6607 REMARK GeneRIF: Chicken ventricular MYH is the ortholog of mammalian MYH15 | |
6608 REFERENCE 2 (bases 1 to 5992) | |
6609 AUTHORS Garriock RJ, Meadows SM and Krieg PA. | |
6610 TITLE Developmental expression and comparative genomic analysis of | |
6611 Xenopus cardiac myosin heavy chain genes | |
6612 JOURNAL Dev. Dyn. 233 (4), 1287-1293 (2005) | |
6613 PUBMED 15986480 | |
6614 REFERENCE 3 (bases 1 to 5992) | |
6615 AUTHORS Ching YH, Ghosh TK, Cross SJ, Packham EA, Honeyman L, Loughna S, | |
6616 Robinson TE, Dearlove AM, Ribas G, Bonser AJ, Thomas NR, Scotter | |
6617 AJ, Caves LS, Tyrrell GP, Newbury-Ecob RA, Munnich A, Bonnet D and | |
6618 Brook JD. | |
6619 TITLE Mutation in myosin heavy chain 6 causes atrial septal defect | |
6620 JOURNAL Nat. Genet. 37 (4), 423-428 (2005) | |
6621 PUBMED 15735645 | |
6622 REFERENCE 4 (bases 1 to 5992) | |
6623 AUTHORS Srikakulam R and Winkelmann DA. | |
6624 TITLE Chaperone-mediated folding and assembly of myosin in striated | |
6625 muscle | |
6626 JOURNAL J. Cell. Sci. 117 (PT 4), 641-652 (2004) | |
6627 PUBMED 14709723 | |
6628 REMARK GeneRIF: The folding and assembly of striated muscle myosin was | |
6629 analyzed by expressing a GFP-tagged embryonic myosin heavy chain | |
6630 (GFP-myosin) in post-mitotic C2C12 myocytes using replication | |
6631 defective adenoviruses. | |
6632 REFERENCE 5 (bases 1 to 5992) | |
6633 AUTHORS Yazawa S, Obata K, Iio A, Koide M, Yokota M, Sasaki S, Kagami H and | |
6634 Ono T. | |
6635 TITLE Heart-selective expression of the chicken FK506-binding protein | |
6636 (FKBP) 12.6 gene during embryonic development | |
6637 JOURNAL Dev. Dyn. 226 (1), 33-41 (2003) | |
6638 PUBMED 12508222 | |
6639 REFERENCE 6 (bases 1 to 5992) | |
6640 AUTHORS Machida S, Noda S, Furutani Y, Takao A, Momma K and Matsuoka R. | |
6641 TITLE Complete sequence and characterization of chick ventricular myosin | |
6642 heavy chain in the developing atria | |
6643 JOURNAL Biochim. Biophys. Acta 1490 (3), 333-341 (2000) | |
6644 PUBMED 10684978 | |
6645 REFERENCE 7 (bases 1 to 5992) | |
6646 AUTHORS Camoretti-Mercado B, Dizon E, Jakovcic S and Zak R. | |
6647 TITLE Differential expression of ventricular-like myosin heavy chain mRNA | |
6648 in developing and regenerating avian skeletal muscles | |
6649 JOURNAL Cell. Mol. Biol. Res. 39 (5), 425-437 (1993) | |
6650 PUBMED 8173588 | |
6651 REFERENCE 8 (bases 1 to 5992) | |
6652 AUTHORS Watanabe B. | |
6653 TITLE Amino-acid sequence of the short subfragment-2 in adult chicken | |
6654 cardiac muscle myosin | |
6655 JOURNAL Biol. Chem. Hoppe-Seyler 373 (10), 1045-1054 (1992) | |
6656 PUBMED 1418675 | |
6657 REFERENCE 9 (bases 1 to 5992) | |
6658 AUTHORS Bisaha JG and Bader D. | |
6659 TITLE Identification and characterization of a ventricular-specific avian | |
6660 myosin heavy chain, VMHC1: expression in differentiating cardiac | |
6661 and skeletal muscle | |
6662 JOURNAL Dev. Biol. 148 (1), 355-364 (1991) | |
6663 PUBMED 1936571 | |
6664 REFERENCE 10 (bases 1 to 5992) | |
6665 AUTHORS Stewart AF, Camoretti-Mercado B, Perlman D, Gupta M, Jakovcic S and | |
6666 Zak R. | |
6667 TITLE Structural and phylogenetic analysis of the chicken ventricular | |
6668 myosin heavy chain rod | |
6669 JOURNAL J. Mol. Evol. 33 (4), 357-366 (1991) | |
6670 PUBMED 1774788 | |
6671 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
6672 NCBI review. The reference sequence was derived from AB032197.1. | |
6673 On Feb 3, 2016 this sequence version replaced gi:45382108. | |
6674 | |
6675 ##Evidence-Data-START## | |
6676 Transcript exon combination :: AB032197.1 [ECO:0000332] | |
6677 RNAseq introns :: mixed/partial sample support | |
6678 SAMEA2201357, SAMEA2201358 | |
6679 [ECO:0000350] | |
6680 ##Evidence-Data-END## | |
6681 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
6682 1-5992 AB032197.1 4-5995 | |
6683 FEATURES Location/Qualifiers | |
6684 source 1..5992 | |
6685 /organism="Gallus gallus" | |
6686 /mol_type="mRNA" | |
6687 /db_xref="taxon:9031" | |
6688 /chromosome="1" | |
6689 /map="1" | |
6690 /breed="Leghorn" | |
6691 gene 1..5992 | |
6692 /gene="MYH15" | |
6693 /gene_synonym="MYH6; myosin; P-MHC; VMHC1" | |
6694 /note="myosin, heavy chain 15" | |
6695 /db_xref="CGNC:49365" | |
6696 /db_xref="GeneID:395534" | |
6697 misc_feature 35..37 | |
6698 /gene="MYH15" | |
6699 /gene_synonym="MYH6; myosin; P-MHC; VMHC1" | |
6700 /note="upstream in-frame stop codon" | |
6701 CDS 50..5863 | |
6702 /gene="MYH15" | |
6703 /gene_synonym="MYH6; myosin; P-MHC; VMHC1" | |
6704 /note="myosin, heavy chain 6, cardiac muscle, alpha; | |
6705 ventricular myosin heavy chain 1; cardiac muscle isoform" | |
6706 /codon_start=1 | |
6707 /product="myosin heavy chain, cardiac muscle isoform" | |
6708 /protein_id="NP_990097.1" | |
6709 /db_xref="CGNC:49365" | |
6710 /db_xref="GeneID:395534" | |
6711 /translation="MMDMTEFGEAAPFLRKSEKELMMLQTVAFDGKKKCWVPDDKKAY | |
6712 VEAEITESSGGKVTVETTDGRTMTIKEDDVQSMNPPKFDMIEDMAMLTHLNEASVLYN | |
6713 LRKRYSNWMIYTYSGLFCVTINPYKWLPVYKSEVVAAYKGKRRSEAPPHIFSIADNAY | |
6714 HDMLRNRENQSMLITGESGAGKTVNTKRVIQYFATVAALGEPGKKSQPATKTGGTLED | |
6715 QIIQANPALEAFGNAKTLRNDNSSRFGKFIRIHFGTTGKLSSADIEIYLLEKSRVIFQ | |
6716 QPGERDYHIFYQILSGKKPELLDMLLVSTNPYDYHFCSQGVVTVDNLDDGEELMATDQ | |
6717 AMDILGFVPDEKYGAYKLTGAIMHFGNMKFKQRPREEQAEADGTESADKAAYLMGINS | |
6718 SDLVKGLLHPRVKVGNEYVTKGQSVEQVLYAVGALSKAVYDRMFKWLVVRINKTLDTK | |
6719 LPRQFFIGVLDIAGFEIFDFNSFEQLCINYTNEKLQQFFNHHMFVLEQEEYKKEGIEW | |
6720 VFIDFGMDLQACIDLIEKPLGILSILEEECMFPKATDMTFKAKLYDNHLGKSPNLQKP | |
6721 RPDKKRKYEAHFELIHYAGSVPYNIIGWLEKNKDPLNETVVGIFQKSSNKLLASLFES | |
6722 YVGADSADQGGEKKRKKGASFQTVSSLHKENLNKLMTNLRSTAPHFVRCIIPNESKTP | |
6723 GEMDAFLVLHQLRCNGVLEGIRICRKGFPNRVLYADFKQRYRILNPGAIPEDKFVDSR | |
6724 KAAEKLLASLDIDHNQYRFGHTKVFFKAGLLGHLEEMRDERLAKILTMIQARARGRLM | |
6725 RIEFQKIVERRDALLVIQWNIRAFMAVKNWPWMKLFFKIKPLLKSAETEKEMANMKEE | |
6726 FLKLKEALEKSEARRKELEEKQVSLVQEKNDLLLQLQAEQDTLADAEERCDLLIKSKI | |
6727 QLEAKVKELTERVEDEEEMNSELTSKKRKLEDECSELKKDIDDLEITLAKVEKEKHAT | |
6728 ENKVKNLTEEMATLDENISKLTKEKKSLQEAHQQVLDDLQAEEDKVNTLSKAKVKLEQ | |
6729 QVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESVMDLENDKLQMEEKLKKKEFEM | |
6730 SQLNSKIEDEQAIVMQLQKKIKELQARIEELEEELEAERAARAKVEKQRSDLARELEV | |
6731 LSERLEEAGGATAAQLEMNKKREAEFLKLARDLEEATLHYEATAAALRKKHADSVAEM | |
6732 GEQLDNLQRVKQKLEKEKSELKMEVDDLTSNMEQTVKGKANAEKLCRTYEDHLNETKT | |
6733 KLDEMTRLMNDLTTQKTKLQSENGEFVRQLEEKESLISQLSRGKTSFTQQIEELRRQL | |
6734 EEETKSKNALAHALQAARHDCDLLREQYEEEQEAKAELQRALSKGNAEVAQWRTKYET | |
6735 DAIQRTEELEDAKKKLAARLQEAEEAIEAANAKCSSLEKTKHRLQNELEDMMIDLEKA | |
6736 NSAAASLDKKQRGFDKIINDWKQKYEESQAELEASQKEARSLSTELFKLKNAYEETLD | |
6737 HLETLKRENKNLQEEISDLTNQISEGNKNLHEIEKVKKQVEQEKSEVQLALEEAEGAL | |
6738 EHEESKTLRFQLELSQLKADFERKLAEKDEEMENIRRNQQRTIDSLQSTLDSEARSRN | |
6739 EAIRLKKKMEGDLNEMEIQLSHANRHAAEATKSARGLQTQIKELQVQLDDLGHLNEDL | |
6740 KEQLAVSDRRNNLLQSELDELRALLDQTERARKLAEHELLEATERVNLLHTQNTSLIN | |
6741 QKKKLEGDISQMQNEVEESIQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMK | |
6742 KNMEQTIKDLQKRLDEAEQIALKGGKKQIQKLESRVRELENELENELRRNSDAQKGAR | |
6743 KFERRIKEVTYQSEEDKKNLARMQDLIDKLQLKVKSYKHQAEEAEAQANLYLSKYRKQ | |
6744 QHDLDDAEERAEIAESQVNKLRSKSRDIGMKKVHEEE" | |
6745 ORIGIN | |
6746 1 tctttgactt tggcctcctt gagctgtact accttgaagc cttgccaaga tgatggacat | |
6747 61 gacggaattt ggggaggctg ctcccttcct ccgaaagagc gagaaggagc tgatgatgtt | |
6748 121 acaaactgtc gccttcgatg ggaaaaagaa atgttgggtt cctgatgaca agaaagctta | |
6749 181 cgttgaagct gaaattacag aaagcagtgg tggcaaagtg actgttgaga caacagatgg | |
6750 241 acggaccatg actataaaag aagatgacgt gcagtcaatg aaccctccca aattcgacat | |
6751 301 gattgaggac atggctatgc tgacccatct gaatgaggca tctgtgttgt acaacctgag | |
6752 361 gaagcgctac agcaactgga tgatttatac ctactcgggc ttgttctgcg tgactataaa | |
6753 421 cccctacaag tggctgcctg tctacaagtc ggaggttgtt gctgcctaca aaggcaagag | |
6754 481 gcgctcagaa gcccctcctc acatcttctc cattgctgat aacgcatacc acgacatgct | |
6755 541 gcgtaatcgg gaaaatcagt caatgctaat cactggagaa tccggtgctg gcaagactgt | |
6756 601 caacacaaaa agggtcatcc agtactttgc cacagtggca gccctgggtg aacctggtaa | |
6757 661 aaagagtcaa cctgctacca aaactggggg aaccttggaa gatcaaatca ttcaagcaaa | |
6758 721 cccagcccta gaagcttttg gaaacgccaa aaccctgaga aatgacaact cctcacgttt | |
6759 781 tggtaaattt atccgaatcc attttggaac cacaggcaag ctgtcatctg ctgacattga | |
6760 841 gatctattta ctggagaaat cccgagtgat ttttcagcaa ccgggtgaga gagactatca | |
6761 901 catcttctac cagatcttat caggaaagaa accagagttg ctggatatgt tattggtctc | |
6762 961 caccaaccca tatgactacc acttttgctc ccaaggagta gttacagtgg acaacttgga | |
6763 1021 tgacggagaa gaactgatgg caacagatca agccatggac attttaggat ttgtgccaga | |
6764 1081 tgagaagtat ggtgcctaca agctcacagg tgccattatg cactttggga acatgaaatt | |
6765 1141 caaacaacga cccagagaag agcaggcaga ggctgatggc actgaaagtg ccgacaaagc | |
6766 1201 tgcctaccta atgggaatca actcctctga tttggttaag ggcttattac accctagagt | |
6767 1261 gaaagttgga aatgagtatg tgaccaaagg tcaaagtgtt gaacaggttt tgtatgctgt | |
6768 1321 tggggcctta tccaaggcag tgtatgatcg aatgttcaag tggctggtgg tccgtatcaa | |
6769 1381 caaaacactg gacactaagc tgccaagaca gttcttcatt ggagtcctgg acattgctgg | |
6770 1441 ctttgaaatc tttgatttca acagctttga gcaactctgc atcaattaca ctaatgagaa | |
6771 1501 actgcaacag tttttcaatc atcacatgtt tgtcctcgag caagaagaat ataaaaaaga | |
6772 1561 aggcattgaa tgggtattta ttgattttgg catggacctg caggcctgta ttgatctaat | |
6773 1621 tgagaagcca ctaggaatcc tgtctatcct tgaagaagaa tgtatgttcc caaaagctac | |
6774 1681 agatatgacg ttcaaagcca aactttacga caaccatctt ggcaagtcac ctaacttgca | |
6775 1741 gaagcccagg cctgataaga aaaggaaata tgaagctcac tttgaactta ttcattatgc | |
6776 1801 tggctcagtt ccctataaca tcattgggtg gcttgagaag aacaaagacc cacttaatga | |
6777 1861 aactgtagta ggtattttcc aaaagtcgtc caacaagctc ctggcaagcc tgtttgaaag | |
6778 1921 ctacgttggt gctgacagtg ctgaccaggg tggagaaaag aaacgcaaga aaggtgcttc | |
6779 1981 ttttcagaca gtgtcctcat tacacaagga aaatttaaat aaactaatga ctaacctaag | |
6780 2041 atctacagcc cctcactttg tacgatgcat tattcccaac gaatcaaaaa caccaggtga | |
6781 2101 aatggatgct ttccttgtct tgcatcagct ccgctgtaat ggtgtcctgg aaggcatccg | |
6782 2161 catttgccgt aagggtttcc caaacagagt gctttatgct gactttaaac aaaggtaccg | |
6783 2221 cattctgaac ccaggtgcaa tcccagagga caagtttgtg gatagcagaa aagctgccga | |
6784 2281 aaaactactg gcatctttag atattgacca taaccaatat cgtttcgggc atactaaggt | |
6785 2341 gttcttcaag gctggtctgt tgggccacct agaagaaatg agggatgaga gacttgcaaa | |
6786 2401 gatcctaaca atgatccagg caagggcacg tggcagactg atgaggatcg agttccagaa | |
6787 2461 gatagtggag cgcagggatg cccttcttgt aattcagtgg aatatccgtg cctttatggc | |
6788 2521 tgtgaagaat tggccctgga tgaagctttt ctttaagatc aaacctcttc tgaagtctgc | |
6789 2581 agaaactgaa aaagagatgg ccaatatgaa ggaagagttc ttgaaattga aggaggccct | |
6790 2641 ggaaaaatct gaagcaagga gaaaggaact tgaagagaaa caagtctctt tagttcagga | |
6791 2701 aaaaaatgat ttgctattgc agctccaagc tgagcaagac actctggcag atgctgagga | |
6792 2761 gcgatgcgac ttgttgatta aatccaagat tcagctggag gccaaagtca aagagctgac | |
6793 2821 agagcgagtt gaggatgagg aagagatgaa ttctgagctg acatccaaaa agagaaaatt | |
6794 2881 ggaagatgaa tgctctgagc tcaagaaaga tattgatgat cttgaaataa cacttgcaaa | |
6795 2941 agtagagaaa gagaagcatg ctactgaaaa taaggtgaaa aatctgacag aagaaatggc | |
6796 3001 gactcttgat gagaacatca gcaaacttac taaggagaag aagtccttgc aggaagctca | |
6797 3061 tcagcaagtt ctggatgacc ttcaagcaga ggaagacaag gtcaacacac tgagcaaagc | |
6798 3121 taaagtgaaa ctggaacagc aagtggatga tcttgagggc tcgcttgagc aagagaagaa | |
6799 3181 agtgaggatg gatctagaaa gagcaaaacg caaactggaa ggagatttga agctgaccca | |
6800 3241 agagagtgtc atggacttgg agaatgataa gttgcaaatg gaagaaaagc tgaaaaagaa | |
6801 3301 agagtttgaa atgagccaat tgaattccaa gatagaagat gaacaagcta ttgtaatgca | |
6802 3361 gctgcagaag aagataaagg aactacaggc tcgtatagaa gagctggaag aggagctgga | |
6803 3421 agcagaaaga gctgctcgag ccaaggtgga aaagcagaga tcagatttgg cccgagagct | |
6804 3481 ggaggtatta agtgagcggc ttgaagaggc tgggggtgcc actgctgccc agctggagat | |
6805 3541 gaacaagaaa cgtgaagctg agttcctgaa gctggcgcgt gacctcgagg aggccacgct | |
6806 3601 gcactatgaa gccacagctg ctgctctgag gaagaagcat gcggacagcg tggctgagat | |
6807 3661 gggggagcag ctggacaacc tgcagcgcgt caagcagaaa ctggaaaagg agaaaagcga | |
6808 3721 gctgaaaatg gaagtggatg atctgacatc caacatggag caaacggtta agggaaaagc | |
6809 3781 aaatgcagaa aaactttgtc gcacttatga agatcatctt aatgagacaa aaactaaact | |
6810 3841 ggatgaaatg actcgcctca tgaatgacct cactactcaa aagacaaaac tccagagtga | |
6811 3901 gaatggtgaa tttgtaagac agcttgaaga gaaagagtcg ctgataagtc agctgtcccg | |
6812 3961 aggaaaaaca tcatttacac agcagattga agaacttagg agacagctag aagaggaaac | |
6813 4021 caagtccaaa aatgctctgg ctcatgccct gcaagcagcc aggcatgact gtgatctctt | |
6814 4081 gcgagaacag tacgaggagg agcaagaagc caaggcagag ctgcagcggg ctctctccaa | |
6815 4141 gggaaatgca gaagtggcac aatggagaac aaagtatgaa actgatgcca ttcagaggac | |
6816 4201 tgaggaactg gaagatgcca aaaaaaagct tgctgcccgc ctgcaagaag ctgaggaagc | |
6817 4261 aattgaagct gccaacgcca agtgctcttc tctggaaaag acaaagcaca ggctgcagaa | |
6818 4321 cgagctggaa gatatgatga ttgatctgga aaaggccaac tcagcggctg cctccctgga | |
6819 4381 caagaagcag cgtggctttg acaagatcat caatgactgg aagcagaagt atgaagagtc | |
6820 4441 acaggctgag ctggaagctt cccagaagga ggcccgcagc ctcagcaccg agctcttcaa | |
6821 4501 gctgaagaat gcctatgaag agacactgga ccatctggag actctgaaac gggaaaacaa | |
6822 4561 gaacctccaa gaggaaattt ctgatctgac caatcagatc agtgaaggaa acaagaacct | |
6823 4621 ccatgagata gaaaaagtca agaagcaggt agaacaagaa aagtcagagg ttcagctagc | |
6824 4681 tctggaagaa gcagagggag ctttggagca tgaagaaagc aagacccttc gttttcagct | |
6825 4741 tgagctttct cagcttaaag ctgattttga aaggaagctg gcagaaaagg atgaagaaat | |
6826 4801 ggaaaatata aggaggaacc aacaacgcac catagattct ctgcagtcca cccttgattc | |
6827 4861 tgaagcccgg agcagaaatg aggccatccg gctgaagaag aagatggaag gagacctcaa | |
6828 4921 cgagatggaa atccagctca gccatgctaa caggcatgct gcagaagcaa ccaagtcagc | |
6829 4981 acgtggcctg cagacacaaa tcaaggagct ccaggtgcag ctggatgact tgggacacct | |
6830 5041 gaatgaagac ttgaaggagc agctggcagt ctctgacagg aggaacaacc ttctccagtc | |
6831 5101 agagctggat gagctgaggg ctttgctgga ccagactgaa cgggcgagga agctggctga | |
6832 5161 gcatgagcta ctggaagcca ccgaacgtgt gaacctgctg catactcaga acacaagcct | |
6833 5221 gatcaatcag aagaagaaac tggagggtga catatcccag atgcagaatg aagtggagga | |
6834 5281 atcaatccag gagtgccgga acgcagagga aaaagccaaa aaagcgatca cagatgcagc | |
6835 5341 aatgatggct gaggagctta aaaaggagca agatactagt gctcacttgg agagaatgaa | |
6836 5401 gaagaacatg gaacaaacca ttaaagatct gcagaaacga ctggatgaag cagaacaaat | |
6837 5461 agccctgaaa ggtggcaaga aacagatcca gaaactggaa tccagggttc gtgagctgga | |
6838 5521 gaatgaactt gagaatgaac tccgccgcaa ttcagatgcc caaaagggag cccgcaagtt | |
6839 5581 tgagaggcgc ataaaggagg tgacttatca gtcagaagaa gataagaaaa atctggcccg | |
6840 5641 aatgcaggat ctgatagata agctacaact aaaagtgaag agctacaaac accaagcaga | |
6841 5701 ggaagccgaa gcacaagcca atctgtacct ttcgaagtac agaaaacagc aacatgatct | |
6842 5761 ggacgatgct gaagaaaggg cagaaatagc tgaatctcaa gttaacaagc tgaggagcaa | |
6843 5821 gtcaagggat attggcatga aaaaggttca tgaagaggag taagtgcggt cctggctccc | |
6844 5881 agatataaga tgatgattca tacaatcagg tataaccaaa agcagatgta ttaaaacaaa | |
6845 5941 actaaaacga gcacttacaa aaataaatat caagtgcaaa ccaaaaaaaa aa | |
6846 // | |
6847 | |
6848 LOCUS NM_001318982 2525 bp mRNA linear VRT 04-JAN-2017 | |
6849 DEFINITION Gallus gallus LOC768735 (LOC768735), mRNA. | |
6850 ACCESSION NM_001318982 XM_001231337 | |
6851 VERSION NM_001318982.1 | |
6852 KEYWORDS RefSeq. | |
6853 SOURCE Gallus gallus (chicken) | |
6854 ORGANISM Gallus gallus | |
6855 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
6856 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
6857 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
6858 Phasianidae; Phasianinae; Gallus. | |
6859 REFERENCE 1 (bases 1 to 2525) | |
6860 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
6861 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
6862 P, Hayashizaki Y and Buerstedde JM. | |
6863 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
6864 gene function analysis | |
6865 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
6866 PUBMED 15642098 | |
6867 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
6868 NCBI review. The reference sequence was derived from AJ720383.1. | |
6869 On Jan 20, 2016 this sequence version replaced gi:971379539. | |
6870 | |
6871 ##Evidence-Data-START## | |
6872 Transcript exon combination :: AJ720383.1, AJ447388.1 [ECO:0000332] | |
6873 RNAseq introns :: single sample supports all introns | |
6874 SAMEA2201358, SAMEA2201361 | |
6875 [ECO:0000348] | |
6876 ##Evidence-Data-END## | |
6877 FEATURES Location/Qualifiers | |
6878 source 1..2525 | |
6879 /organism="Gallus gallus" | |
6880 /mol_type="mRNA" | |
6881 /db_xref="taxon:9031" | |
6882 /chromosome="2" | |
6883 /map="2" | |
6884 /breed="Leghorn" | |
6885 gene 1..2525 | |
6886 /gene="LOC768735" | |
6887 /gene_synonym="CTC-575C13.4; CTD-2561J22.3" | |
6888 /note="LOC768735" | |
6889 /db_xref="CGNC:54710" | |
6890 /db_xref="GeneID:768735" | |
6891 CDS 36..1613 | |
6892 /gene="LOC768735" | |
6893 /gene_synonym="CTC-575C13.4; CTD-2561J22.3" | |
6894 /EC_number="2.7.1.21" | |
6895 /codon_start=1 | |
6896 /product="LOC768735" | |
6897 /protein_id="NP_001305911.1" | |
6898 /db_xref="CGNC:54710" | |
6899 /db_xref="GeneID:768735" | |
6900 /translation="MASHMEEPVTFEDIAIYLSRAEWDMVAEEQRELYRSVMLDNYEL | |
6901 LASLGYPGPKPDILHRLERGEEPWVNTPQSTVKWDGPDRPLGLNGYKRWLAESCSSRW | |
6902 LDADKHKVLEETNPPSHGERCEPWRLRSSRLLKKFGCLEGRSELRSEAASSQPAPEGS | |
6903 QEKARMGCLTRNLETEGKQGIKTELAQSMGNVASCKRLHDNCTDTFQGTVEKPHHVLE | |
6904 EVSVFQANREYRESSTEDVIKTVLEDHCYCVSNALPWTVFSRALREHDYCSNNNSDSS | |
6905 VLRDHEYCQVQRFPYRDRIRKVVCRTCRARARAYRLAKRKSYVERIIWKAKRSVRFLK | |
6906 STFKSLWFPRAFFCTKSLSASPVSSSVPLARADNSTKETCGTFCPPAEQVVVPQQSQK | |
6907 KEDSQEVAVLPQPEKEHSQEETSEAHSAPAAPVESAAAPPAPREAAEVQGEAAQPEVL | |
6908 VHQGMQEAKLIHEADTQQNTERYKIINPSCVLLHDAYEMVVWTVDHMLESVCQAFELG | |
6909 GYTLCKEMRPVITQSDS" | |
6910 ORIGIN | |
6911 1 agagtgtaga ggtttgcgag gccttcacag gcgtcatggc ctcgcacatg gaggagcctg | |
6912 61 tgacctttga ggacatcgcc atctatctga gccgcgcaga gtgggacatg gttgcagagg | |
6913 121 agcagaggga gctgtaccgc agcgtcatgc tggacaacta tgagctcttg gcatcactgg | |
6914 181 gatacccagg ccccaaacct gacattctgc atcggctgga gcgtggggaa gagccatggg | |
6915 241 tcaacacacc acagagcaca gtgaagtggg atggacctga cagacctctt ggactcaatg | |
6916 301 ggtacaagag atggctggca gagtcgtgct ccagcaggtg gctggatgct gacaagcaca | |
6917 361 aggtgctgga ggagacaaac ccccccagcc atggagaacg atgtgagccg tggcggctac | |
6918 421 ggtctagcag actgctgaag aagtttgggt gcctcgaggg taggagtgag ttgcgatcag | |
6919 481 aggcagccag cagccagcca gcgccagagg gaagccaaga gaaggcacgg atgggctgtt | |
6920 541 tgaccaggaa tttagaaacg gaaggtaaac aagggatcaa gacagaatta gcacaaagca | |
6921 601 tgggaaatgt ggcttcttgc aagcgtctgc atgataactg cacagacacc tttcaaggga | |
6922 661 ctgtagaaaa accacatcat gttttagagg aagtaagtgt tttccaggca aacagggaat | |
6923 721 acagggaatc ttctactgag gatgtgatca aaactgttct ggaagaccac tgttactgtg | |
6924 781 tgagtaatgc actgccctgg actgtatttt cacgtgctct gagagaacat gactactgca | |
6925 841 gtaacaataa tagtgattcc tcagtgctca gagaccacga atactgtcag gtacaaaggt | |
6926 901 ttccttatcg ggacagaatc cgtaaagttg tttgccgtac ttgcagggct cgtgccagag | |
6927 961 cttataggct agcaaagcga aaatcctatg tagagcgtat catctggaaa gctaagcgaa | |
6928 1021 gtgtgcgatt tctcaagtcc accttcaaaa gcttgtggtt tcctcgagct ttcttctgca | |
6929 1081 caaaatctct ttctgcatct cctgtgtcgt catctgttcc tctggctagg gcagataact | |
6930 1141 ccacgaagga aacttgtggg acgttttgtc ctcctgcaga gcaggtggtt gtgccccaac | |
6931 1201 agtctcagaa gaaagaagac tcccaagagg tggctgtgct cccacagcct gagaaggagc | |
6932 1261 actctcagga ggagacatca gaagcacaca gtgcccctgc tgcacctgtt gaatcagcag | |
6933 1321 ctgcaccccc agcccccagg gaagctgcag aggtgcaggg ggaagcggca caacctgagg | |
6934 1381 tgcttgtgca ccaagggatg caggaggcaa aattgatcca tgaagctgac actcagcaaa | |
6935 1441 acacagaaag atacaaaatc attaatccaa gttgcgtatt gctgcacgat gcttatgaaa | |
6936 1501 tggtcgtgtg gactgttgat cacatgctgg aatctgtatg ccaggcattt gagcttggtg | |
6937 1561 gctatactct gtgtaaggag atgaggcctg tgattaccca gtctgacagc tgaccaccag | |
6938 1621 aacatgagca gctgtgcctg ctctgtcatg gtgaacagac agaaccctgc agcaagaccc | |
6939 1681 actaatgtgg cttcgcaata gaaactgaaa ggtgtactaa aggatcagtg cgtaaatgga | |
6940 1741 tactaccacg taaatggatg caaaacgtgg cttgtagcac ctgctgggaa aagtgttatc | |
6941 1801 acttgggagg cttcagggaa aagccagagg aagagaacaa gcaggactgg tgcaagtaaa | |
6942 1861 agaggaagaa gcctgggaaa acttataaga gatgggagaa taagggcagc tgtgtgttag | |
6943 1921 caggctgctg tctggtgtac tttctggctc agctgtgtgt gatcactgtg tagtttctcc | |
6944 1981 ttgttaaacc attgccacct gtttgtgtga gcacatgctc acgtgtgtca gcatgcgagc | |
6945 2041 tgtgcttgct tgccagggct ggacctggca gaaagggatc tgaggctgcc gtactcaact | |
6946 2101 ctgcctcagt acaggcactg tgtgtgatgt cctgggctct ccctctcata atttaagcct | |
6947 2161 tttgaacacg ggaattctta agatggaacg atatatattt tttttttaag agactgcaca | |
6948 2221 tctgcctgtt ttgaaagcag gtggggatgt atcacgcaaa gccttgctgc attctaatgt | |
6949 2281 gaaagctatt ggaaaaaaaa tcattgcagt gggaggtgag gttctgatag tgggaaggct | |
6950 2341 gcgaaaagat gctggggctg ccctgtacca gtgcagccac atccagcagc ccggccacac | |
6951 2401 agagtggtag agcccagcaa ctgagatggc ggggcctttt aattggtctt tgttctcact | |
6952 2461 acccaactgt attttcattg gcaataaaat gaacttttcc ccaggttgaa aaaaaaaaaa | |
6953 2521 aaaaa | |
6954 // | |
6955 | |
6956 LOCUS NM_001318432 969 bp mRNA linear VRT 04-JAN-2017 | |
6957 DEFINITION Gallus gallus histamine N-methyltransferase-like (LOC771456), mRNA. | |
6958 ACCESSION NM_001318432 | |
6959 VERSION NM_001318432.1 | |
6960 KEYWORDS RefSeq. | |
6961 SOURCE Gallus gallus (chicken) | |
6962 ORGANISM Gallus gallus | |
6963 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
6964 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
6965 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
6966 Phasianidae; Phasianinae; Gallus. | |
6967 REFERENCE 1 (bases 1 to 969) | |
6968 AUTHORS Drozak J, Chrobok L, Poleszak O, Jagielski AK and Derlacz R. | |
6969 TITLE Molecular identification of carnosine N-methyltransferase as | |
6970 chicken histamine N-methyltransferase-like protein (hnmt-like) | |
6971 JOURNAL PLoS ONE 8 (5), E64805 (2013) | |
6972 PUBMED 23705015 | |
6973 REMARK GeneRIF: carnosine N-methyltransferase was purified from chicken | |
6974 muscle, a rich source of the enzyme, characterized and identified | |
6975 using mass spectrometry analysis. | |
6976 GeneRIF: Chicken histamine N-methyltransferase-like gene encodes | |
6977 carnosine N-methyltransferase that catalyzes the transfer of methyl | |
6978 group of S-adenosyl-L-methionine to carnosine, yielding anserine. | |
6979 Publication Status: Online-Only | |
6980 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
6981 NCBI review. The reference sequence was derived from KF271750.1. | |
6982 | |
6983 ##Evidence-Data-START## | |
6984 Transcript exon combination :: KF271750.1 [ECO:0000332] | |
6985 RNAseq introns :: single sample supports all introns | |
6986 SAMEA2201363, SAMEA2201366 | |
6987 [ECO:0000348] | |
6988 ##Evidence-Data-END## | |
6989 FEATURES Location/Qualifiers | |
6990 source 1..969 | |
6991 /organism="Gallus gallus" | |
6992 /mol_type="mRNA" | |
6993 /db_xref="taxon:9031" | |
6994 /chromosome="7" | |
6995 /map="7" | |
6996 gene 1..969 | |
6997 /gene="LOC771456" | |
6998 /gene_synonym="HNMT-like" | |
6999 /note="histamine N-methyltransferase-like" | |
7000 /db_xref="CGNC:56790" | |
7001 /db_xref="GeneID:771456" | |
7002 CDS 1..969 | |
7003 /gene="LOC771456" | |
7004 /gene_synonym="HNMT-like" | |
7005 /EC_number="2.1.1.22" | |
7006 /function="catalyzes the transfer of methyl group of | |
7007 S-adenosyl-L-methionine to carnosine yielding anserine" | |
7008 /codon_start=1 | |
7009 /product="carnosine N-methyltransferase 2" | |
7010 /protein_id="NP_001305361.1" | |
7011 /db_xref="CGNC:56790" | |
7012 /db_xref="GeneID:771456" | |
7013 /translation="MEPTPEMKRNRLPSMNFEAEILADPHDNSELYVIPSMRSLTAEE | |
7014 YVEAFQSFLDHSTEHQCMDEFNKEVMPHIMAGLGNGKSTINILGVGSGTGEQDLKMIQ | |
7015 ILQAAHPGVLINNEIIEPNPQHVAAYKELVNRAPDLQGVSFTWHQLTSSEYEQQVKEK | |
7016 NTHKKFDFIHMIQMLYRVEDIPNTIKFFHSCLNHQGKLLIIILSDSSGWASLWKKYRH | |
7017 CLPSTDSGHYITSDSITAVLRKLGIKYHVYEFPSGWDITECFIEGDPAGGHMMDFLTG | |
7018 TKNFLGTAPAALRSRLQEALCQPECSSRKDGRVIFCNNLSMIVAES" | |
7019 ORIGIN | |
7020 1 atggagccca cccctgagat gaagaggaat aggttaccca gcatgaactt tgaagcagag | |
7021 61 attctggcag atccacacga taattcagag ctgtatgtca tcccttccat gagaagtctc | |
7022 121 acggctgagg agtatgtaga ggcctttcag tcatttttgg atcactcaac agagcaccag | |
7023 181 tgcatggatg agttcaacaa ggaggtgatg ccacacatca tggctggtct cggcaatgga | |
7024 241 aaatcgacta taaacattct gggagtgggg agcggcacag gtgaacagga tctgaaaatg | |
7025 301 atccagatcc tgcaggctgc acacccaggg gtccttatca acaacgaaat catagagccc | |
7026 361 aacccacagc acgtggccgc ctacaaagag ctggttaatc gagctccaga tctgcagggg | |
7027 421 gtctctttta cttggcacca gcttacttcc tcagagtatg aacaacaggt gaaagagaaa | |
7028 481 aacacacaca agaagttcga cttcatccat atgattcaga tgctgtaccg tgtggaagat | |
7029 541 attcctaaca ccatcaagtt tttccacagc tgcctcaacc atcagggcaa actcctgatc | |
7030 601 ataattctgt cagacagcag cggttgggcc agcttatgga agaagtacag gcattgcttg | |
7031 661 ccttcaaccg acagcggcca ctacatcacc tccgacagca tcacggcagt gctgaggaag | |
7032 721 ctcggcatca agtaccacgt ttatgagttc ccatcgggct gggacatcac cgagtgcttt | |
7033 781 attgaggggg acccagccgg aggccatatg atggatttcc tgacggggac aaaaaacttc | |
7034 841 ctgggcacag caccggcagc tctgcggagc cgtctgcagg aggctctctg ccagcccgaa | |
7035 901 tgcagcagca ggaaggacgg gagagtcatt ttctgcaaca atctcagtat gatcgtagcg | |
7036 961 gaatcctaa | |
7037 // | |
7038 | |
7039 LOCUS NM_001317736 2344 bp mRNA linear VRT 04-JAN-2017 | |
7040 DEFINITION Gallus gallus transmembrane protein 136 family member 1 | |
7041 (TMEM136-1), mRNA. | |
7042 ACCESSION NM_001317736 XM_417891 | |
7043 VERSION NM_001317736.1 | |
7044 KEYWORDS RefSeq. | |
7045 SOURCE Gallus gallus (chicken) | |
7046 ORGANISM Gallus gallus | |
7047 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
7048 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
7049 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
7050 Phasianidae; Phasianinae; Gallus. | |
7051 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
7052 preliminary review. The reference sequence was derived from | |
7053 AADN04000115.1. | |
7054 On Dec 5, 2015 this sequence version replaced gi:513222209. | |
7055 | |
7056 Sequence Note: The RefSeq transcript and protein were derived from | |
7057 genomic sequence to make the sequence consistent with the reference | |
7058 genome assembly. The genomic coordinates used for the transcript | |
7059 record were based on alignments. | |
7060 | |
7061 ##Evidence-Data-START## | |
7062 Transcript exon combination :: BM440371.1 [ECO:0000332] | |
7063 RNAseq introns :: single sample supports all introns | |
7064 SAMN02738216, SAMN02738218 | |
7065 [ECO:0000348] | |
7066 ##Evidence-Data-END## | |
7067 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
7068 1-73 AADN04000115.1 1471604-1471676 c | |
7069 74-273 AADN04000115.1 1471314-1471513 c | |
7070 274-2344 AADN04000115.1 1468686-1470756 c | |
7071 FEATURES Location/Qualifiers | |
7072 source 1..2344 | |
7073 /organism="Gallus gallus" | |
7074 /mol_type="mRNA" | |
7075 /db_xref="taxon:9031" | |
7076 /chromosome="24" | |
7077 /map="24" | |
7078 /breed="Red Jungle Fowl" | |
7079 gene 1..2344 | |
7080 /gene="TMEM136-1" | |
7081 /gene_synonym="null; TMEM136" | |
7082 /note="transmembrane protein 136 family member 1" | |
7083 /db_xref="CGNC:66350" | |
7084 /db_xref="GeneID:419753" | |
7085 misc_feature 27..29 | |
7086 /gene="TMEM136-1" | |
7087 /gene_synonym="null; TMEM136" | |
7088 /note="upstream in-frame stop codon" | |
7089 CDS 78..812 | |
7090 /gene="TMEM136-1" | |
7091 /gene_synonym="null; TMEM136" | |
7092 /codon_start=1 | |
7093 /product="transmembrane protein 136 family member 1" | |
7094 /protein_id="NP_001304665.1" | |
7095 /db_xref="CGNC:66350" | |
7096 /db_xref="GeneID:419753" | |
7097 /translation="MLPIALEVLGSLLAWLCLYAAFCLWNRHRSPEWNCRLVTLLHGA | |
7098 TATCLSGYIALWDGPWPLSHAGSPNTALQVHVLSLTLGYFIFDLLWCLYFQTEGDLML | |
7099 LHHTLSICGMVLVLGLGKSATEVNAVVFVSEITNPLLQTRWFLREMGCYHSFLGEVVD | |
7100 FCFVLLFLVLRIGGGALIMYAMVTAPDPNWILKGGGLAMYIVSLGFMVEICRFVRRKM | |
7101 LKKYHSWRRLRSEDAPVKTNGHLAAH" | |
7102 ORIGIN | |
7103 1 aagaagggcg tatggggaag cggtgctgag aggagccggc tgcgttcagc cccgcgctgt | |
7104 61 gctcgtgggg aggcaggatg ctccccatcg ccctcgaggt gctcggcagc ctcctggcct | |
7105 121 ggctgtgcct ctatgctgct ttctgcctct ggaacaggca ccgctccccc gagtggaact | |
7106 181 gccgcctggt caccctgctg cacggggcca ccgccacctg cctgtccggg tacatcgccc | |
7107 241 tctgggacgg cccctggcct ctgagccatg caggttcacc aaacaccgct ctccaggtcc | |
7108 301 acgtgctgtc cctgacgttg ggttacttca tcttcgacct gctctggtgc ttgtacttcc | |
7109 361 agacagaggg agacctgatg ctgctccatc acacgctgag catctgcggc atggtgctgg | |
7110 421 tgctggggct gggcaagtct gccaccgagg tcaacgcggt ggtgtttgtc agtgagatca | |
7111 481 ccaaccctct gctgcagacc cgctggttcc tgcgggagat gggctgctac cactccttcc | |
7112 541 tgggggaggt ggtggatttc tgcttcgtgc tcctcttcct ggtgctgcgc attggcggag | |
7113 601 gagctctgat catgtacgcc atggtgacgg ccccggatcc caactggatc ctcaaggggg | |
7114 661 gaggcctggc catgtacatc gtgtccttgg ggttcatggt tgagatctgc cgcttcgtta | |
7115 721 ggaggaagat gttgaaaaag taccattcct ggaggcgcct gaggagtgag gatgcacccg | |
7116 781 tgaaaacaaa tgggcacttg gcagctcact gacggtggct gctgtggatg gggccccggc | |
7117 841 tgctggagcc tgtaactgtg acaagagctc ctaaaagtgg tgtggaaatg acatcctggc | |
7118 901 actggcagct ctctacaagc cctggggaag atggatggtc actcagcatg tgggaaagct | |
7119 961 gaccaaatag ggatttcagc ataggagcat agcgtgtctg ctgagcggct gtccctgact | |
7120 1021 gctccctctt ccagcccata gtgcacagcc tgactgatcc atgatcgtgt tggaggcagt | |
7121 1081 gttatctcac agtgcagttg gaatatctga tctggaacat ctcaccctct ccccagtgga | |
7122 1141 gccaggtgtg ggtgtgaccc agccaggatg tactcagcgt tgttctccct tcaaatggga | |
7123 1201 caaaacattg gaccaagtac atgaatgaga ctttgtgagc aaggctgaag tgcccacagg | |
7124 1261 gggacagcgg ggttgtcctt ggtgtgaagt gatgctgctg tggtacgtga gggtgaggca | |
7125 1321 atgttctacc tcattgtttt tagcaataca tttccttcct tttaatactt gcattcaagg | |
7126 1381 agatactgat cttggagcag tgtgacttca ctgggttgga cagtgcacac ctctgttcct | |
7127 1441 tacaaacagg agtctggaac cagacctgtg ctgaacacct cctcacagag cgcatcacct | |
7128 1501 caccttgcac tgctttcaga aactcgggtg ctgtgtgtgt gagggctgac agagcagaac | |
7129 1561 cctctctgga tgctctgtct gtcccggagc tgacttgctg caggccagga atgctgaatg | |
7130 1621 caatgcagac aggagcctgg tgttcatttc caggggtggc agcgatgttg aggtggatct | |
7131 1681 cagtgcgaca tcactccata cagttctcag catatggatc agttctcttc tttacctctc | |
7132 1741 agaattgtgt tctgactttc ccctggggtc gtaatgtgaa tttcccttca ctcatgtagc | |
7133 1801 agcatcctgc tggagctcga gagcccccgg agctcctggt ggcctttgcc ccacgtgtca | |
7134 1861 ctgctgtggg gtgcaggagg ggagtggctg tgtcacccct ctgcccttat cttgccagct | |
7135 1921 gggctctact cagcactgat acctgggctg cgaggtgtct ggagagataa aagctaatag | |
7136 1981 catgaatgga ctgagctttt aggtgtgtcc tctggatgcc acgcagaccc caggcatgca | |
7137 2041 gcaggtctat ggggtcgggc agatggagcc tggcaatcct ggggggaggg cacttcggag | |
7138 2101 ccatgggttg ctgtcagagc tccccatagt gagcagactt ccaataaagg tgcattctca | |
7139 2161 ttttaaaagg gaacagttgc tgtagcattc ttttgttctg ggtctgaagg aggcagctgg | |
7140 2221 agctaacgag gctgggccgg atggggcagc ccggtctggt ggtcggaacc ccgctgtacc | |
7141 2281 ccagttgttc catgcagaac accccttccc acagggctgg gaagcaatgt gccctcgggt | |
7142 2341 ggtc | |
7143 // | |
7144 | |
7145 LOCUS NM_001305110 1304 bp mRNA linear VRT 04-JAN-2017 | |
7146 DEFINITION Gallus gallus ethylmalonyl-CoA decarboxylase 1 (ECHDC1), transcript | |
7147 variant 2, mRNA. | |
7148 ACCESSION NM_001305110 XM_004940252 | |
7149 VERSION NM_001305110.1 | |
7150 KEYWORDS RefSeq. | |
7151 SOURCE Gallus gallus (chicken) | |
7152 ORGANISM Gallus gallus | |
7153 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
7154 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
7155 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
7156 Phasianidae; Phasianinae; Gallus. | |
7157 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
7158 preliminary review. The reference sequence was derived from | |
7159 BU369494.1, BX929701.2 and AADN04000375.1. | |
7160 On Feb 25, 2015 this sequence version replaced gi:513177299. | |
7161 | |
7162 Transcript Variant: This variant (2) uses an alternate splice site | |
7163 in its 5' UTR compared to variant 1. Variants 1 and 2 encode the | |
7164 same protein. | |
7165 | |
7166 Sequence Note: This RefSeq record was created from transcript data | |
7167 from different strains because no single transcript from the same | |
7168 strain was available for the full length of the gene. The extent of | |
7169 this transcript is supported by transcript alignments and | |
7170 orthologous data. | |
7171 | |
7172 ##Evidence-Data-START## | |
7173 Transcript exon combination :: BU369494.1, BX929701.2 [ECO:0000332] | |
7174 RNAseq introns :: single sample supports all introns | |
7175 SAMN02729317, SAMN03354467 | |
7176 [ECO:0000348] | |
7177 ##Evidence-Data-END## | |
7178 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
7179 1-7 BU369494.1 1-7 | |
7180 8-1233 BX929701.2 1-1226 | |
7181 1234-1304 AADN04000375.1 1027885-1027955 c | |
7182 FEATURES Location/Qualifiers | |
7183 source 1..1304 | |
7184 /organism="Gallus gallus" | |
7185 /mol_type="mRNA" | |
7186 /db_xref="taxon:9031" | |
7187 /chromosome="3" | |
7188 /map="3" | |
7189 /breed="Leghorn" | |
7190 gene 1..1304 | |
7191 /gene="ECHDC1" | |
7192 /gene_synonym="MMCD" | |
7193 /note="ethylmalonyl-CoA decarboxylase 1" | |
7194 /db_xref="CGNC:54924" | |
7195 /db_xref="GeneID:769021" | |
7196 CDS 67..969 | |
7197 /gene="ECHDC1" | |
7198 /gene_synonym="MMCD" | |
7199 /EC_number="4.1.1.41" | |
7200 /EC_number="4.1.1.94" | |
7201 /note="isoform 1 is encoded by transcript variant 2; enoyl | |
7202 Coenzyme A hydratase domain containing 1; | |
7203 methylmalonyl-CoA decarboxylase; enoyl CoA hydratase | |
7204 domain containing 1" | |
7205 /codon_start=1 | |
7206 /product="ethylmalonyl-CoA decarboxylase isoform 1" | |
7207 /protein_id="NP_001292039.1" | |
7208 /db_xref="CGNC:54924" | |
7209 /db_xref="GeneID:769021" | |
7210 /translation="MAVFLWRNLFQTTKARMLQQRRASLYNGAHDYDEELIKKKLQQF | |
7211 AGGSISLSKEHSGIGILTLNNSRLMNAFTGTMMLELQERVTELENWKDGKGLIICGAG | |
7212 NTFCSGSDLNAVKAISNSQDGMNMCMFMQNTLTRLMRLPLISIALIQGKALGGGAELT | |
7213 TACDFRLMTPGSEIRFVHKHMGLVPGWGGATRLVRIIGSRAALQLLSRAHGVDPERAL | |
7214 HLGLSEGTLSSSDETGSLEEARAWLSQYTEGPASVIQAVKKVVTAGRELPLEAALRTE | |
7215 KDVFGTVWGGPANLEALTRRQKHK" | |
7216 mat_peptide 67..960 | |
7217 /gene="ECHDC1" | |
7218 /gene_synonym="MMCD" | |
7219 /product="Ethylmalonyl-CoA decarboxylase" | |
7220 /experiment="experimental evidence, no additional details | |
7221 recorded" | |
7222 /note="propagated from UniProtKB/Swiss-Prot (F1NB38.2)" | |
7223 ORIGIN | |
7224 1 cccgctcgtc cggcagaggg aggggagccg tgctgtggtg agccgtgcct tggtttcttt | |
7225 61 ccagaaatgg cagttttcct atggagaaac ttgtttcaga ctacaaaggc aaggatgcta | |
7226 121 cagcagagaa gggcatcgct gtataatggt gctcatgact atgatgaaga attgataaag | |
7227 181 aagaaacttc agcagtttgc tggtggatcc atcagccttt ccaaagaaca cagtggcatt | |
7228 241 ggaatactta ccttgaacaa ctcccgacta atgaatgcct tcacaggtac tatgatgcta | |
7229 301 gaactccagg agagagtaac tgaactggaa aactggaagg atggcaaagg ccttatcatc | |
7230 361 tgtggtgcag gaaacacttt ttgttcagga tctgatttga atgctgtcaa agcaatatcc | |
7231 421 aattcccagg atgggatgaa tatgtgcatg tttatgcaaa ataccttaac cagactcatg | |
7232 481 aggttgccat tgatcagcat tgcactaatc caaggaaaag ctcttggagg aggagcggaa | |
7233 541 cttaccacag catgtgattt caggttgatg acgccaggca gtgagattcg atttgtccat | |
7234 601 aagcacatgg gcctggtgcc aggctgggga ggagccacca ggctggtgcg aatcattggc | |
7235 661 agtagagctg ccctccagct gctgagcagg gctcatgggg tggaccctga gagagcactg | |
7236 721 catctcggac tgtcagaggg gaccttgtct tcttcagatg aaaccggatc gctagaagaa | |
7237 781 gctcgagcct ggctgagtca gtacacagag ggtccagcta gtgtgataca ggctgtgaaa | |
7238 841 aaggtggtca cggctggaag agaactgcca ctggaagctg ccctaaggac agagaaggat | |
7239 901 gtttttggaa ctgtgtgggg tgggcctgcc aatttggagg cactgactag aagacaaaag | |
7240 961 cataaataat ggccaataca taataaatat tcttgatatt ttacacacga agctttcaca | |
7241 1021 aaagcagaca atagattgaa tcgtttaatg ccagtttaaa ggagcaagtt cttagcattc | |
7242 1081 ctgtcgttca cgtctggcag acttatttgg tgtgcaacca cagagtaatc cccagaagat | |
7243 1141 cctttactgt tctaatcacc cactgaatgg agattagtga aattcgtatg taaaggtaaa | |
7244 1201 tactgggctt agaacagaat ataattattt tgcaatgagg ctgaagatta ttttctttgg | |
7245 1261 aataattttg ttttttctaa ctgatataga aatgaattgt gtga | |
7246 // | |
7247 | |
7248 LOCUS NM_001305109 1308 bp mRNA linear VRT 04-JAN-2017 | |
7249 DEFINITION Gallus gallus ethylmalonyl-CoA decarboxylase 1 (ECHDC1), transcript | |
7250 variant 1, mRNA. | |
7251 ACCESSION NM_001305109 XM_001231582 | |
7252 VERSION NM_001305109.1 | |
7253 KEYWORDS RefSeq. | |
7254 SOURCE Gallus gallus (chicken) | |
7255 ORGANISM Gallus gallus | |
7256 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
7257 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
7258 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
7259 Phasianidae; Phasianinae; Gallus. | |
7260 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
7261 preliminary review. The reference sequence was derived from | |
7262 BU369494.1, BX929701.2, CD761561.1 and AADN04000375.1. | |
7263 On Feb 24, 2015 this sequence version replaced gi:513177293. | |
7264 | |
7265 Transcript Variant: This variant (1) represents the longest | |
7266 transcript. Variants 1 and 2 encode the same protein. | |
7267 | |
7268 Sequence Note: This RefSeq record was created from transcript data | |
7269 from different strains because no single transcript from the same | |
7270 strain was available for the full length of the gene. The extent of | |
7271 this transcript is supported by transcript alignments and | |
7272 orthologous data. | |
7273 | |
7274 ##Evidence-Data-START## | |
7275 Transcript exon combination :: CD761561.1 [ECO:0000332] | |
7276 RNAseq introns :: single sample supports all introns | |
7277 SAMEA2201361, SAMEA2201363 | |
7278 [ECO:0000348] | |
7279 ##Evidence-Data-END## | |
7280 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
7281 1-7 BU369494.1 1-7 | |
7282 8-52 BX929701.2 1-45 | |
7283 53-61 CD761561.1 11-19 | |
7284 62-1237 BX929701.2 51-1226 | |
7285 1238-1308 AADN04000375.1 1027885-1027955 c | |
7286 FEATURES Location/Qualifiers | |
7287 source 1..1308 | |
7288 /organism="Gallus gallus" | |
7289 /mol_type="mRNA" | |
7290 /db_xref="taxon:9031" | |
7291 /chromosome="3" | |
7292 /map="3" | |
7293 /breed="Leghorn" | |
7294 gene 1..1308 | |
7295 /gene="ECHDC1" | |
7296 /gene_synonym="MMCD" | |
7297 /note="ethylmalonyl-CoA decarboxylase 1" | |
7298 /db_xref="CGNC:54924" | |
7299 /db_xref="GeneID:769021" | |
7300 CDS 71..973 | |
7301 /gene="ECHDC1" | |
7302 /gene_synonym="MMCD" | |
7303 /EC_number="4.1.1.41" | |
7304 /EC_number="4.1.1.94" | |
7305 /note="isoform 1 is encoded by transcript variant 1; enoyl | |
7306 Coenzyme A hydratase domain containing 1; | |
7307 methylmalonyl-CoA decarboxylase; enoyl CoA hydratase | |
7308 domain containing 1" | |
7309 /codon_start=1 | |
7310 /product="ethylmalonyl-CoA decarboxylase isoform 1" | |
7311 /protein_id="NP_001292038.1" | |
7312 /db_xref="CGNC:54924" | |
7313 /db_xref="GeneID:769021" | |
7314 /translation="MAVFLWRNLFQTTKARMLQQRRASLYNGAHDYDEELIKKKLQQF | |
7315 AGGSISLSKEHSGIGILTLNNSRLMNAFTGTMMLELQERVTELENWKDGKGLIICGAG | |
7316 NTFCSGSDLNAVKAISNSQDGMNMCMFMQNTLTRLMRLPLISIALIQGKALGGGAELT | |
7317 TACDFRLMTPGSEIRFVHKHMGLVPGWGGATRLVRIIGSRAALQLLSRAHGVDPERAL | |
7318 HLGLSEGTLSSSDETGSLEEARAWLSQYTEGPASVIQAVKKVVTAGRELPLEAALRTE | |
7319 KDVFGTVWGGPANLEALTRRQKHK" | |
7320 mat_peptide 71..964 | |
7321 /gene="ECHDC1" | |
7322 /gene_synonym="MMCD" | |
7323 /product="Ethylmalonyl-CoA decarboxylase" | |
7324 /experiment="experimental evidence, no additional details | |
7325 recorded" | |
7326 /note="propagated from UniProtKB/Swiss-Prot (F1NB38.2)" | |
7327 ORIGIN | |
7328 1 cccgctcgtc cggcagaggg aggggagccg tgctgtggtg agccgtgcct tgggcagttt | |
7329 61 ctttccagaa atggcagttt tcctatggag aaacttgttt cagactacaa aggcaaggat | |
7330 121 gctacagcag agaagggcat cgctgtataa tggtgctcat gactatgatg aagaattgat | |
7331 181 aaagaagaaa cttcagcagt ttgctggtgg atccatcagc ctttccaaag aacacagtgg | |
7332 241 cattggaata cttaccttga acaactcccg actaatgaat gccttcacag gtactatgat | |
7333 301 gctagaactc caggagagag taactgaact ggaaaactgg aaggatggca aaggccttat | |
7334 361 catctgtggt gcaggaaaca ctttttgttc aggatctgat ttgaatgctg tcaaagcaat | |
7335 421 atccaattcc caggatggga tgaatatgtg catgtttatg caaaatacct taaccagact | |
7336 481 catgaggttg ccattgatca gcattgcact aatccaagga aaagctcttg gaggaggagc | |
7337 541 ggaacttacc acagcatgtg atttcaggtt gatgacgcca ggcagtgaga ttcgatttgt | |
7338 601 ccataagcac atgggcctgg tgccaggctg gggaggagcc accaggctgg tgcgaatcat | |
7339 661 tggcagtaga gctgccctcc agctgctgag cagggctcat ggggtggacc ctgagagagc | |
7340 721 actgcatctc ggactgtcag aggggacctt gtcttcttca gatgaaaccg gatcgctaga | |
7341 781 agaagctcga gcctggctga gtcagtacac agagggtcca gctagtgtga tacaggctgt | |
7342 841 gaaaaaggtg gtcacggctg gaagagaact gccactggaa gctgccctaa ggacagagaa | |
7343 901 ggatgttttt ggaactgtgt ggggtgggcc tgccaatttg gaggcactga ctagaagaca | |
7344 961 aaagcataaa taatggccaa tacataataa atattcttga tattttacac acgaagcttt | |
7345 1021 cacaaaagca gacaatagat tgaatcgttt aatgccagtt taaaggagca agttcttagc | |
7346 1081 attcctgtcg ttcacgtctg gcagacttat ttggtgtgca accacagagt aatccccaga | |
7347 1141 agatccttta ctgttctaat cacccactga atggagatta gtgaaattcg tatgtaaagg | |
7348 1201 taaatactgg gcttagaaca gaatataatt attttgcaat gaggctgaag attattttct | |
7349 1261 ttggaataat tttgtttttt ctaactgata tagaaatgaa ttgtgtga | |
7350 // | |
7351 | |
7352 LOCUS NM_001305111 1075 bp mRNA linear VRT 04-JAN-2017 | |
7353 DEFINITION Gallus gallus ethylmalonyl-CoA decarboxylase 1 (ECHDC1), transcript | |
7354 variant 3, mRNA. | |
7355 ACCESSION NM_001305111 XM_004940254 | |
7356 VERSION NM_001305111.1 | |
7357 KEYWORDS RefSeq. | |
7358 SOURCE Gallus gallus (chicken) | |
7359 ORGANISM Gallus gallus | |
7360 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
7361 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
7362 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
7363 Phasianidae; Phasianinae; Gallus. | |
7364 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
7365 preliminary review. The reference sequence was derived from | |
7366 BU369494.1, BX929701.2, BU129201.1 and AADN04000375.1. | |
7367 On Feb 24, 2015 this sequence version replaced gi:513177305. | |
7368 | |
7369 Transcript Variant: This variant (3) lacks an alternate exon in the | |
7370 5' UTR and coding region and uses a downstream start codon compared | |
7371 to variant 1. It encodes isoform 2 which has a shorter N-terminus | |
7372 compared to isoform 1. | |
7373 | |
7374 Sequence Note: This RefSeq record was created from transcript data | |
7375 from different strains because no single transcript from the same | |
7376 strain was available for the full length of the gene. The extent of | |
7377 this transcript is supported by transcript alignments and | |
7378 orthologous data. | |
7379 | |
7380 ##Evidence-Data-START## | |
7381 Transcript exon combination :: BU129201.1 [ECO:0000332] | |
7382 RNAseq introns :: single sample supports all introns | |
7383 SAMN02729316, SAMN03354478 | |
7384 [ECO:0000348] | |
7385 ##Evidence-Data-END## | |
7386 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
7387 1-7 BU369494.1 1-7 | |
7388 8-53 BX929701.2 1-46 | |
7389 54-151 BU129201.1 21-118 | |
7390 152-1004 BX929701.2 374-1226 | |
7391 1005-1075 AADN04000375.1 1027885-1027955 c | |
7392 FEATURES Location/Qualifiers | |
7393 source 1..1075 | |
7394 /organism="Gallus gallus" | |
7395 /mol_type="mRNA" | |
7396 /db_xref="taxon:9031" | |
7397 /chromosome="3" | |
7398 /map="3" | |
7399 /breed="Leghorn" | |
7400 gene 1..1075 | |
7401 /gene="ECHDC1" | |
7402 /gene_synonym="MMCD" | |
7403 /note="ethylmalonyl-CoA decarboxylase 1" | |
7404 /db_xref="CGNC:54924" | |
7405 /db_xref="GeneID:769021" | |
7406 misc_feature 39..41 | |
7407 /gene="ECHDC1" | |
7408 /gene_synonym="MMCD" | |
7409 /note="upstream in-frame stop codon" | |
7410 CDS 63..740 | |
7411 /gene="ECHDC1" | |
7412 /gene_synonym="MMCD" | |
7413 /EC_number="4.1.1.41" | |
7414 /EC_number="4.1.1.94" | |
7415 /note="isoform 2 is encoded by transcript variant 3; enoyl | |
7416 Coenzyme A hydratase domain containing 1; | |
7417 methylmalonyl-CoA decarboxylase; enoyl CoA hydratase | |
7418 domain containing 1" | |
7419 /codon_start=1 | |
7420 /product="ethylmalonyl-CoA decarboxylase isoform 2" | |
7421 /protein_id="NP_001292040.1" | |
7422 /db_xref="CGNC:54924" | |
7423 /db_xref="GeneID:769021" | |
7424 /translation="MMLELQERVTELENWKDGKGLIICGAGNTFCSGSDLNAVKAISN | |
7425 SQDGMNMCMFMQNTLTRLMRLPLISIALIQGKALGGGAELTTACDFRLMTPGSEIRFV | |
7426 HKHMGLVPGWGGATRLVRIIGSRAALQLLSRAHGVDPERALHLGLSEGTLSSSDETGS | |
7427 LEEARAWLSQYTEGPASVIQAVKKVVTAGRELPLEAALRTEKDVFGTVWGGPANLEAL | |
7428 TRRQKHK" | |
7429 ORIGIN | |
7430 1 cccgctcgtc cggcagaggg aggggagccg tgctgtggtg agccgtgcct tgggcaggta | |
7431 61 ctatgatgct agaactccag gagagagtaa ctgaactgga aaactggaag gatggcaaag | |
7432 121 gccttatcat ctgtggtgca ggaaacactt tttgttcagg atctgatttg aatgctgtca | |
7433 181 aagcaatatc caattcccag gatgggatga atatgtgcat gtttatgcaa aataccttaa | |
7434 241 ccagactcat gaggttgcca ttgatcagca ttgcactaat ccaaggaaaa gctcttggag | |
7435 301 gaggagcgga acttaccaca gcatgtgatt tcaggttgat gacgccaggc agtgagattc | |
7436 361 gatttgtcca taagcacatg ggcctggtgc caggctgggg aggagccacc aggctggtgc | |
7437 421 gaatcattgg cagtagagct gccctccagc tgctgagcag ggctcatggg gtggaccctg | |
7438 481 agagagcact gcatctcgga ctgtcagagg ggaccttgtc ttcttcagat gaaaccggat | |
7439 541 cgctagaaga agctcgagcc tggctgagtc agtacacaga gggtccagct agtgtgatac | |
7440 601 aggctgtgaa aaaggtggtc acggctggaa gagaactgcc actggaagct gccctaagga | |
7441 661 cagagaagga tgtttttgga actgtgtggg gtgggcctgc caatttggag gcactgacta | |
7442 721 gaagacaaaa gcataaataa tggccaatac ataataaata ttcttgatat tttacacacg | |
7443 781 aagctttcac aaaagcagac aatagattga atcgtttaat gccagtttaa aggagcaagt | |
7444 841 tcttagcatt cctgtcgttc acgtctggca gacttatttg gtgtgcaacc acagagtaat | |
7445 901 ccccagaaga tcctttactg ttctaatcac ccactgaatg gagattagtg aaattcgtat | |
7446 961 gtaaaggtaa atactgggct tagaacagaa tataattatt ttgcaatgag gctgaagatt | |
7447 1021 attttctttg gaataatttt gttttttcta actgatatag aaatgaattg tgtga | |
7448 // | |
7449 | |
7450 LOCUS NM_001305112 932 bp mRNA linear VRT 04-JAN-2017 | |
7451 DEFINITION Gallus gallus ethylmalonyl-CoA decarboxylase 1 (ECHDC1), transcript | |
7452 variant 4, mRNA. | |
7453 ACCESSION NM_001305112 | |
7454 VERSION NM_001305112.1 | |
7455 KEYWORDS RefSeq. | |
7456 SOURCE Gallus gallus (chicken) | |
7457 ORGANISM Gallus gallus | |
7458 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
7459 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
7460 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
7461 Phasianidae; Phasianinae; Gallus. | |
7462 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
7463 preliminary review. The reference sequence was derived from | |
7464 BU369494.1, BX929701.2, BU383248.1 and AADN04000375.1. | |
7465 | |
7466 Transcript Variant: This variant (4) lacks two consecutive | |
7467 alternate exons in the 5' UTR and coding region and uses a | |
7468 downstream start codon compared to variant 1. It encodes isoform 3 | |
7469 which has a significantly shorter N-terminus compared to isoform 1. | |
7470 | |
7471 Sequence Note: This RefSeq record was created from transcript data | |
7472 from different strains because no single transcript from the same | |
7473 strain was available for the full length of the gene. The extent of | |
7474 this transcript is supported by transcript alignments and | |
7475 orthologous data. | |
7476 | |
7477 ##Evidence-Data-START## | |
7478 Transcript exon combination :: BU383248.1 [ECO:0000332] | |
7479 RNAseq introns :: single sample supports all introns | |
7480 SAMEA2201357, SAMEA3109051 | |
7481 [ECO:0000348] | |
7482 ##Evidence-Data-END## | |
7483 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
7484 1-7 BU369494.1 1-7 | |
7485 8-52 BX929701.2 1-45 | |
7486 53-651 BU383248.1 24-622 | |
7487 652-861 BX929701.2 1017-1226 | |
7488 862-932 AADN04000375.1 1027885-1027955 c | |
7489 FEATURES Location/Qualifiers | |
7490 source 1..932 | |
7491 /organism="Gallus gallus" | |
7492 /mol_type="mRNA" | |
7493 /db_xref="taxon:9031" | |
7494 /chromosome="3" | |
7495 /map="3" | |
7496 /breed="Leghorn" | |
7497 gene 1..932 | |
7498 /gene="ECHDC1" | |
7499 /gene_synonym="MMCD" | |
7500 /note="ethylmalonyl-CoA decarboxylase 1" | |
7501 /db_xref="CGNC:54924" | |
7502 /db_xref="GeneID:769021" | |
7503 CDS 64..597 | |
7504 /gene="ECHDC1" | |
7505 /gene_synonym="MMCD" | |
7506 /EC_number="4.1.1.41" | |
7507 /EC_number="4.1.1.94" | |
7508 /note="isoform 3 is encoded by transcript variant 4; enoyl | |
7509 Coenzyme A hydratase domain containing 1; | |
7510 methylmalonyl-CoA decarboxylase; enoyl CoA hydratase | |
7511 domain containing 1" | |
7512 /codon_start=1 | |
7513 /product="ethylmalonyl-CoA decarboxylase isoform 3" | |
7514 /protein_id="NP_001292041.1" | |
7515 /db_xref="CGNC:54924" | |
7516 /db_xref="GeneID:769021" | |
7517 /translation="MNMCMFMQNTLTRLMRLPLISIALIQGKALGGGAELTTACDFRL | |
7518 MTPGSEIRFVHKHMGLVPGWGGATRLVRIIGSRAALQLLSRAHGVDPERALHLGLSEG | |
7519 TLSSSDETGSLEEARAWLSQYTEGPASVIQAVKKVVTAGRELPLEAALRTEKDVFGTV | |
7520 WGGPANLEALTRRQKHK" | |
7521 ORIGIN | |
7522 1 cccgctcgtc cggcagaggg aggggagccg tgctgtggtg agccgtgcct tgggcaggat | |
7523 61 gggatgaata tgtgcatgtt tatgcaaaat accttaacca gactcatgag gttgccattg | |
7524 121 atcagcattg cactaatcca aggaaaagct cttggaggag gagcggaact taccacagca | |
7525 181 tgtgatttca ggttgatgac gccaggcagt gagattcgat ttgtccataa gcacatgggc | |
7526 241 ctggtgccag gctggggagg agccaccagg ctggtgcgaa tcattggcag tagagctgcc | |
7527 301 ctccagctgc tgagcagggc tcatggggtg gaccctgaga gagcactgca tctcggactg | |
7528 361 tcagagggga ccttgtcttc ttcagatgaa accggatcgc tagaagaagc tcgagcctgg | |
7529 421 ctgagtcagt acacagaggg tccagctagt gtgatacagg ctgtgaaaaa ggtggtcacg | |
7530 481 gctggaagag aactgccact ggaagctgcc ctaaggacag agaaggatgt ttttggaact | |
7531 541 gtgtggggtg ggcctgccaa tttggaggca ctgactagaa gacaaaagca taaataatgg | |
7532 601 ccaatacata ataaatattc ttgatatttt acacacgaag ctttcacaaa agcagacaat | |
7533 661 agattgaatc gtttaatgcc agtttaaagg agcaagttct tagcattcct gtcgttcacg | |
7534 721 tctggcagac ttatttggtg tgcaaccaca gagtaatccc cagaagatcc tttactgttc | |
7535 781 taatcaccca ctgaatggag attagtgaaa ttcgtatgta aaggtaaata ctgggcttag | |
7536 841 aacagaatat aattattttg caatgaggct gaagattatt ttctttggaa taattttgtt | |
7537 901 ttttctaact gatatagaaa tgaattgtgt ga | |
7538 // | |
7539 | |
7540 LOCUS NM_001305089 3510 bp mRNA linear VRT 04-JAN-2017 | |
7541 DEFINITION Gallus gallus minichromosome maintenance 9 homologous recombination | |
7542 repair factor (MCM9), mRNA. | |
7543 ACCESSION NM_001305089 XM_003641032 | |
7544 VERSION NM_001305089.1 | |
7545 KEYWORDS RefSeq. | |
7546 SOURCE Gallus gallus (chicken) | |
7547 ORGANISM Gallus gallus | |
7548 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
7549 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
7550 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
7551 Phasianidae; Phasianinae; Gallus. | |
7552 REFERENCE 1 (bases 1 to 3510) | |
7553 AUTHORS Nishimura K, Ishiai M, Horikawa K, Fukagawa T, Takata M, Takisawa H | |
7554 and Kanemaki MT. | |
7555 TITLE Mcm8 and Mcm9 form a complex that functions in homologous | |
7556 recombination repair induced by DNA interstrand crosslinks | |
7557 JOURNAL Mol. Cell 47 (4), 511-522 (2012) | |
7558 PUBMED 22771115 | |
7559 REFERENCE 2 (bases 1 to 3510) | |
7560 CONSRTM International Chicken Genome Sequencing Consortium | |
7561 TITLE Sequence and comparative analysis of the chicken genome provide | |
7562 unique perspectives on vertebrate evolution | |
7563 JOURNAL Nature 432 (7018), 695-716 (2004) | |
7564 PUBMED 15592404 | |
7565 REMARK Erratum:[Nature. 2005 Feb 17;433(7027):777] | |
7566 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
7567 preliminary review. The reference sequence was derived from | |
7568 AB689141.1. | |
7569 On Feb 21, 2015 this sequence version replaced gi:513177436. | |
7570 | |
7571 ##Evidence-Data-START## | |
7572 Transcript exon combination :: AB689141.1 [ECO:0000332] | |
7573 RNAseq introns :: single sample supports all introns | |
7574 SAMEA2201363, SAMEA2201366 | |
7575 [ECO:0000348] | |
7576 ##Evidence-Data-END## | |
7577 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
7578 1-3510 AB689141.1 1-3510 | |
7579 FEATURES Location/Qualifiers | |
7580 source 1..3510 | |
7581 /organism="Gallus gallus" | |
7582 /mol_type="mRNA" | |
7583 /db_xref="taxon:9031" | |
7584 /chromosome="3" | |
7585 /map="3" | |
7586 gene 1..3510 | |
7587 /gene="MCM9" | |
7588 /note="minichromosome maintenance 9 homologous | |
7589 recombination repair factor" | |
7590 /db_xref="CGNC:66117" | |
7591 /db_xref="GeneID:100857742" | |
7592 CDS 1..3510 | |
7593 /gene="MCM9" | |
7594 /EC_number="3.6.4.12" | |
7595 /note="DNA replication licensing factor MCM9; | |
7596 minichromosome maintenance complex component 9" | |
7597 /codon_start=1 | |
7598 /product="DNA helicase MCM9" | |
7599 /protein_id="NP_001292018.1" | |
7600 /db_xref="CGNC:66117" | |
7601 /db_xref="GeneID:100857742" | |
7602 /translation="MALRADQVSLIGQVFESYLLQHHRDDILGILRQGDDEAHYPVLV | |
7603 DALTLFETNMEIGEYFNAFPSQVLPIFDGALRRAAMAVLQAATPSPELRMKPNLHARI | |
7604 SGLPICPELTREHIPKTRDVGHFLSVTGTVIRTSLVKVLEFERSYICNKCKHVFVAKA | |
7605 DFEQYYAFCRPSACLNEEGCNSTKFTCLSGTSSSPTSCRDYQEIKIQEQVQRLSVGSI | |
7606 PRCMVVVLEDDLVDSCKSGDDITVYGVVMQRWKPFHQDARCDLELVLKANYVKVNNEQ | |
7607 LAGVTIDEEVRKEFEDFWEKHRNNPLAGRNEILASLCPQVFGLYLVKLAVAMVLAGGV | |
7608 QRIDATGTRIRGESHLLLVGDPGTGKSQFLKYAVKITPRSVLTAGIGSTSAGLTVTAV | |
7609 KDFGEWNLEAGALVLADGGLCCIDEFNSIKEHDRTSIHEAMEQQTISVAKAGLVCKLN | |
7610 TRTTILAATNPKGHYDPAESVSVNIALGSPLLSRFDLVLVLLDTKNEEWDRIISSFIL | |
7611 QNKGCPSKSEKLWSMEKMKTYFCLIKRIQPKLSDESNLILVRYYQMQRQSDCRNAART | |
7612 TIRLLESLIRLAEAHARLMFRDTVTLEDAVTVVSVMESSMQGGALLGAINALHTSFPE | |
7613 NPMTQYRMQCELILERLELHDLLHKELQRLDRLQKETYCQLQPEETSFSTTTGCLNKN | |
7614 TFESKQQSQSEPSDQQKINSYPQPSLPKSNCEGDKHPEALRNPTPGNNISTKRLSRLN | |
7615 KRSDDGSLGWFDRLEDRNTDAEETFWKTSPLPKTSPDNMALKTMSKSSCSEEGNSSVP | |
7616 RKEDGMRGSLRTVTLCAPLEQDKVSEISSKRTEERKCFSSEANIQDPTSASASVQESV | |
7617 ITQRVSKSLQRLHTEKSHRFFTSTQNSEANALPSVLPVSGLLDLSSDTDSVVGDENNS | |
7618 ASAAVKHAVISMRKRSKGQAEKEAKAVSSHEPEITDGESPPAAKLAKFSFRPRTKLDD | |
7619 SSEKKNAEFPLFPSENTVKPGEQPQGEQLQKDCCPPEKRKMTLTCLGRKGLEKQSIGS | |
7620 KGNEEQLSQALGKEMGGNAQIHSDVTLDVVSPPHTEKRREGEEKLGGPSTVRVCSSTL | |
7621 ENLSKFCFASRPDSKSEAPPTIKTDTNNKESHSPLLKVHVSNPNKRKSFALGNASKDS | |
7622 VVTRKSLFSIAELDDATLDFDWD" | |
7623 ORIGIN | |
7624 1 atggcgctgc gcgccgacca ggtgagcctc atcgggcagg tgttcgagtc ctacctgctg | |
7625 61 cagcaccacc gggacgacat cctcggcatc ctgcgccagg gggacgacga ggcgcactat | |
7626 121 ccggtcctcg tcgacgccct gacgctgttc gagaccaaca tggagatcgg ggagtacttc | |
7627 181 aacgccttcc ccagccaggt gctgcccatc tttgacggtg cgctacgccg ggcggccatg | |
7628 241 gcggtgctgc aggccgccac gccatcccca gagctccgca tgaagccaaa cctccatgcc | |
7629 301 aggatttcag gtttgcccat ttgcccagag ctgactcgag agcacattcc taagaccagg | |
7630 361 gatgtgggtc acttcttgtc tgtcactggg actgtcatcc gtaccagtct ggtgaaagtg | |
7631 421 ctggaatttg agcggagcta catctgcaat aagtgcaaac acgtatttgt ggctaaggct | |
7632 481 gactttgagc agtactatgc tttctgccgt ccatcagcct gcctgaatga agagggctgc | |
7633 541 aactcaacca agttcacttg cctctctgga acatcctcct cccctaccag ctgcagagac | |
7634 601 tatcaggaaa tcaaaattca ggagcaggtt caaagactgt ctgtcggaag catccctcgt | |
7635 661 tgcatggtgg ttgttctgga agatgactta gtggacagtt gcaaatctgg agatgacatc | |
7636 721 acagtgtatg gagtggtaat gcagagatgg aaacctttcc atcaggatgc acgctgtgac | |
7637 781 ttggagcttg ttttgaaagc caactacgtt aaagtaaata acgagcagct agcaggtgtt | |
7638 841 acaattgatg aagaggtccg caaggaattt gaagacttct gggaaaagca tagaaataat | |
7639 901 cccttagcag ggaggaatga aattttggct agtttatgcc ctcaagtgtt tggattgtac | |
7640 961 ctggtgaagt tggctgtagc catggtgctt gctggtggtg tgcagaggat tgatgctact | |
7641 1021 ggaactcgaa tcagaggtga atcgcatctt ctgttagttg gagacccagg aacggggaaa | |
7642 1081 tctcagtttc tcaagtatgc agtaaagatt acaccgcggt ctgtgcttac tgcaggaatt | |
7643 1141 ggatctacaa gtgcaggttt gacagtgact gctgtgaagg actttgggga gtggaacttg | |
7644 1201 gaagctggag cactggtgct tgcagatgga ggcctttgtt gcattgatga gttcaatagc | |
7645 1261 atcaaagaac atgacagaac cagtatccat gaagcaatgg agcaacaaac catcagtgta | |
7646 1321 gcaaaagcag gcttggtatg taagcttaat acaaggacaa ccatactggc agcaacaaac | |
7647 1381 cccaaaggcc attatgaccc tgctgagtct gtctctgtca acatagctct tggcagtccc | |
7648 1441 ctgctgagca gatttgacct ggtcttagtg ttattagata caaagaatga ggagtgggac | |
7649 1501 cgtatcattt catctttcat cttgcaaaat aaaggttgcc ctagcaaatc agaaaagctg | |
7650 1561 tggagcatgg aaaagatgaa aacctacttc tgccttataa aaaggataca gccaaaattg | |
7651 1621 tctgatgaga gcaacctgat cctcgtacgc tattatcaaa tgcagcgtca gagtgactgc | |
7652 1681 aggaatgctg cccgaactac cattcgcttg ttggagagtt tgatacgcct tgcagaagct | |
7653 1741 catgcccgct tgatgtttag ggataccgtg actttggaag atgctgtaac tgtggtatcg | |
7654 1801 gtgatggaat cttctatgca gggaggtgca cttcttggag ccatcaatgc cttacacacc | |
7655 1861 tctttcccag aaaacccaat gacacagtac cgaatgcagt gtgaactcat actggagcga | |
7656 1921 ctggagctgc atgatcttct gcacaaagag ctacaaagac ttgacagatt acaaaaggaa | |
7657 1981 acttactgcc aattacagcc tgaagagaca agtttcagta ctactacagg atgcttgaac | |
7658 2041 aaaaatacat ttgagtcaaa gcaacagtct cagtcagaac cttcagatca acaaaagatt | |
7659 2101 aactcctatc cacagccttc tttgcccaaa agcaattgtg aaggggataa acacccagaa | |
7660 2161 gccttacgca acccaacgcc tggtaataac ataagtacaa aacgcttgag tagacttaac | |
7661 2221 aagagaagtg atgatggcag cctgggatgg tttgacagac tggaagacag aaacactgat | |
7662 2281 gctgaagaaa ctttttggaa gacatctcca ttgcccaaga catctccaga taatatggct | |
7663 2341 ttaaaaacca tgtctaagtc ctcctgttca gaggaaggaa attcttcagt cccgaggaag | |
7664 2401 gaagatggaa tgagagggtc actaagaact gttactctgt gtgctccttt ggagcaagac | |
7665 2461 aaagtttctg agataagcag caaaaggact gaggagcgca aatgtttttc ttcagaagca | |
7666 2521 aacattcaag acccaacatc agcaagtgcc agtgtgcagg agtcagttat tacacaacgg | |
7667 2581 gtttctaaaa gcctgcagag gctgcacaca gagaaatcac atagattctt tacaagtaca | |
7668 2641 cagaactctg aagcaaatgc tcttccctca gtattacctg tatcagggct gctggatctt | |
7669 2701 tcaagtgata cagactcagt agttggagat gaaaataata gtgcatctgc agcagtaaaa | |
7670 2761 catgcagtaa tttccatgag aaaacgaagt aaaggtcaag cagagaagga agcaaaggca | |
7671 2821 gtaagttccc atgagccaga aattactgac ggtgaaagtc ctccagcagc taaactagct | |
7672 2881 aaattttctt tcagaccaag gacaaaactt gatgattctt ctgagaagaa aaacgcagaa | |
7673 2941 tttccccttt ttccaagtga aaatactgtt aagccgggag agcagcccca gggagagcag | |
7674 3001 ctgcaaaaag attgctgccc acctgagaaa cgcaagatga cactgacttg cttaggaaga | |
7675 3061 aagggtttgg aaaagcaatc cattggtagt aaagggaatg aagagcaact gagtcaggcc | |
7676 3121 ttagggaaag agatgggagg aaatgcacag atacattctg atgtcaccct tgatgttgtg | |
7677 3181 tcacctccac acactgaaaa aagaagggag ggagaggaga aacttggtgg tccaagcaca | |
7678 3241 gtgagggtgt gctccagcac attagaaaac ctctccaagt tctgctttgc gtcacgtcct | |
7679 3301 gactcaaaat cagaagcgcc accaactatc aagactgaca ctaacaacaa ggaaagccac | |
7680 3361 agcccattgc tgaaggtgca tgtgagcaat cctaataaaa ggaagagttt tgcattggga | |
7681 3421 aatgcaagta aagacagtgt ggtcacccga aaatctctct tctcaatagc agagctggat | |
7682 3481 gatgctacat tagattttga ctgggattaa | |
7683 // | |
7684 | |
7685 LOCUS NM_205501 1578 bp mRNA linear VRT 04-JAN-2017 | |
7686 DEFINITION Gallus gallus argininosuccinate lyase 1 (ASL1), mRNA. | |
7687 ACCESSION NM_205501 | |
7688 VERSION NM_205501.2 | |
7689 KEYWORDS RefSeq. | |
7690 SOURCE Gallus gallus (chicken) | |
7691 ORGANISM Gallus gallus | |
7692 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
7693 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
7694 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
7695 Phasianidae; Phasianinae; Gallus. | |
7696 REFERENCE 1 (bases 1 to 1578) | |
7697 AUTHORS Inoue M, Shiina T, Aizawa S, Sakata I, Takagi H and Sakai T. | |
7698 TITLE Detailed analysis of the delta-crystallin mRNA-expressing region in | |
7699 early development of the chick pituitary gland | |
7700 JOURNAL J. Mol. Histol. 43 (3), 273-280 (2012) | |
7701 PUBMED 22461196 | |
7702 REMARK GeneRIF: Embryonic chick pituitary gland consists of two different | |
7703 regions where delta-crystallin and Lhx3 are expressed. | |
7704 REFERENCE 2 (bases 1 to 1578) | |
7705 AUTHORS Sampaleanu LM, Vallee F, Slingsby C and Howell PL. | |
7706 TITLE Structural studies of duck delta 1 and delta 2 crystallin suggest | |
7707 conformational changes occur during catalysis | |
7708 JOURNAL Biochemistry 40 (9), 2732-2742 (2001) | |
7709 PUBMED 11258884 | |
7710 REFERENCE 3 (bases 1 to 1578) | |
7711 AUTHORS Nickerson,J.M., Wawrousek,E.F., Borras,T., Hawkins,J.W., | |
7712 Norman,B.L., Filpula,D.R., Nagle,J.W., Ally,A.H. and Piatigorsky,J. | |
7713 TITLE Sequence of the chicken delta 2 crystallin gene and its intergenic | |
7714 spacer. Extreme homology with the delta 1 crystallin gene | |
7715 JOURNAL J. Biol. Chem. 261 (2), 552-557 (1986) | |
7716 PUBMED 3941090 | |
7717 REFERENCE 4 (bases 1 to 1578) | |
7718 AUTHORS Nickerson,J.M., Wawrousek,E.F., Hawkins,J.W., Wakil,A.S., | |
7719 Wistow,G.J., Thomas,G., Norman,B.L. and Piatigorsky,J. | |
7720 TITLE The complete sequence of the chicken delta 1 crystallin gene and | |
7721 its 5' flanking region | |
7722 JOURNAL J. Biol. Chem. 260 (16), 9100-9105 (1985) | |
7723 PUBMED 3839507 | |
7724 REFERENCE 5 (bases 1 to 1578) | |
7725 AUTHORS Ohno,M., Sakamoto,H., Yasuda,K., Okada,T.S. and Shimura,Y. | |
7726 TITLE Nucleotide sequence of a chicken delta-crystallin gene | |
7727 JOURNAL Nucleic Acids Res. 13 (5), 1593-1606 (1985) | |
7728 PUBMED 2987831 | |
7729 REFERENCE 6 (bases 1 to 1578) | |
7730 AUTHORS Borras,T., Nickerson,J.M., Chepelinsky,A.B. and Piatigorsky,J. | |
7731 TITLE Structural and functional evidence for differential promoter | |
7732 activity of the two linked delta-crystallin genes in the chicken | |
7733 JOURNAL EMBO J. 4 (2), 445-452 (1985) | |
7734 PUBMED 4018032 | |
7735 REFERENCE 7 (bases 1 to 1578) | |
7736 AUTHORS Yasuda,K., Nakajima,N., Isobe,T., Okada,T.S. and Shimura,Y. | |
7737 TITLE The nucleotide sequence of a complete chicken delta-crystallin cDNA | |
7738 JOURNAL EMBO J. 3 (6), 1397-1402 (1984) | |
7739 PUBMED 6547670 | |
7740 REFERENCE 8 (bases 1 to 1578) | |
7741 AUTHORS Nickerson,J.M. and Piatigorsky,J. | |
7742 TITLE Sequence of a complete chicken delta-crystallin cDNA | |
7743 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 81 (9), 2611-2615 (1984) | |
7744 PUBMED 6585817 | |
7745 REFERENCE 9 (bases 1 to 1578) | |
7746 AUTHORS Nickerson,J.M. and Piatigorsky,J. | |
7747 TITLE The nucleic acid and deduced protein sequence of cDNA clones for | |
7748 delta-crystallin of the chicken lens | |
7749 JOURNAL FEBS Lett. 144 (2), 289-292 (1982) | |
7750 PUBMED 7117543 | |
7751 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
7752 preliminary review. The reference sequence was derived from | |
7753 AADN04000065.1. | |
7754 On Feb 21, 2015 this sequence version replaced gi:45382826. | |
7755 | |
7756 Sequence Note: The RefSeq transcript and protein were derived from | |
7757 genomic sequence to make the sequence consistent with the reference | |
7758 genome assembly. The genomic coordinates used for the transcript | |
7759 record were based on alignments. | |
7760 | |
7761 ##Evidence-Data-START## | |
7762 Transcript exon combination :: J00843.1, X00626.1 [ECO:0000332] | |
7763 RNAseq introns :: single sample supports all introns | |
7764 SAMEA3109051 [ECO:0000348] | |
7765 ##Evidence-Data-END## | |
7766 COMPLETENESS: complete on the 3' end. | |
7767 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
7768 1-35 AADN04000065.1 3864098-3864132 c | |
7769 36-98 AADN04000065.1 3863924-3863986 c | |
7770 99-293 AADN04000065.1 3862590-3862784 c | |
7771 294-377 AADN04000065.1 3861590-3861673 c | |
7772 378-434 AADN04000065.1 3861182-3861238 c | |
7773 435-532 AADN04000065.1 3860819-3860916 c | |
7774 533-610 AADN04000065.1 3860391-3860468 c | |
7775 611-688 AADN04000065.1 3860003-3860080 c | |
7776 689-741 AADN04000065.1 3859806-3859858 c | |
7777 742-804 AADN04000065.1 3859427-3859489 c | |
7778 805-919 AADN04000065.1 3859094-3859208 c | |
7779 920-1004 AADN04000065.1 3858427-3858511 c | |
7780 1005-1064 AADN04000065.1 3858188-3858247 c | |
7781 1065-1148 AADN04000065.1 3857931-3858014 c | |
7782 1149-1229 AADN04000065.1 3857592-3857672 c | |
7783 1230-1336 AADN04000065.1 3857113-3857219 c | |
7784 1337-1578 AADN04000065.1 3856377-3856618 c | |
7785 FEATURES Location/Qualifiers | |
7786 source 1..1578 | |
7787 /organism="Gallus gallus" | |
7788 /mol_type="mRNA" | |
7789 /db_xref="taxon:9031" | |
7790 /chromosome="19" | |
7791 /map="19" | |
7792 /breed="Red Jungle Fowl" | |
7793 gene 1..1578 | |
7794 /gene="ASL1" | |
7795 /gene_synonym="ASL; CRYD1; D-CRY" | |
7796 /note="argininosuccinate lyase 1" | |
7797 /db_xref="CGNC:49838" | |
7798 /db_xref="GeneID:396498" | |
7799 misc_feature 21..23 | |
7800 /gene="ASL1" | |
7801 /gene_synonym="ASL; CRYD1; D-CRY" | |
7802 /note="upstream in-frame stop codon" | |
7803 CDS 87..1487 | |
7804 /gene="ASL1" | |
7805 /gene_synonym="ASL; CRYD1; D-CRY" | |
7806 /EC_number="4.3.2.1" | |
7807 /note="delta1-crystallin; delta-crystallin 1; delta | |
7808 crystallin I" | |
7809 /codon_start=1 | |
7810 /product="delta-1 crystallin" | |
7811 /protein_id="NP_990832.2" | |
7812 /db_xref="CGNC:49838" | |
7813 /db_xref="GeneID:396498" | |
7814 /translation="MATEGDKLLGGRFVGSTDPIMEILSSSISTEQRLTEVDIQASMA | |
7815 YAKALEKASILTKTELEKILSGLEKISEESSKGVLVMTQSDEDIQTAIERRLKELIGD | |
7816 IAGKLQTGRSRNEQVVTDLKLLLKSSISVISTHLLQLIKTLVERAAIEIDIIMPGYTH | |
7817 LQKALPIRWSQFLLSHAVALTRDSERLGEVKKRITVLPLGSGALAGNPLEIDRELLRS | |
7818 ELDMTSITLNSIDAISERDFVVELISVATLLMIHLSKLAEDLIIFSTTEFGFVTLSDA | |
7819 YSTGSSLLPQKKNPDSLELIRSKAGRVFGRLAAILMVLKGIPSTFSKDLQEDKEAVLD | |
7820 VVDTLTAVLQVATGVISTLQVNKENMEKALTPELLSTDLALYLVRKGMPIRQAQTASG | |
7821 KAVHLAETKGITINNLTLEDLKSISPLFASDVSQVFSVVNSVEQYTAVGGTAKSSVTA | |
7822 QIEQLRELLKKQKEQA" | |
7823 ORIGIN | |
7824 1 acggagcgac cagccagggc tgagctgcgg agacggttgc accaggtgcc aggattgctg | |
7825 61 caaacacgag caaaacgtcg tccgaaatgg caaccgaggg ggataaactt ttgggaggaa | |
7826 121 gatttgttgg aagcacagat cccatcatgg agattctcag ctcttctata tccactgagc | |
7827 181 agagactgac tgaagttgat atccaggcaa gcatggctta tgccaaagcc ttggagaagg | |
7828 241 ctagcatcct gactaaaact gagctggaga agatcctgag tggcctggaa aagatctctg | |
7829 301 aggaatcatc taagggagtc cttgtaatga cccaaagtga tgaagatatc cagactgcca | |
7830 361 ttgaacgcag actgaaggag ctgattgggg atatagctgg aaagctgcag actggaagaa | |
7831 421 gcaggaatga acaggttgtg actgatctga aactgctcct gaagagttcc atctctgtca | |
7832 481 tctccactca cctgctgcag ctcatcaaga ccctggtgga gcgcgctgct atagaaattg | |
7833 541 atattatcat gcctggctac acccacctgc agaaagctct gcccatcaga tggagccagt | |
7834 601 tcctgctcag ccatgctgtt gcactgaccc gtgattctga gcgcctggga gaggtgaaga | |
7835 661 aaaggatcac tgtcttgcct ctgggaagtg gtgctctggc tggcaaccca ctggaaattg | |
7836 721 atagagagct tctgcgtagc gaactggaca tgacttccat caccctgaac agcatagacg | |
7837 781 ccatcagtga gagagacttt gtggtggaat taatctctgt tgccaccctg ctgatgatcc | |
7838 841 accttagcaa gctggctgaa gatctcatca tcttcagcac cactgaattt ggctttgtga | |
7839 901 ccctctctga tgcctacagc actggcagca gcctgttgcc tcagaagaag aaccctgata | |
7840 961 gcctggaact gatccgcagc aaagctggtc gtgtgtttgg acggttggct gctattctca | |
7841 1021 tggttctcaa aggaattcca agcaccttca gcaaggatct gcaggaggac aaggaagctg | |
7842 1081 tccttgatgt tgtggacact ctgactgctg tgctccaggt tgccactgga gtgatttcta | |
7843 1141 ccctccaggt caacaaggag aacatggaga aggctctgac ccctgagttg ctgtctactg | |
7844 1201 atctggctct ctacttggtt cgtaaaggaa tgccaatcag acaagcccaa actgcttctg | |
7845 1261 ggaaggccgt ccaccttgct gagactaaag gcatcaccat caataatctc accctggagg | |
7846 1321 acctgaagag catcagcccc ctgtttgcca gcgatgtctc ccaggtcttc agcgttgtca | |
7847 1381 acagtgtgga gcagtacact gccgtgggcg gtactgccaa gagcagcgtg actgcccaga | |
7848 1441 tcgagcagct gagggagctg ctgaagaagc agaaggagca ggcttagagt gtggggacat | |
7849 1501 atcccgtggc tgcagcgttg tgcttatcac actaatccag agttaataaa cactgtggtg | |
7850 1561 tattgtagtt cactgaaa | |
7851 // | |
7852 | |
7853 LOCUS NM_001293169 3363 bp mRNA linear VRT 04-JAN-2017 | |
7854 DEFINITION Gallus gallus minichromosome maintenance 8 homologous recombination | |
7855 repair factor (MCM8), mRNA. | |
7856 ACCESSION NM_001293169 XM_004935291 | |
7857 VERSION NM_001293169.1 | |
7858 KEYWORDS RefSeq. | |
7859 SOURCE Gallus gallus (chicken) | |
7860 ORGANISM Gallus gallus | |
7861 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
7862 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
7863 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
7864 Phasianidae; Phasianinae; Gallus. | |
7865 REFERENCE 1 (bases 1 to 3363) | |
7866 AUTHORS Nishimura K, Ishiai M, Horikawa K, Fukagawa T, Takata M, Takisawa H | |
7867 and Kanemaki MT. | |
7868 TITLE Mcm8 and Mcm9 form a complex that functions in homologous | |
7869 recombination repair induced by DNA interstrand crosslinks | |
7870 JOURNAL Mol. Cell 47 (4), 511-522 (2012) | |
7871 PUBMED 22771115 | |
7872 REFERENCE 2 (bases 1 to 3363) | |
7873 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
7874 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
7875 P, Hayashizaki Y and Buerstedde JM. | |
7876 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
7877 gene function analysis | |
7878 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
7879 PUBMED 15642098 | |
7880 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
7881 preliminary review. The reference sequence was derived from | |
7882 AADN04000139.1 and AB689140.1. | |
7883 On Jun 3, 2014 this sequence version replaced gi:513174765. | |
7884 | |
7885 Sequence Note: This RefSeq record was created from transcript and | |
7886 genomic sequence data to make the sequence consistent with the | |
7887 reference genome assembly. The genomic coordinates used for the | |
7888 transcript record were based on transcript alignments. | |
7889 | |
7890 ##Evidence-Data-START## | |
7891 Transcript exon combination :: AB689140.1 [ECO:0000332] | |
7892 RNAseq introns :: single sample supports all introns | |
7893 SAMEA2201357, SAMEA2201361 | |
7894 [ECO:0000348] | |
7895 ##Evidence-Data-END## | |
7896 COMPLETENESS: complete on the 3' end. | |
7897 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
7898 1-121 AADN04000139.1 15673630-15673750 c | |
7899 122-2614 AB689140.1 1-2493 | |
7900 2615-3363 AADN04000139.1 15658574-15659322 c | |
7901 FEATURES Location/Qualifiers | |
7902 source 1..3363 | |
7903 /organism="Gallus gallus" | |
7904 /mol_type="mRNA" | |
7905 /db_xref="taxon:9031" | |
7906 /chromosome="3" | |
7907 /map="3" | |
7908 /breed="Red Jungle Fowl" | |
7909 gene 1..3363 | |
7910 /gene="MCM8" | |
7911 /note="minichromosome maintenance 8 homologous | |
7912 recombination repair factor" | |
7913 /db_xref="CGNC:6990" | |
7914 /db_xref="GeneID:421314" | |
7915 misc_feature 77..79 | |
7916 /gene="MCM8" | |
7917 /note="upstream in-frame stop codon" | |
7918 CDS 122..2614 | |
7919 /gene="MCM8" | |
7920 /EC_number="3.6.4.12" | |
7921 /note="MCM8 minichromosome maintenance deficient 8; DNA | |
7922 replication licensing factor MCM8; minichromosome | |
7923 maintenance complex component 8" | |
7924 /codon_start=1 | |
7925 /product="DNA helicase MCM8" | |
7926 /protein_id="NP_001280098.1" | |
7927 /db_xref="CGNC:6990" | |
7928 /db_xref="GeneID:421314" | |
7929 /translation="MSRDLRGRGCPRGRGFQGWRGGWRGGWRGGWRGGWRGRTQKVEW | |
7930 KRAPEPASSRLVQSTLDQFIPYKGWKLYFSEAYADKSPFVQKTQAFEKFFMQRIELYD | |
7931 KDEIERKGSILVDYKELIEDRELTKSIPNISTELRDMPQKILQCMGLAIHQVLTKDLE | |
7932 RHAAELQVQEGLPLDGEPIINVPLIHARLYNYEPLTQLKNVRANCYGKYIALRGTVVR | |
7933 VSNIKPLCTKLAFVCGTCGDVQSVPLPDGKYTLPTKCLVPECRGRSFTPDRSSPLTAT | |
7934 VDWQSVKVQELMSDDQREAGRIPRTIECELVQDLVDSCVPGDVVTITGVVKVSSTEEG | |
7935 ASKNKNDKCVFLLYIEANSVSNSKGQKTKNFEEETFQRSFMEFSLKDLYAVQEIQAEE | |
7936 NLFRIIVNSLCPAIYGHEIVKAGLALALFGGCQKFVDDKNRIPVRGDPHVLIVGDPGL | |
7937 GKSQMLQAVCNVAPRGVYVCGNTSTSSGLTVTLSRDGASGDFALEAGALVLGDQGICG | |
7938 IDEFDKMGSQHQALLEAMEQQSISLAKAGIVCSLPARTSIVAAANPVGGHYNKAKTVS | |
7939 ENLKMGSALLSRFDLVFILLDTPNEDHDHLLSEHVMAIRAGKQAVCSSAVVSRTNVQD | |
7940 RSVLEVVSDRPLLERLKISPGENFDAIPHQLLRKYVGYARQYVHPHLSPEAAQVLQEF | |
7941 YLELRKQNQGASSTPITTRQLESLIRLTEARSRLELREKCTKEDAEDVIEIMKYSMLG | |
7942 TYSDEFGKLDFERSQHGSGMSNRSQAKRFVSALSSIAERTYSNLFDLQQLRQVAKELQ | |
7943 IRVFDFESFIESLNDQGYLLKKGSRLYQLQTM" | |
7944 ORIGIN | |
7945 1 gtttctcgcc tgcatcagag tgtgtgggca gcctcgcgcc ctacagagtc cccagcgatt | |
7946 61 tttgttaact ttgttctgat gcgttccgat ctcctctact ccgtctggcg ccgcggctga | |
7947 121 gatgagcagg gacctcaggg gcagggggtg cccccgggga cggggcttcc agggctggcg | |
7948 181 aggaggctgg cggggaggct ggcggggagg ctggcgagga ggctggcggg gaaggacgca | |
7949 241 aaaggtggag tggaagagag cgcctgagcc tgcaagttct cgactcgttc agtcaacact | |
7950 301 ggaccagttt attccgtata agggctggaa gctttatttc tctgaagctt atgctgacaa | |
7951 361 gtcacctttt gtccagaaga cacaagcctt tgaaaaattt tttatgcaac gcattgaact | |
7952 421 ttatgataag gatgaaatag aaagaaaggg aagcatcctt gtggattata aggaactgat | |
7953 481 agaagataga gaattaacca aatcaatacc aaatatatct acggagttac gggatatgcc | |
7954 541 tcagaaaata ctgcagtgca tgggtctggc aattcatcag gtgctaacca aggaccttga | |
7955 601 aaggcatgct gcagagctgc aggtgcagga agggttacca ctggatggag agcctataat | |
7956 661 aaatgttcct ctcattcatg ccagactgta caactatgag ccactaactc agctgaaaaa | |
7957 721 tgttcgggcc aactgttatg ggaaatacat tgccttgcgt ggcactgttg tacgtgtcag | |
7958 781 taacattaag cctctgtgca ctaagctagc ctttgtgtgt ggcacgtgtg gagatgttca | |
7959 841 gagtgttcct ctgcctgatg gaaagtacac tcttccaacg aagtgccttg ttcctgagtg | |
7960 901 ccgtggccgg tcattcacac ctgacaggag ctctccttta actgctacag tggattggca | |
7961 961 gtctgttaag gttcaggagc tcatgtcgga tgatcagcga gaagcaggcc gcatccctcg | |
7962 1021 cacgattgaa tgtgagctgg ttcaagatct tgtggacagt tgtgtcccag gagatgtggt | |
7963 1081 cacaattaca ggggtggtta aggtgtccag cactgaggaa ggagcatcta aaaataagaa | |
7964 1141 cgacaagtgt gtgttcttgt tgtacattga ggcaaattct gtcagcaaca gtaaaggaca | |
7965 1201 aaaaacaaag aattttgagg aggagacttt tcaacgatcc ttcatggaat tttcacttaa | |
7966 1261 ggacctctac gctgttcaag aaattcaagc tgaggaaaat ctcttcagga ttattgtgaa | |
7967 1321 ctctctttgt cctgcaatct acggccacga gattgtaaag gcaggcttgg ccctggcctt | |
7968 1381 gtttggcggg tgtcagaagt ttgtcgatga caagaacaga atcccagtgc gaggagatcc | |
7969 1441 acatgttctc attgttggag atccaggatt aggaaaaagt caaatgttgc aagcagtgtg | |
7970 1501 taacgttgct cctcgaggtg tgtatgtttg tggtaatact tccaccagct ctggcctgac | |
7971 1561 tgttacgctg tctagagatg gtgcttctgg agattttgcc ttggaagctg gtgctttagt | |
7972 1621 gcttggagat caaggtattt gtggaataga tgaatttgat aagatgggaa gccagcatca | |
7973 1681 ggctttgctg gaagccatgg aacaacaaag tatcagcctt gccaaggctg gtattgtttg | |
7974 1741 cagtttgcca gcccgaacat ctattgttgc tgcagcaaac ccagttggag ggcattataa | |
7975 1801 caaagccaaa acagtgtctg agaacttaaa aatggggagt gctttactgt caagatttga | |
7976 1861 cttagttttt attttgctgg acaccccaaa tgaagatcat gatcatttgc tgtcagagca | |
7977 1921 cgtgatggca atccgagctg ggaagcaggc agtgtgcagc agtgcagttg tgagccgtac | |
7978 1981 caacgtgcag gatcgctctg ttcttgaagt cgtttcagat cggcccctgc ttgaaagact | |
7979 2041 aaagatctca ccaggagaaa actttgatgc cattccacat cagctgctga ggaagtacgt | |
7980 2101 cggctatgct cggcagtacg ttcacccaca tttatctcca gaagctgctc aggtccttca | |
7981 2161 ggagttctat ctggagcttc ggaagcagaa ccagggagca agcagcacac caatcaccac | |
7982 2221 gaggcagctg gagtcgctga ttcgactcac ggaggcacga tcaaggctgg aattaaggga | |
7983 2281 gaaatgtacc aaggaagatg ctgaggatgt aatagaaata atgaaataca gcatgctggg | |
7984 2341 aacctactca gatgagtttg gaaaactgga ctttgaacgt tcacagcatg ggtctgggat | |
7985 2401 gagcaatcgg tcacaagcaa aaagatttgt ttctgccctt agtagtattg cagaaagaac | |
7986 2461 ttacagcaat ctctttgatt tgcaacaact tcgacaggtt gcaaaggagc tacaaatacg | |
7987 2521 agtatttgat tttgagagct ttattgaatc cctgaatgat cagggttatc tcttgaaaaa | |
7988 2581 aggctcgaga ctttatcagc ttcagactat gtgagaagag cttctgcagt aaacgttgag | |
7989 2641 acataattac tgtatcttga atggactgat gaacatggag cagtaaagca ccctgacttg | |
7990 2701 cagcctgccc caggagcacc tctggctctg ttgcttactg gaagttcctg ttcaaacatt | |
7991 2761 ggtaatgcca gcaggcttgc tagaagctca cgtaagacaa tctgtggtac tgctgcttga | |
7992 2821 ctcatcctgc aaggctgcca gcccaaacga tcctaacaac agatttcagt tctaaattgt | |
7993 2881 tggactcaca aattttaaac ctgaaatctt ttgtgagaag acagtgcaag ttgtgtcctt | |
7994 2941 agcactgcag ttcgtttgag gattttgaag tatagaaatg tttctaaaaa tttgggaact | |
7995 3001 ttcatgttga acctctgcag ctttatagct gtaagggttt tgttttttga tttgtaaccc | |
7996 3061 tttatttatt ggtcttccta acagatttta tttgaagtgc aagtctcact tatgaaagtc | |
7997 3121 tcctcgttac aatgcttaat gtgtaaaatg ggaattgtat ttttatttct cattaaatat | |
7998 3181 gatgggaata atagtaatag tgaacacttg catgggtgtt aataggtgtt atgtatgttc | |
7999 3241 acattacata ctgtgtatgt cttcttttaa ctgttctgcc acagaaggct gtctgatttt | |
8000 3301 atgaaacggg gcatgccctg atgcagtaac atagcagatg agaagctctg cataaggatt | |
8001 3361 ttt | |
8002 // | |
8003 | |
8004 LOCUS NM_001030587 2656 bp mRNA linear VRT 04-JAN-2017 | |
8005 DEFINITION Gallus gallus MON1 homolog A, secretory trafficking associated | |
8006 (MON1A), mRNA. | |
8007 ACCESSION NM_001030587 XM_003641966 XM_414273 | |
8008 VERSION NM_001030587.2 | |
8009 KEYWORDS RefSeq. | |
8010 SOURCE Gallus gallus (chicken) | |
8011 ORGANISM Gallus gallus | |
8012 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
8013 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
8014 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
8015 Phasianidae; Phasianinae; Gallus. | |
8016 REFERENCE 1 (bases 1 to 2656) | |
8017 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
8018 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
8019 P, Hayashizaki Y and Buerstedde JM. | |
8020 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
8021 gene function analysis | |
8022 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
8023 PUBMED 15642098 | |
8024 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
8025 preliminary review. The reference sequence was derived from | |
8026 AJ720812.1, AADN04000419.1 and BU243495.1. | |
8027 On or before May 31, 2014 this sequence version replaced | |
8028 gi:513204511, gi:71895458. | |
8029 | |
8030 ##Evidence-Data-START## | |
8031 CDS exon combination :: AJ720812.1 [ECO:0000331] | |
8032 RNAseq introns :: mixed/partial sample support SAMEA2201357, | |
8033 SAMEA2201358 [ECO:0000350] | |
8034 ##Evidence-Data-END## | |
8035 COMPLETENESS: complete on the 3' end. | |
8036 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
8037 1-2259 AJ720812.1 290-2548 | |
8038 2260-2261 AADN04000419.1 612166-612167 | |
8039 2262-2645 AJ720812.1 2549-2932 | |
8040 2646-2656 BU243495.1 679-689 | |
8041 FEATURES Location/Qualifiers | |
8042 source 1..2656 | |
8043 /organism="Gallus gallus" | |
8044 /mol_type="mRNA" | |
8045 /db_xref="taxon:9031" | |
8046 /chromosome="12" | |
8047 /map="12" | |
8048 /breed="Leghorn" | |
8049 gene 1..2656 | |
8050 /gene="MON1A" | |
8051 /note="MON1 homolog A, secretory trafficking associated" | |
8052 /db_xref="CGNC:2109" | |
8053 /db_xref="GeneID:415929" | |
8054 CDS 20..1669 | |
8055 /gene="MON1A" | |
8056 /note="MON1 secretory trafficking family member A" | |
8057 /codon_start=1 | |
8058 /product="vacuolar fusion protein MON1 homolog A" | |
8059 /protein_id="NP_001025758.1" | |
8060 /db_xref="CGNC:2109" | |
8061 /db_xref="GeneID:415929" | |
8062 /translation="MAADVHKKKGWEVPNGSLAPGDGQHAERSESPTPGLAQGTEPGA | |
8063 GQEGAMFVHTRSYEDLTSPEDGGAVVRSPEERRGEPAEPTSMEQISKDFSELSTQLTG | |
8064 MALDLEEEMRQSQEGKLEPSPQATRHDSVLSGKEEEDVTMDTWRMHRKHVFVLSEAGK | |
8065 PVYSRYGSEEALSSTMGVMMALVSFLEAEKNAIRSIHADGYKVVFVRRSPLVLVAVAR | |
8066 TRQSEQEIAHELLYIYYQILSLLTWTQLNHIFQQKQNYDLRRLLAGSERITDNLLDLM | |
8067 AHDPSFLMGAVRCLPLAASVRDAVSTSLQQAKAKSLVFSILLSGNQLVSLVRKKDQFL | |
8068 HPIDLHLLFNLISSSSSFREGEAWTPICLPKFNSSGFFHAHISYLEQEMDLCLLLVST | |
8069 DREDFFTVSDCKRRFQERLRRRGVHHALQEALRTPFYSVAQVGIPDLRHFIYKSKSSG | |
8070 LFTSPEIEAPYVREEEKERLLGLYQYLHSRAHNSSCPLKNIYFTGPRENLLAWVTSAF | |
8071 ELYICYSPLGTKAGAISAVNKLMKWIRKEEDRLFILTPQTY" | |
8072 ORIGIN | |
8073 1 gcatgtcccg ccccaaggaa tggctgcgga tgtccacaag aagaaaggct gggaagtgcc | |
8074 61 caacgggtcc ctggcgccgg gcgatgggca gcacgcggag cgctccgaga gccccacacc | |
8075 121 ggggctggca caggggacgg agccgggtgc gggccaggag ggagccatgt tcgtgcacac | |
8076 181 ccgctcctac gaggacctga cgagccctga ggacgggggg gctgtggtgc ggagccctga | |
8077 241 ggagaggcga ggggagccgg ctgagcccac gagcatggag cagatcagca aggacttcag | |
8078 301 cgagctgagc acacagctga cgggcatggc cctcgacctg gaggaggaga tgagacagag | |
8079 361 ccaggaggga aagctggagc cgtccccaca ggccacccgc catgactcgg tgctgtcagg | |
8080 421 aaaggaggag gaggatgtga ccatggacac ctggcgcatg catcggaagc acgtcttcgt | |
8081 481 gctgagtgag gctggcaagc ccgtgtattc ccgctatggg tccgaggaag ccctctccag | |
8082 541 caccatgggt gtcatgatgg ccctggtgtc cttcctagag gccgagaaaa acgccatccg | |
8083 601 gtccatccat gcagatggct acaaggtggt ctttgtgcgg aggagcccgc tggtgctggt | |
8084 661 ggcagtggcg cggacccggc agtctgagca ggagattgcc catgagctgc tctacatcta | |
8085 721 ttaccaaatc ctgagcctgc tcacctggac tcagctcaac cacatcttcc agcagaagca | |
8086 781 gaactacgac cttcgcaggc tccttgctgg ctccgagcgc atcactgaca acctgctgga | |
8087 841 ccttatggcc cacgacccca gcttcctcat gggtgccgtg cgctgcctgc ccttggctgc | |
8088 901 cagcgtgcgg gacgccgtga gcaccagcct ccagcaggcc aaggccaaga gcttggtctt | |
8089 961 ctccatcctc ctgtcaggga accagctggt ttctctggtg aggaagaagg atcagttcct | |
8090 1021 ccaccccatc gacctccatc tgctcttcaa cctcatcagc tcctcctctt cctttcggga | |
8091 1081 gggtgaagcc tggactccca tttgcctccc taagttcaac tccagcggct tcttccacgc | |
8092 1141 tcacatctcc tacctggagc aggagatgga cctgtgcctc ctgttggtct ccactgaccg | |
8093 1201 tgaggacttc ttcacagtct ccgactgcaa gcggcgcttc caggagcgcc tgcggcggcg | |
8094 1261 cggagtgcac cacgctctgc aggaggccct gcgcaccccc ttctacagcg tcgcccaggt | |
8095 1321 gggcatccct gacctgcggc acttcatcta caagtccaag agctctgggc tcttcaccag | |
8096 1381 ccctgagatc gaggcaccct acgtgcggga ggaggagaag gaaaggctct tggggctcta | |
8097 1441 tcagtacctc cacagccggg ctcacaactc gtcgtgcccc ctgaagaaca tctacttcac | |
8098 1501 gggcccacgt gaaaacctcc tggcttgggt caccagcgcc tttgagctct acatatgcta | |
8099 1561 cagtccactg gggaccaagg cgggcgccat cagtgctgtc aacaagctca tgaagtggat | |
8100 1621 ccgcaaggag gaagaccggc tcttcatcct cacaccccag acgtactgac ggacattgcc | |
8101 1681 cagggtgtgg tgccatccgg aggacctctg ctgtgctggg gagctcgtct ctctgggaag | |
8102 1741 cctgggctgt gagccagggg agagggcacg ggggaccctg agggcatggg gaaactgccc | |
8103 1801 gacctgggtg tgagagacga ggtgcaaagc tgcccaggct atgtggtgag cagggctttc | |
8104 1861 tctcacctgc aggcaatgcc tccctcatct ggggagctgc ccttcctctg cagcccgcct | |
8105 1921 ctctgtcctt tgtgctgctg tgcccacgga gggcaggtga caacacccag ctgggcacag | |
8106 1981 ggctggccgg gacactgcca gcactgctcc tctccccgct ttgggggagc tgggcctccc | |
8107 2041 aagtgccggg cagcccctga tggtcccaga gccaggctgg aggccggcag gtttgtcccc | |
8108 2101 ctggcaccta tgtgtgccca gtccctttct actgaggcca tgagaaggat gtccttgggg | |
8109 2161 atgctgggaa gcagggcagc cccagtgaga ctcggggtac cgggatgcca ctcggtgtgc | |
8110 2221 tcgtggtgct ggctccaaag cagcagctgt ggtgtgccct cccctacccc tccctcagag | |
8111 2281 ccccagctgg catggggcac tgatgtgtct tcatcgcatc gtggggtccc ctatcctcca | |
8112 2341 aaaagcagcc ccccgagctg ggcttgctgt gcgaggacca cctcctccct gctgtcccca | |
8113 2401 gctgtcccca ggcactggcg tggggctgag caccccgcag cacggcgctg ggcacggctc | |
8114 2461 ccgccccatg aagcacaacc tgaccctgtg catagggatg ggcgtccggg aggggaaacc | |
8115 2521 cccccgcggt cacaccgagg ggccggcagg aacccggcgg ggctaacgca gggactccgc | |
8116 2581 tcccttattt atgctcctgc cagattgtag tcgcttttct ttgctcataa acattatctg | |
8117 2641 gactcaaatc gaaaaa | |
8118 // | |
8119 | |
8120 LOCUS NM_001293103 1151 bp mRNA linear VRT 04-JAN-2017 | |
8121 DEFINITION Gallus gallus melatonin receptor 1B (MTNR1B), mRNA. | |
8122 ACCESSION NM_001293103 XM_417201 | |
8123 VERSION NM_001293103.1 | |
8124 KEYWORDS RefSeq. | |
8125 SOURCE Gallus gallus (chicken) | |
8126 ORGANISM Gallus gallus | |
8127 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
8128 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
8129 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
8130 Phasianidae; Phasianinae; Gallus. | |
8131 REFERENCE 1 (bases 1 to 1151) | |
8132 AUTHORS Li J, Wang Z, Cao J, Dong Y and Chen Y. | |
8133 TITLE Melatonin receptor subtypes Mel1a and Mel1c but not Mel1b are | |
8134 associated with monochromatic light-induced B-lymphocyte | |
8135 proliferation in broilers | |
8136 JOURNAL Domest. Anim. Endocrinol. 45 (4), 206-215 (2013) | |
8137 PUBMED 24209505 | |
8138 REMARK GeneRIF: results suggest that melatonin mediates green | |
8139 light-induced bursal B-lymphocyte proliferation through melatonin | |
8140 receptor subrypes Mel1c and Mel1a receptors but not Mel1b receptors | |
8141 by activating the cyclic AMP/protein kinase A pathway | |
8142 REFERENCE 2 (bases 1 to 1151) | |
8143 AUTHORS Sundaresan NR, Marcus Leo MD, Subramani J, Anish D, Sudhagar M, | |
8144 Ahmed KA, Saxena M, Tyagi JS, Sastry KV and Saxena VK. | |
8145 TITLE Expression analysis of melatonin receptor subtypes in the ovary of | |
8146 domestic chicken | |
8147 JOURNAL Vet. Res. Commun. 33 (1), 49-56 (2009) | |
8148 PUBMED 18604592 | |
8149 REFERENCE 3 (bases 1 to 1151) | |
8150 AUTHORS Liu F, Yuan H, Sugamori KS, Hamadanizadeh A, Lee FJ, Pang SF, Brown | |
8151 GM, Pristupa ZB and Niznik HB. | |
8152 TITLE Molecular and functional characterization of a partial cDNA | |
8153 encoding a novel chicken brain melatonin receptor | |
8154 JOURNAL FEBS Lett. 374 (2), 273-278 (1995) | |
8155 PUBMED 7589552 | |
8156 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
8157 preliminary review. The reference sequence was derived from | |
8158 AADN04000207.1 and U30609.1. | |
8159 On May 30, 2014 this sequence version replaced gi:513166281. | |
8160 | |
8161 Sequence Note: This RefSeq record was created from transcript and | |
8162 genomic sequence data to make the sequence consistent with the | |
8163 reference genome assembly. The genomic coordinates and exon | |
8164 combination used for the transcript record were based on alignment | |
8165 to mRNA DQ178665.1 from zebra finch (Taeniopygia guttata, taxonomy | |
8166 ID 59729). | |
8167 | |
8168 ##Evidence-Data-START## | |
8169 RNAseq introns :: single sample supports all introns SAMEA2201363, | |
8170 SAMEA2201364 [ECO:0000348] | |
8171 ##Evidence-Data-END## | |
8172 | |
8173 ##RefSeq-Attributes-START## | |
8174 inferred exon combination :: based on alignments, homology | |
8175 ##RefSeq-Attributes-END## | |
8176 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
8177 1-217 AADN04000207.1 941976-942192 | |
8178 218-1151 U30609.1 2-935 | |
8179 FEATURES Location/Qualifiers | |
8180 source 1..1151 | |
8181 /organism="Gallus gallus" | |
8182 /mol_type="mRNA" | |
8183 /db_xref="taxon:9031" | |
8184 /chromosome="1" | |
8185 /map="1" | |
8186 /breed="Red Jungle Fowl" | |
8187 gene 1..1151 | |
8188 /gene="MTNR1B" | |
8189 /gene_synonym="Mel-1B-R; Mel1b" | |
8190 /note="melatonin receptor 1B" | |
8191 /db_xref="CGNC:12946" | |
8192 /db_xref="GeneID:396338" | |
8193 CDS 1..1086 | |
8194 /gene="MTNR1B" | |
8195 /gene_synonym="Mel-1B-R; Mel1b" | |
8196 /note="Mel-1b melatonin receptor; mel1b receptor; | |
8197 melatonin receptor type 1b variant 1; melatonin receptor | |
8198 type 1b variant 2" | |
8199 /codon_start=1 | |
8200 /product="melatonin receptor type 1B" | |
8201 /protein_id="NP_001280032.1" | |
8202 /db_xref="CGNC:12946" | |
8203 /db_xref="GeneID:396338" | |
8204 /translation="MLENGSLRNCCEPGGRGHFGSAEREAAAGGAPRPAWVVTALSSV | |
8205 LIFTTVVDILGNLLVIVSVFKNRKLRNSGNAFVVSLALADLVVALYPYPLVLLAIFHN | |
8206 GWTLGEMHCKVSGFVMGLSVIGSIFNITAIAINRYCYICHSFAYDKVYSCWNTMLYVS | |
8207 LIWVLTVIATVPNFFVGSLKYDPRIYSCTFVQTASSYYTIAVVVIHFIVPITVVSFCY | |
8208 LRIWVLVLQVRRRVKSETKPRLKPSDFRNFLTMFVVFVIFAFCWAPLNFIGLAVAINP | |
8209 SEMAPKVPEWLFIISYFMAYFNSCLNAIIYGLLNQNFRNEYKRILMSLWMPRLFFQDT | |
8210 SKGGTDGQKSKPSPALNNNDQMKTDTL" | |
8211 ORIGIN | |
8212 1 atgctggaga atggatctct gaggaactgc tgcgagccgg gcgggagggg tcacttcggc | |
8213 61 tcggcggagc gggaggcggc ggctggaggc gccccgcggc ccgcctgggt ggtgacggct | |
8214 121 ctctccagcg tgctgatctt caccaccgtg gtggacattt tgggcaacct gctggtcatc | |
8215 181 gtgtccgtct tcaagaaccg caagctcagg aactcaggta atgcatttgt ggtgagcctg | |
8216 241 gctttggctg atctggtggt ggccttgtat ccatacccac tggtgctctt agctattttc | |
8217 301 cacaatggat ggactttggg tgaaatgcac tgtaaagtga gtggctttgt gatgggacta | |
8218 361 agtgtaatag gctctatttt caacatcact gcaattgcaa taaaccgata ttgctatata | |
8219 421 tgtcatagct ttgcctatga caaagtgtat agctgttgga acacaatgct ctatgtgtcc | |
8220 481 ttaatctggg tattaacagt aattgcaact gtgccaaatt tttttgtcgg ctctctgaag | |
8221 541 tatgatccac gcatctattc atgcacattt gttcagactg caagctccta ctatacaatt | |
8222 601 gcagttgtgg taattcattt catcgtccct attactgttg tgagcttctg ctatcttcga | |
8223 661 atttgggtct tagtgcttca agttagaaga cgagtcaagt cagaaacaaa gccaagactg | |
8224 721 aaaccaagtg acttcagaaa ctttcttacc atgtttgtgg tttttgtgat ttttgccttt | |
8225 781 tgctgggcac ctctaaactt cataggactg gctgtagcca tcaatccttc agaaatggca | |
8226 841 ccaaaagttc ctgaatggtt attcattata agctacttca tggcctattt caacagctgc | |
8227 901 cttaatgcaa taatatatgg acttcttaac cagaattttc ggaatgaata caaacgtatt | |
8228 961 ttaatgtcac tgtggatgcc aaggcttttc ttccaggaca catccaaagg aggaactgat | |
8229 1021 ggacagaaga gcaagccttc tcctgcttta aacaacaatg accaaatgaa aactgacacc | |
8230 1081 ttgtaaaggg gtgatggtta atcgagaagt ttgtcatgga gagcttcatt gatagagttc | |
8231 1141 gaatgttcta g | |
8232 // | |
8233 | |
8234 LOCUS NM_001290554 3006 bp mRNA linear VRT 04-JAN-2017 | |
8235 DEFINITION Gallus gallus solute carrier family 4 member 1 (Diego blood group) | |
8236 (SLC4A1), mRNA. | |
8237 ACCESSION NM_001290554 | |
8238 VERSION NM_001290554.1 | |
8239 KEYWORDS RefSeq. | |
8240 SOURCE Gallus gallus (chicken) | |
8241 ORGANISM Gallus gallus | |
8242 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
8243 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
8244 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
8245 Phasianidae; Phasianinae; Gallus. | |
8246 REFERENCE 1 (bases 1 to 3006) | |
8247 AUTHORS Weber RE, Voelter W, Fago A, Echner H, Campanella E and Low PS. | |
8248 TITLE Modulation of red cell glycolysis: interactions between vertebrate | |
8249 hemoglobins and cytoplasmic domains of band 3 red cell membrane | |
8250 proteins | |
8251 JOURNAL Am. J. Physiol. Regul. Integr. Comp. Physiol. 287 (2), R454-R464 | |
8252 (2004) | |
8253 PUBMED 15087282 | |
8254 REMARK GeneRIF: The cdB3 interaction is strongly dependent on pH and the | |
8255 number of negative and positive charges of the peptide and at the | |
8256 effector binding site, respectively. | |
8257 REFERENCE 2 (bases 1 to 3006) | |
8258 AUTHORS Gabrielli MG, Cox JV, Materazzi G and Menghi G. | |
8259 TITLE Cell type-specific and developmentally regulated expression of the | |
8260 AE1 anion exchanger in the chicken chorioallantoic membrane | |
8261 JOURNAL Histochem. Cell Biol. 121 (3), 189-199 (2004) | |
8262 PUBMED 14963713 | |
8263 REMARK GeneRIF: Basolateral AE1 plays role in bicarbonate reabsorption | |
8264 that is required in the embryo for maintaining acid-base balance | |
8265 during development. | |
8266 REFERENCE 3 (bases 1 to 3006) | |
8267 AUTHORS Cox KH, Adair-Kirk TL and Cox JV. | |
8268 TITLE Four variant chicken erythroid AE1 anion exchangers. Role of the | |
8269 alternative N-terminal sequences in intracellular targeting in | |
8270 transfected human erythroleukemia cells | |
8271 JOURNAL J. Biol. Chem. 270 (34), 19752-19760 (1995) | |
8272 PUBMED 7649985 | |
8273 REFERENCE 4 (bases 1 to 3006) | |
8274 AUTHORS Cox KH and Cox JV. | |
8275 TITLE Variant chicken AE1 anion exchangers possess divergent | |
8276 NH(2)-terminal cytoplasmic domains | |
8277 JOURNAL Am. J. Physiol. 268 (3 PT 2), F503-F513 (1995) | |
8278 PUBMED 7900851 | |
8279 REFERENCE 5 (bases 1 to 3006) | |
8280 AUTHORS Kim HR, Yew NS, Ansorge W, Voss H, Schwager C, Vennstrom B, Zenke M | |
8281 and Engel JD. | |
8282 TITLE Two different mRNAs are transcribed from a single genomic locus | |
8283 encoding the chicken erythrocyte anion transport proteins (band 3) | |
8284 JOURNAL Mol. Cell. Biol. 8 (10), 4416-4424 (1988) | |
8285 PUBMED 3185555 | |
8286 REFERENCE 6 (bases 1 to 3006) | |
8287 AUTHORS Cox JV and Lazarides E. | |
8288 TITLE Alternative primary structures in the transmembrane domain of the | |
8289 chicken erythroid anion transporter | |
8290 JOURNAL Mol. Cell. Biol. 8 (3), 1327-1335 (1988) | |
8291 PUBMED 2835670 | |
8292 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
8293 NCBI review. The reference sequence was derived from M23404.1. | |
8294 | |
8295 ##Evidence-Data-START## | |
8296 Transcript exon combination :: M23404.1 [ECO:0000332] | |
8297 RNAseq introns :: mixed/partial sample support | |
8298 SAMEA2201357, SAMEA2201358 | |
8299 [ECO:0000350] | |
8300 ##Evidence-Data-END## | |
8301 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
8302 1-3006 M23404.1 1-3006 | |
8303 FEATURES Location/Qualifiers | |
8304 source 1..3006 | |
8305 /organism="Gallus gallus" | |
8306 /mol_type="mRNA" | |
8307 /db_xref="taxon:9031" | |
8308 gene 1..3006 | |
8309 /gene="SLC4A1" | |
8310 /gene_synonym="AE1; EAT" | |
8311 /note="solute carrier family 4 member 1 (Diego blood | |
8312 group)" | |
8313 /db_xref="CGNC:49859" | |
8314 /db_xref="GeneID:396532" | |
8315 misc_feature 41..43 | |
8316 /gene="SLC4A1" | |
8317 /gene_synonym="AE1; EAT" | |
8318 /note="upstream in-frame stop codon" | |
8319 CDS 77..2845 | |
8320 /gene="SLC4A1" | |
8321 /gene_synonym="AE1; EAT" | |
8322 /note="erythroid anion exchanger 1; erythrocyte anion | |
8323 transport protein; solute carrier family 4, anion | |
8324 exchanger, member 1 (erythrocyte membrane protein band 3, | |
8325 Diego blood group)" | |
8326 /codon_start=1 | |
8327 /product="band 3 anion transport protein" | |
8328 /protein_id="NP_001277483.1" | |
8329 /db_xref="CGNC:49859" | |
8330 /db_xref="GeneID:396532" | |
8331 /translation="MEGPGQDTEDALRRSLDPEGYEDTKGSRTSLGTMSNPLVSDVDL | |
8332 EAAGSRQPTAHRDTYEGYVELHELVLDSRKDPCWMEAGRWLHLEESMEPGGAWGSHLP | |
8333 LLTYHSLLELHRAFAKGVVLLDVAANSLAAVAHVLLDQLIYEGQLKPQHRDDVLRALL | |
8334 LRHKHPSEAESVWTLPAAQLQCSDGEQKDADERALLRDQRAVEMRELHGAGQSPSRAQ | |
8335 LGPQLHQQLPEDTEATLVLVACAAFLEQPLLALVRLGAPCPDAVLAVPLPVRFVLTVL | |
8336 GPDSPRLSYHEIRRAAATVMADRVFRRDAYLCGGRAELLGGLQGFLEASIVLPPQEVP | |
8337 SEQHLHALIPLQRHAVRRRYQHPDTVRSPGGPTAPKDTGDKGQAPQDDDPLLRTRRPF | |
8338 GGLVRDIRRRYPKYLSDIRDALNPQCLAAVIFIYFAALSPAITFGGLLGEKTRGMMGV | |
8339 SELLLSTSVQCLLFSLLSAQPLLVVGFSGPLLVFEEAFFRFCEDHGLEYIVGRVWIGF | |
8340 WLILLVLLVVACEGTVLVRYLSRYTQEIFSFLISLIFIYETFAKLVTIFEAHPLQQSY | |
8341 DTDVSTEPSVPKPNTALLSLVLMAGTFFLALFLRQFKNSVFLPGKVRRLIGDFGVPIS | |
8342 IFVMALADFFIKDTYTQKLKVPRGLEVTNGTARGWFIHPMGSATPFPIWMMFASPVPA | |
8343 LLVFILIFLETQITTLIVSKPERKLVKGSGFHLDLLLIVAMGGLAALFGMPWLSATTV | |
8344 RTITHANALTVVGKSAVPGERAHIVEVKEQRLSGLLVAVLIGVSILMEPILKYIPLAV | |
8345 LFGIFLYMGVTSLFGIQLFDRILLLLMPPKYHPKEPYVTRVKTWRITSSPLTQILVVA | |
8346 LLWGVKVSPASLRCPFVLVLTVPLRRLLLPRIFSEIELKCLDTDDAVVTFEEAEGQDV | |
8347 YNEVQMPS" | |
8348 misc_feature 1325..1396 | |
8349 /gene="SLC4A1" | |
8350 /gene_synonym="AE1; EAT" | |
8351 /experiment="experimental evidence, no additional details | |
8352 recorded" | |
8353 /note="propagated from UniProtKB/Swiss-Prot (P15575.1); | |
8354 transmembrane region" | |
8355 misc_feature 1421..1483 | |
8356 /gene="SLC4A1" | |
8357 /gene_synonym="AE1; EAT" | |
8358 /experiment="experimental evidence, no additional details | |
8359 recorded" | |
8360 /note="propagated from UniProtKB/Swiss-Prot (P15575.1); | |
8361 transmembrane region" | |
8362 misc_feature 1493..1543 | |
8363 /gene="SLC4A1" | |
8364 /gene_synonym="AE1; EAT" | |
8365 /experiment="experimental evidence, no additional details | |
8366 recorded" | |
8367 /note="propagated from UniProtKB/Swiss-Prot (P15575.1); | |
8368 transmembrane region" | |
8369 misc_feature 1571..1633 | |
8370 /gene="SLC4A1" | |
8371 /gene_synonym="AE1; EAT" | |
8372 /experiment="experimental evidence, no additional details | |
8373 recorded" | |
8374 /note="propagated from UniProtKB/Swiss-Prot (P15575.1); | |
8375 transmembrane region" | |
8376 misc_feature 1670..1738 | |
8377 /gene="SLC4A1" | |
8378 /gene_synonym="AE1; EAT" | |
8379 /experiment="experimental evidence, no additional details | |
8380 recorded" | |
8381 /note="propagated from UniProtKB/Swiss-Prot (P15575.1); | |
8382 transmembrane region" | |
8383 misc_feature 1820..1882 | |
8384 /gene="SLC4A1" | |
8385 /gene_synonym="AE1; EAT" | |
8386 /experiment="experimental evidence, no additional details | |
8387 recorded" | |
8388 /note="propagated from UniProtKB/Swiss-Prot (P15575.1); | |
8389 transmembrane region" | |
8390 misc_feature 1916..1978 | |
8391 /gene="SLC4A1" | |
8392 /gene_synonym="AE1; EAT" | |
8393 /experiment="experimental evidence, no additional details | |
8394 recorded" | |
8395 /note="propagated from UniProtKB/Swiss-Prot (P15575.1); | |
8396 transmembrane region" | |
8397 misc_feature 2099..2161 | |
8398 /gene="SLC4A1" | |
8399 /gene_synonym="AE1; EAT" | |
8400 /experiment="experimental evidence, no additional details | |
8401 recorded" | |
8402 /note="propagated from UniProtKB/Swiss-Prot (P15575.1); | |
8403 transmembrane region" | |
8404 misc_feature 2210..2266 | |
8405 /gene="SLC4A1" | |
8406 /gene_synonym="AE1; EAT" | |
8407 /experiment="experimental evidence, no additional details | |
8408 recorded" | |
8409 /note="propagated from UniProtKB/Swiss-Prot (P15575.1); | |
8410 transmembrane region" | |
8411 misc_feature 2267..2320 | |
8412 /gene="SLC4A1" | |
8413 /gene_synonym="AE1; EAT" | |
8414 /experiment="experimental evidence, no additional details | |
8415 recorded" | |
8416 /note="propagated from UniProtKB/Swiss-Prot (P15575.1); | |
8417 transmembrane region" | |
8418 misc_feature 2390..2452 | |
8419 /gene="SLC4A1" | |
8420 /gene_synonym="AE1; EAT" | |
8421 /experiment="experimental evidence, no additional details | |
8422 recorded" | |
8423 /note="propagated from UniProtKB/Swiss-Prot (P15575.1); | |
8424 transmembrane region" | |
8425 misc_feature 2453..2509 | |
8426 /gene="SLC4A1" | |
8427 /gene_synonym="AE1; EAT" | |
8428 /experiment="experimental evidence, no additional details | |
8429 recorded" | |
8430 /note="propagated from UniProtKB/Swiss-Prot (P15575.1); | |
8431 transmembrane region" | |
8432 ORIGIN | |
8433 1 ggcggcggcg tccccagagc ggggcatggt gccgccaaga tgagcgccgg cacgcagcgg | |
8434 61 gggggtgagt ggagccatgg aggggcccgg ccaggacacc gaggacgcgc tacgcaggag | |
8435 121 cctggacccc gagggctacg aggacaccaa gggctccagg acatccctgg ggacgatgag | |
8436 181 caatccattg gtgagcgatg tggacctgga ggcggcgggg agccgacagc ccacggccca | |
8437 241 cagggacacc tatgagggct acgtggagct gcacgagttg gtgctggaca gcaggaagga | |
8438 301 tccgtgctgg atggaggccg ggcgctggct gcatctggag gagagcatgg agccgggggg | |
8439 361 ggcgtggggc agccacctcc ccctgctcac ctaccacagc ctgctggagc tgcaccgcgc | |
8440 421 cttcgccaaa ggcgttgtgc tgctcgacgt ggcggccaac tcgctggcag ccgtggccca | |
8441 481 cgtgctgctg gatcagctca tctacgaggg gcagctgaag ccgcagcacc gcgacgacgt | |
8442 541 cctgcgggcg ctgctgctgc ggcacaagca ccccagtgag gccgagtcgg tgtggacgct | |
8443 601 gccggcggcg cagctgcagt gctcggacgg ggagcagaag gacgcggacg agcgcgcact | |
8444 661 gctgcgggac cagcgggctg tggagatgag ggagctgcat ggggccggcc agagcccctc | |
8445 721 cagggcgcag ctcggcccac agctccacca gcagctcccc gaggacaccg aggccacgct | |
8446 781 ggtgctcgtg gcctgcgcag cgttcctgga gcagccgctg ttggcgttgg tgcggctcgg | |
8447 841 cgcgccgtgt ccggacgcgg tgctggccgt gccgctgccc gtgcgcttcg tgctgacggt | |
8448 901 gttgggcccc gacagccccc gcctcagcta ccacgagatc cgccgcgccg ccgccaccgt | |
8449 961 catggccgac cgggtgttcc gccgggacgc ctacctgtgc gggggccgtg cggagctgct | |
8450 1021 gggggggctg cagggcttcc tggaggccag catcgttctg ccgccccaag aggtgcccag | |
8451 1081 cgagcagcac ctgcatgccc tgatcccact gcagcgccac gctgtccgcc gccgctacca | |
8452 1141 gcaccccgac accgtgcgca gccccggcgg ccccacggcc cccaaagaca caggggataa | |
8453 1201 gggccaggct ccgcaggacg acgaccccct gctccggacg aggcggccgt ttggggggtt | |
8454 1261 ggtgagggac atccgccgcc gttaccccaa atacctcagt gacatcaggg atgcgctcaa | |
8455 1321 cccgcagtgc ctggcagccg tcatcttcat ctacttcgca gcgctgtcgc ccgccatcac | |
8456 1381 cttcgggggt ttgctgggtg agaagacccg cggtatgatg ggggtgtcgg agctgctgct | |
8457 1441 ctccaccagc gtgcagtgtt tgctcttcag tctgctgagc gcgcagcctc tgctcgtcgt | |
8458 1501 cggcttctcg gggccactgc tggtctttga ggaggctttc ttcaggttct gtgaggatca | |
8459 1561 tggcctggag tacatcgtgg gccgggtgtg gatcggcttc tggctcatcc tgctggtgct | |
8460 1621 gctggtggtg gcctgcgagg gcaccgtcct ggtgcgctac ctgtcccgat acacgcagga | |
8461 1681 gatcttctcc ttcctcatct ccctcatctt catctatgag accttcgcca aactcgtcac | |
8462 1741 gatcttcgag gcccacccgc tgcagcagag ctacgacacg gacgtcagca cggagccctc | |
8463 1801 cgtgcccaaa cccaacacgg cgctgctgtc cctcgtgctc atggccggca ccttcttcct | |
8464 1861 cgccctcttc ctccgtcagt tcaagaacag tgtgttcctg cccggcaagg tgcggcggct | |
8465 1921 gatcggggac ttcggggtgc ccatctccat cttcgtcatg gccctggctg acttcttcat | |
8466 1981 caaggacacc tacacgcaga agctgaaggt gcccagaggg ctggaggtga ccaacggcac | |
8467 2041 cgcccgcggt tggttcatcc accccatggg cagcgccacc cccttcccca tctggatgat | |
8468 2101 gttcgcctcg ccggtgcccg ccctcctggt cttcatcctc atcttcctcg agacgcagat | |
8469 2161 caccaccctc atcgtcagca aaccggagcg gaagctggtg aagggctcgg ggttccacct | |
8470 2221 ggacctgctg ctcatcgtgg ccatgggcgg cctggccgcg ctcttcggca tgccctggct | |
8471 2281 gagcgccacc acggtgcgca ccatcacgca cgccaacgcg ctcaccgtcg tgggtaagag | |
8472 2341 cgccgtgccg ggggagaggg cccacatcgt ggaggtgaag gagcagcggc tcagcgggct | |
8473 2401 gctggtggcc gtgctgatcg gcgtctccat cctgatggag cccatcctga agtacatccc | |
8474 2461 gctggcggtg ctcttcggca tcttcctcta catgggcgtc acgtcgctct tcggcatcca | |
8475 2521 gctcttcgac cgcattctgc tgctgctcat gccccccaag taccacccca aggagccgta | |
8476 2581 cgtcacccgg gtgaagacgt ggcggatcac atcttcaccc ctgacgcaga tcctcgtcgt | |
8477 2641 ggcgctgctg tggggggtga aggtcagccc ggcctccctg cgctgccctt tcgtcctcgt | |
8478 2701 cctcaccgtg ccgctgcggc gccttctgct gccccgcatc ttcagcgaga tcgagctcaa | |
8479 2761 atgcctggac acggacgacg cagtggtgac atttgaagag gcggagggcc aggacgtgta | |
8480 2821 caacgaggtg cagatgccca gctaaggtcc cgccgtgccc ccacccacgt gtagatccac | |
8481 2881 catcgccccc cagagccgcg tcctgcccag accgtcccgc tatgccgccc agcgtcccgg | |
8482 2941 ggtagggatg gaacagccca gcacaggggg tagggtttgt aacgcagaga atcgctgcaa | |
8483 3001 aaacac | |
8484 // | |
8485 | |
8486 LOCUS NM_205054 1273 bp mRNA linear VRT 04-JAN-2017 | |
8487 DEFINITION Gallus gallus pepsinogen 3, group I (pepsinogen A) (PGA3), mRNA. | |
8488 ACCESSION NM_205054 | |
8489 VERSION NM_205054.2 | |
8490 KEYWORDS RefSeq. | |
8491 SOURCE Gallus gallus (chicken) | |
8492 ORGANISM Gallus gallus | |
8493 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
8494 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
8495 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
8496 Phasianidae; Phasianinae; Gallus. | |
8497 REFERENCE 1 (bases 1 to 1273) | |
8498 AUTHORS Watanuki K and Yasugi S. | |
8499 TITLE Analysis of transcription regulatory regions of embryonic chicken | |
8500 pepsinogen (ECPg) gene | |
8501 JOURNAL Dev. Dyn. 228 (1), 51-58 (2003) | |
8502 PUBMED 12950079 | |
8503 REMARK GeneRIF: An analysis of the transcription regulatory regions of | |
8504 pepsinogen was made. | |
8505 REFERENCE 2 (bases 1 to 1273) | |
8506 AUTHORS Hayashi K, Agata K, Mochii M, Yasugi S, Eguchi G and Mizuno T. | |
8507 TITLE Molecular cloning and the nucleotide sequence of cDNA for embryonic | |
8508 chicken pepsinogen: phylogenetic relationship with prochymosin | |
8509 JOURNAL J. Biochem. 103 (2), 290-296 (1988) | |
8510 PUBMED 3131317 | |
8511 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
8512 NCBI review. The reference sequence was derived from D00215.1. | |
8513 On May 15, 2013 this sequence version replaced gi:45384243. | |
8514 | |
8515 ##Evidence-Data-START## | |
8516 Transcript exon combination :: D00215.1 [ECO:0000332] | |
8517 RNAseq introns :: mixed/partial sample support | |
8518 SAMEA2201364 [ECO:0000350] | |
8519 ##Evidence-Data-END## | |
8520 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
8521 1-1273 D00215.1 1-1273 | |
8522 FEATURES Location/Qualifiers | |
8523 source 1..1273 | |
8524 /organism="Gallus gallus" | |
8525 /mol_type="mRNA" | |
8526 /db_xref="taxon:9031" | |
8527 /chromosome="26" | |
8528 /map="26" | |
8529 gene 1..1273 | |
8530 /gene="PGA3" | |
8531 /note="pepsinogen 3, group I (pepsinogen A)" | |
8532 /db_xref="CGNC:49555" | |
8533 /db_xref="GeneID:395926" | |
8534 CDS 17..1168 | |
8535 /gene="PGA3" | |
8536 /EC_number="3.4.23.1" | |
8537 /note="embryonic pepsinogen" | |
8538 /codon_start=1 | |
8539 /product="embryonic pepsinogen precursor" | |
8540 /protein_id="NP_990385.1" | |
8541 /db_xref="CGNC:49555" | |
8542 /db_xref="GeneID:395926" | |
8543 /translation="MRSLALLCAVLALSDGITRLPLERGKKLREILREKGLLHHFLQH | |
8544 HRYDIGTKFPHAFPDVLTVVTEPLLNTLDMEYYGTISIGTPPQDFTVVFDTGSSNLWV | |
8545 PSVSCTSPACQSHQMFNPSQSSTYKSTGQNLSIHYGTGDMEGTVGCDTVTVASLMDTN | |
8546 QLFGLSTSEPGQFFVYVKFDGILGLGYPSLAADGITPVFDNMVNESLLEQNLFSVYLS | |
8547 REPMGSMVVFGGIDESYFTGSINWIPVSYQGYWQISMDSIIVNKQEIACSSGCQAIID | |
8548 TGTSLVAGPASDINDIQSAVGANQNTYGEYSVNCSHILAMPDVVFVIGGIQYPVPALA | |
8549 YTEQNGQGTCMSSFQNSSADLWILGDVFIRVYYSIFDRANNRVGLAKAI" | |
8550 sig_peptide 17..64 | |
8551 /gene="PGA3" | |
8552 /experiment="experimental evidence, no additional details | |
8553 recorded" | |
8554 /note="{ECO:0000255}; propagated from UniProtKB/Swiss-Prot | |
8555 (P16476.1)" | |
8556 mat_peptide 65..1165 | |
8557 /gene="PGA3" | |
8558 /product="Embryonic pepsinogen" | |
8559 /experiment="experimental evidence, no additional details | |
8560 recorded" | |
8561 /note="propagated from UniProtKB/Swiss-Prot (P16476.1)" | |
8562 regulatory 1259..1264 | |
8563 /regulatory_class="polyA_signal_sequence" | |
8564 /gene="PGA3" | |
8565 ORIGIN | |
8566 1 ctgcatccct ggcacaatgc gatccctggc gctcctgtgc gcggtccttg ctctctccga | |
8567 61 tggcatcacc aggctgccct tggaaagggg gaagaagctg agagagatcc tcagggagaa | |
8568 121 gggcttgctg caccacttcc tccagcatca ccgctacgac atcggcacca aattcccaca | |
8569 181 tgcttttcct gatgtgctca ccgtggtcac cgaacccctg ctgaacaccc tggacatgga | |
8570 241 atactatggg accatctcca ttggcacccc accgcaggac ttcactgtgg tcttcgacac | |
8571 301 cggctcctcc aacctctggg ttccctctgt ctcctgcacc agcccagcct gccaaagcca | |
8572 361 tcagatgttt aacccatcgc agtcctccac ctacaaaagc acagggcaga acctgtccat | |
8573 421 tcactatggc actggtgaca tggagggcac cgtgggctgc gacaccgtca ctgttgcatc | |
8574 481 actgatggac accaaccagc tctttggctt gagtacctct gagcctggcc aattctttgt | |
8575 541 ctatgtcaaa tttgatggga tcttgggctt gggctaccca agtttagcag ctgatggaat | |
8576 601 cactccggtc tttgataaca tggtgaatga gagcttgctg gagcagaacc tcttctcagt | |
8577 661 ctatctatcc cgtgagccaa tggggagcat ggtcgtcttc gggggaatcg atgagtccta | |
8578 721 tttcactggc tccatcaact ggattcctgt ctcttaccaa ggatactggc agatctccat | |
8579 781 ggacagcatc attgtgaaca agcaggagat tgcgtgcagc agcggctgcc aggccatcat | |
8580 841 tgacactggc acatccctcg tggccgggcc ggcctcggac attaacgaca tccaaagcgc | |
8581 901 agtcggggcc aatcagaaca cgtatggaga gtacagtgtg aactgcagcc acatccttgc | |
8582 961 catgcctgac gttgtctttg tcatcggtgg cattcagtat cccgtgcctg ccttggctta | |
8583 1021 caccgagcag aatggccaag gaacctgcat gagcagcttc cagaacagct ctgcagacct | |
8584 1081 ctggatcttg ggagacgtct tcatcagagt gtactacagc atcttcgacc gggccaacaa | |
8585 1141 ccgtgttgga ctggccaagg ctatttagat ctactgagat gacagcactc aaccaggcca | |
8586 1201 tggctgtgtt tttcagagca gcaagaggcc tcttgtaagg tgtccttgcc tgcatgcaaa | |
8587 1261 taaaatgttg atg | |
8588 // | |
8589 | |
8590 LOCUS NM_001277841 1731 bp mRNA linear VRT 04-JAN-2017 | |
8591 DEFINITION Gallus gallus SEC13 homolog, nuclear pore and COPII coat complex | |
8592 component (SEC13), mRNA. | |
8593 ACCESSION NM_001277841 XM_414450 | |
8594 VERSION NM_001277841.1 | |
8595 KEYWORDS RefSeq. | |
8596 SOURCE Gallus gallus (chicken) | |
8597 ORGANISM Gallus gallus | |
8598 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
8599 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
8600 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
8601 Phasianidae; Phasianinae; Gallus. | |
8602 REFERENCE 1 (bases 1 to 1731) | |
8603 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
8604 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
8605 TITLE A comprehensive collection of chicken cDNAs | |
8606 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
8607 PUBMED 12445392 | |
8608 REFERENCE 2 (bases 1 to 1731) | |
8609 AUTHORS Abdrakhmanov I, Lodygin D, Geroth P, Arakawa H, Law A, Plachy J, | |
8610 Korn B and Buerstedde JM. | |
8611 TITLE A large database of chicken bursal ESTs as a resource for the | |
8612 analysis of vertebrate gene function | |
8613 JOURNAL Genome Res. 10 (12), 2062-2069 (2000) | |
8614 PUBMED 11116100 | |
8615 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
8616 preliminary review. The reference sequence was derived from | |
8617 BX934554.2, AJ396688.1, BU334051.1 and BG269901.1. | |
8618 On Apr 24, 2013 this sequence version replaced gi:363738752. | |
8619 | |
8620 ##Evidence-Data-START## | |
8621 Transcript exon combination :: BX934554.2 [ECO:0000332] | |
8622 RNAseq introns :: mixed/partial sample support | |
8623 SAMEA2201357, SAMEA2201358 | |
8624 [ECO:0000350] | |
8625 ##Evidence-Data-END## | |
8626 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
8627 1-397 BX934554.2 1-397 | |
8628 398-700 AJ396688.1 210-512 | |
8629 701-1438 BU334051.1 9-746 | |
8630 1439-1731 BG269901.1 12-304 c | |
8631 FEATURES Location/Qualifiers | |
8632 source 1..1731 | |
8633 /organism="Gallus gallus" | |
8634 /mol_type="mRNA" | |
8635 /db_xref="taxon:9031" | |
8636 /chromosome="12" | |
8637 /map="12" | |
8638 /breed="Leghorn" | |
8639 gene 1..1731 | |
8640 /gene="SEC13" | |
8641 /gene_synonym="SEC13L1" | |
8642 /note="SEC13 homolog, nuclear pore and COPII coat complex | |
8643 component" | |
8644 /db_xref="CGNC:6381" | |
8645 /db_xref="GeneID:416119" | |
8646 CDS 51..1013 | |
8647 /gene="SEC13" | |
8648 /gene_synonym="SEC13L1" | |
8649 /note="SEC13-like 1" | |
8650 /codon_start=1 | |
8651 /product="protein SEC13 homolog" | |
8652 /protein_id="NP_001264770.1" | |
8653 /db_xref="CGNC:6381" | |
8654 /db_xref="GeneID:416119" | |
8655 /translation="MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRN | |
8656 GGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWKEENGTWEKTYEYTGH | |
8657 DSSVNSVCWAPHDYGLILACGSSDGAISLLSYTGDGQWEVKKISNAHTIGCNAVSWAP | |
8658 AVVPGSLIEQPSGQKPNYIKRFASGGCDNLVKIWKEEDGQWKEEQKLEAHSDWVRDVA | |
8659 WAPSIGLPTSTIASCSQDGRVFIWTCDDASGSSWSPKLLHKFNDVVWHVSWSITANIL | |
8660 AVSGGDNKVTLWKESVDGLWACISDVNKGQGGVSAVPEGQQNEQ" | |
8661 ORIGIN | |
8662 1 cgcccgccga ccgatcgccg cccgccgttc cacggcccgc agccgccgcc atggtttccg | |
8663 61 tcattaacac cgtggacacc tctcacgagg acatgataca cgatgcgcag atggattact | |
8664 121 atggcactcg gctagcgacc tgttcttcag acagatctgt gaaaatcttt gatgttcgga | |
8665 181 atggagggca gatcctcatt gcggacctaa gagggcatga aggtccagtg tggcaagttg | |
8666 241 cctgggctca tcctatgtac ggaaacatct tggcttcctg ctcctatgac aggaaggtta | |
8667 301 ttatctggaa ggaagaaaat ggcacttggg aaaagaccta tgagtacaca gggcatgatt | |
8668 361 cctcagtgaa ttctgtctgc tgggcaccac acgactacgg actgatactg gcctgcggga | |
8669 421 gctctgatgg tgcaatttca ttactgagct acactggtga cgggcagtgg gaagtcaaaa | |
8670 481 agatcagcaa tgcacatact attggatgta atgcagttag ctgggctcct gctgttgtac | |
8671 541 caggcagcct tatagagcaa ccatctggtc aaaaaccaaa ctacatcaaa agatttgcat | |
8672 601 ctggtggttg tgacaacctt gtcaagatct ggaaagaaga agatggtcag tggaaagaag | |
8673 661 agcagaagct ggaggcacac agtgactggg ttcgagatgt agcctgggct ccatccatag | |
8674 721 gcttgccaac aagtaccatt gctagctgtt cacaggatgg cagagtgttt atctggacat | |
8675 781 gcgatgatgc ctctggaagt tcatggtcac caaaattgct gcacaagttc aatgatgttg | |
8676 841 tctggcatgt gagttggtcc attactgcaa atatacttgc agtgtctgga ggagacaata | |
8677 901 aagtcacact gtggaaggaa tcggtagatg ggctgtgggc atgcatcagc gatgtcaaca | |
8678 961 agggccaagg aggagtgtct gccgttccag aagggcagca gaatgagcag tgatgcggga | |
8679 1021 ctgaccagcc cagctgctgg aagcgatcac tatacctgat ttgcaatgtt tcttgaatca | |
8680 1081 gatgagaact ggttttatcc aaactggacg tgaacatggg gaaataacta tccaatttta | |
8681 1141 tgagcactct taaccaatac ttggaggcta ctatgtgttg ataatcagcc ttaattgaca | |
8682 1201 ttcccttaaa ttaaagatga agagaggagc aaagtactgt gccttgtgct actccctgat | |
8683 1261 actgtaaaaa ttgtaacctg ccttctggtt taggagtcag atttaattgg atacacttca | |
8684 1321 agcatgcgag caggaacagg aggaggcagg caatgaaagt gctcatgtgt gaacccatct | |
8685 1381 gtgtaagggg caaatactct gccactcaaa ggccaaaact atttcaagtg acagggtggg | |
8686 1441 ctggtggagt tagcagtaga cagcattctg gtggtactga aatggtgctt gggtttccct | |
8687 1501 gaaagtaatg tgctcagata catgaaaatc tccatgcatt cccaaagatg aaaaagagta | |
8688 1561 gcagaacgca tatgtatttt gctttacagt aatctcaaac ttgtttattt aacaaacatc | |
8689 1621 aacaaatgaa aatacaattt gaagactttt ttttagccac aattctatac tgtacctcag | |
8690 1681 gtttttgttt agacaacaaa ataaagtctt attggttaaa gcctgaaaaa a | |
8691 // | |
8692 | |
8693 LOCUS NM_001277715 1025 bp mRNA linear VRT 04-JAN-2017 | |
8694 DEFINITION Gallus gallus IMP4 homolog, U3 small nucleolar ribonucleoprotein | |
8695 (IMP4), mRNA. | |
8696 ACCESSION NM_001277715 XM_003641728 | |
8697 VERSION NM_001277715.1 | |
8698 KEYWORDS RefSeq. | |
8699 SOURCE Gallus gallus (chicken) | |
8700 ORGANISM Gallus gallus | |
8701 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
8702 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
8703 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
8704 Phasianidae; Phasianinae; Gallus. | |
8705 REFERENCE 1 (bases 1 to 1025) | |
8706 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
8707 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
8708 TITLE A comprehensive collection of chicken cDNAs | |
8709 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
8710 PUBMED 12445392 | |
8711 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
8712 preliminary review. The reference sequence was derived from | |
8713 BX929657.2 and BU218418.1. | |
8714 On Apr 14, 2013 this sequence version replaced gi:363736930. | |
8715 | |
8716 ##Evidence-Data-START## | |
8717 Transcript exon combination :: BX929657.2, CR386362.1 [ECO:0000332] | |
8718 RNAseq introns :: mixed/partial sample support | |
8719 SAMEA2201357, SAMEA2201358 | |
8720 [ECO:0000350] | |
8721 ##Evidence-Data-END## | |
8722 COMPLETENESS: complete on the 3' end. | |
8723 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
8724 1-1016 BX929657.2 1-1016 | |
8725 1017-1025 BU218418.1 264-272 | |
8726 FEATURES Location/Qualifiers | |
8727 source 1..1025 | |
8728 /organism="Gallus gallus" | |
8729 /mol_type="mRNA" | |
8730 /db_xref="taxon:9031" | |
8731 /chromosome="9" | |
8732 /map="9" | |
8733 /breed="Leghorn" | |
8734 gene 1..1025 | |
8735 /gene="IMP4" | |
8736 /note="IMP4 homolog, U3 small nucleolar ribonucleoprotein" | |
8737 /db_xref="CGNC:65804" | |
8738 /db_xref="GeneID:100857200" | |
8739 misc_feature 31..33 | |
8740 /gene="IMP4" | |
8741 /note="upstream in-frame stop codon" | |
8742 CDS 58..930 | |
8743 /gene="IMP4" | |
8744 /note="U3 small nucleolar ribonucleoprotein protein | |
8745 IMP4-like; IMP4, U3 small nucleolar ribonucleoprotein, | |
8746 homolog" | |
8747 /codon_start=1 | |
8748 /product="U3 small nucleolar ribonucleoprotein protein | |
8749 IMP4" | |
8750 /protein_id="NP_001264644.1" | |
8751 /db_xref="CGNC:65804" | |
8752 /db_xref="GeneID:100857200" | |
8753 /translation="MLRRQARERREYLQRRAQEERLRRQQDKKEQLRQALDENRLLPT | |
8754 ELRRQALALQKELEFETPGENGVTGSQDDEYRWAGLEPPKVMVTTSRDPSARLRVFAK | |
8755 ELCLVIPGARRLNRGRAEVGALVSACRAAGVTDLLVVHETRGQPDGLVLCHLPHGPTA | |
8756 HFTLSGAVLRHEVGGLGGAPLGAPHILLHRLDSALGRRVGTILKHLFPVPRPQTRRVV | |
8757 TFANEDDVILVRNHVYRRQGKTVELEEVGPRFQLRPYLIRLGTLEQGDAADVEWRWHP | |
8758 YTTTARKRQLLSLT" | |
8759 ORIGIN | |
8760 1 caacggcggc ggtgtttgga ggcgccggtg tgaggagaga gcggtgcggc tgcagctatg | |
8761 61 cttcgccgcc aggcccgtga gcgccgtgag tacctgcagc gccgggcgca ggaggagcgg | |
8762 121 ctgagacggc agcaggataa gaaggagcag ctgagacagg ccctggatga gaaccgactg | |
8763 181 ctgcccactg agctgaggcg ccaggcactg gccttgcaga aggagctgga gtttgagaca | |
8764 241 ccaggggaaa atggtgtgac aggcagccag gatgatgagt accggtgggc agggctggag | |
8765 301 ccccccaagg tgatggtgac aacctcgcgt gaccccagtg cccgcctccg tgtctttgcc | |
8766 361 aaggagctgt gcctggtgat cccaggggca cggcggctga accggggccg ggcagaggta | |
8767 421 ggggccctgg tgagtgcgtg ccgggcggct ggcgtcactg acctgctggt ggtgcatgag | |
8768 481 acccgtggac agcctgatgg actggtgctg tgccacctgc cccacggccc cacagcccac | |
8769 541 ttcacactga gcggggctgt gctgaggcac gaggtggggg gtcttggtgg agctccccta | |
8770 601 ggagcaccac acatcttgct gcaccgactg gacagcgcgc tgggacgtcg ggtagggacc | |
8771 661 atcctcaagc acctcttccc tgttccccgg ccccagaccc gccgcgtggt gacttttgcc | |
8772 721 aacgaagatg acgtcatcct tgtccggaac catgtttacc gtcgccaggg gaagacagtg | |
8773 781 gagctagagg aggtgggacc ccgcttccag ctacgcccct acctgatccg ccttgggacc | |
8774 841 ctggagcaag gggatgccgc tgatgtggaa tggcgttggc acccctacac caccactgcc | |
8775 901 cgcaagcgcc agctgctgag tctcacctga gtgttgtcac ctcctgttgc ctgaactact | |
8776 961 ggcattctgc tggctcagat gacattttca ataatatata tttttccact ttttccacac | |
8777 1021 caaaa | |
8778 // | |
8779 | |
8780 LOCUS NM_001277631 1133 bp mRNA linear VRT 04-JAN-2017 | |
8781 DEFINITION Gallus gallus RNA polymerase I subunit C (POLR1C), transcript | |
8782 variant 2, mRNA. | |
8783 ACCESSION NM_001277631 | |
8784 VERSION NM_001277631.1 | |
8785 KEYWORDS RefSeq. | |
8786 SOURCE Gallus gallus (chicken) | |
8787 ORGANISM Gallus gallus | |
8788 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
8789 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
8790 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
8791 Phasianidae; Phasianinae; Gallus. | |
8792 REFERENCE 1 (bases 1 to 1133) | |
8793 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
8794 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
8795 TITLE A comprehensive collection of chicken cDNAs | |
8796 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
8797 PUBMED 12445392 | |
8798 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
8799 preliminary review. The reference sequence was derived from | |
8800 AADN04000139.1, BX929977.2, AJ444864.1 and BU338692.1. | |
8801 | |
8802 Transcript Variant: This variant (2) lacks an alternate in-frame | |
8803 exon compared to variant 1. The resulting protein (isoform 2) is | |
8804 shorter compared to isoform 1. | |
8805 | |
8806 Sequence Note: This RefSeq record was created from transcript and | |
8807 genomic sequence data from different strains because no single | |
8808 transcript from the same strain was available for the full length | |
8809 of the gene. The extent of this transcript is supported by | |
8810 transcript alignments and orthologous data. | |
8811 | |
8812 ##Evidence-Data-START## | |
8813 Transcript exon combination :: BX929977.2, BU229232.1 [ECO:0000332] | |
8814 RNAseq introns :: single sample supports all introns | |
8815 SAMN03354475, SAMN03354491 | |
8816 [ECO:0000348] | |
8817 ##Evidence-Data-END## | |
8818 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
8819 1-16 AADN04000139.1 1602039-1602054 | |
8820 17-353 BX929977.2 1-337 | |
8821 354-394 AJ444864.1 41-81 | |
8822 395-722 BX929977.2 379-706 | |
8823 723-760 AJ444864.1 530-567 | |
8824 761-917 BX929977.2 745-901 | |
8825 918-1128 BU338692.1 396-606 | |
8826 1129-1133 AADN04000139.1 1605359-1605363 | |
8827 FEATURES Location/Qualifiers | |
8828 source 1..1133 | |
8829 /organism="Gallus gallus" | |
8830 /mol_type="mRNA" | |
8831 /db_xref="taxon:9031" | |
8832 /chromosome="3" | |
8833 /map="3" | |
8834 /breed="Red Jungle Fowl" | |
8835 gene 1..1133 | |
8836 /gene="POLR1C" | |
8837 /note="RNA polymerase I subunit C" | |
8838 /db_xref="CGNC:7876" | |
8839 /db_xref="GeneID:421452" | |
8840 CDS 13..933 | |
8841 /gene="POLR1C" | |
8842 /note="isoform 2 is encoded by transcript variant 2; | |
8843 polymerase (RNA) I polypeptide C, 30kDa; polymerase (RNA) | |
8844 I subunit C" | |
8845 /codon_start=1 | |
8846 /product="DNA-directed RNA polymerases I and III subunit | |
8847 RPAC1 isoform 2" | |
8848 /protein_id="NP_001264560.1" | |
8849 /db_xref="CGNC:7876" | |
8850 /db_xref="GeneID:421452" | |
8851 /translation="MAAKRSMDELRERVVLGEFGVRNVHTTDFPGNYPGYDDAWDQRR | |
8852 FEEAFRVDVVREEDGVLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVFVYNNTSIVQ | |
8853 DEILAHRLGLIPIRADPRLFEYRNQVYSKHMTWVPLGNQTDLFPDADFRPVHDDILIA | |
8854 LLRPGQEIDVLMHCVKGIGKDHAKFSPVATASYRLLPDITLLQPVEDEAAETLQKCFS | |
8855 PGVIEIQNIKGKKVARVANARLDTFSREVFRHEGLKNLVRLARVRNHYIFSVESTGIL | |
8856 PPDVLVTEAIKILMGKCQRFLNELDSVPME" | |
8857 ORIGIN | |
8858 1 cttccggcgg cgatggcggc caagaggagc atggacgagt tgagggagcg cgtggtgctg | |
8859 61 ggcgagttcg gcgtccgcaa cgtccacacc accgacttcc ccggcaacta ccccggctac | |
8860 121 gacgacgcgt gggaccagcg gcgcttcgag gaggcgttcc gcgtggacgt ggtgcgggag | |
8861 181 gaggacggcg tgctggagtt cgacatggtg ggcatcgacg cggccatcgc caacgccttc | |
8862 241 cgccgcatcc tgctcgccga ggtgccaacg atggctgtgg agaaagtgtt tgtgtacaac | |
8863 301 aacacgtcca tcgtgcagga tgagatcctg gcgcaccgcc tgggccttat ccccatccgg | |
8864 361 gccgaccctc gactctttga gtacaggaat caagtgtaca gtaagcacat gacatgggtg | |
8865 421 cccttgggga atcagacaga cctctttccg gatgctgact tccgacctgt ccatgatgac | |
8866 481 atcctcatag cactgttgcg acctgggcag gaaatagatg tgctcatgca ctgtgtcaag | |
8867 541 ggcataggta aagatcatgc caagttctct cctgtggcca cagctagtta tcgactgctt | |
8868 601 cctgacatta ctctcctgca gcctgttgag gatgaggcag ccgagacgtt acagaagtgc | |
8869 661 ttttcccctg gagtcattga gatccagaac atcaagggaa aaaaggtggc aagagtagcc | |
8870 721 aacgcacggt tggacacatt cagcagggaa gtcttccgac atgagggtct gaaaaacctt | |
8871 781 gtgcgcctgg caagagtgcg aaatcattac atcttttcag tggagtcgac aggtatcttg | |
8872 841 cctccagatg tgctggtgac cgaagccatc aagatactga tgggaaagtg tcagcgtttc | |
8873 901 ctgaatgaac tggacagcgt gcctatggag tgagcacgct gtagccaaga agcagaaccc | |
8874 961 tgtgctgctg ttttgggctt cctgctccag cctgcaggag tggttcttct gccctaggca | |
8875 1021 tgagttttga gatggatttg ttaagagccc tgggaccatc tctttgaact ggttttgtgt | |
8876 1081 gtgatgagcc tcagtgagga gatgcaccaa aataaaagct ttcttttacc tcc | |
8877 // | |
8878 | |
8879 LOCUS NM_001277630 1253 bp mRNA linear VRT 04-JAN-2017 | |
8880 DEFINITION Gallus gallus RNA polymerase I subunit C (POLR1C), transcript | |
8881 variant 1, mRNA. | |
8882 ACCESSION NM_001277630 XM_001234461 XM_419502 | |
8883 VERSION NM_001277630.1 | |
8884 KEYWORDS RefSeq. | |
8885 SOURCE Gallus gallus (chicken) | |
8886 ORGANISM Gallus gallus | |
8887 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
8888 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
8889 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
8890 Phasianidae; Phasianinae; Gallus. | |
8891 REFERENCE 1 (bases 1 to 1253) | |
8892 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
8893 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
8894 TITLE A comprehensive collection of chicken cDNAs | |
8895 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
8896 PUBMED 12445392 | |
8897 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
8898 preliminary review. The reference sequence was derived from | |
8899 BX934152.2, BU224670.1 and AADN04000139.1. | |
8900 On or before Apr 13, 2013 this sequence version replaced | |
8901 gi:363731836, gi:363731837. | |
8902 | |
8903 Transcript Variant: This variant (1) represents the longer | |
8904 transcript and encodes the longer protein (isoform 1). | |
8905 | |
8906 Sequence Note: This RefSeq record was created from transcript and | |
8907 genomic sequence data from different strains because no single | |
8908 transcript from the same strain was available for the full length | |
8909 of the gene. The extent of this transcript is supported by | |
8910 transcript alignments and orthologous data. | |
8911 | |
8912 ##Evidence-Data-START## | |
8913 Transcript exon combination :: BX934152.2 [ECO:0000332] | |
8914 RNAseq introns :: mixed/partial sample support | |
8915 SAMEA2201357, SAMEA2201358 | |
8916 [ECO:0000350] | |
8917 ##Evidence-Data-END## | |
8918 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
8919 1-1037 BX934152.2 2-1038 | |
8920 1038-1038 BU224670.1 543-543 | |
8921 1039-1229 BX934152.2 1040-1230 | |
8922 1230-1253 AADN04000139.1 1605340-1605363 | |
8923 FEATURES Location/Qualifiers | |
8924 source 1..1253 | |
8925 /organism="Gallus gallus" | |
8926 /mol_type="mRNA" | |
8927 /db_xref="taxon:9031" | |
8928 /chromosome="3" | |
8929 /map="3" | |
8930 gene 1..1253 | |
8931 /gene="POLR1C" | |
8932 /note="RNA polymerase I subunit C" | |
8933 /db_xref="CGNC:7876" | |
8934 /db_xref="GeneID:421452" | |
8935 CDS 13..1053 | |
8936 /gene="POLR1C" | |
8937 /note="isoform 1 is encoded by transcript variant 1; | |
8938 polymerase (RNA) I polypeptide C, 30kDa; polymerase (RNA) | |
8939 I subunit C" | |
8940 /codon_start=1 | |
8941 /product="DNA-directed RNA polymerases I and III subunit | |
8942 RPAC1 isoform 1" | |
8943 /protein_id="NP_001264559.1" | |
8944 /db_xref="CGNC:7876" | |
8945 /db_xref="GeneID:421452" | |
8946 /translation="MAAKRSMDELRERVVLGEFGVRNVHTTDFPGNYPGYDDAWDQRR | |
8947 FEEAFRVDVVREEDGVLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVFVYNNTSIVQ | |
8948 DEILAHRLGLIPIRADPRLFEYRNQGDEEGTEIDTLQFQLKIKCSRNPQAAKESSDPN | |
8949 ELYFNHKVYSKHMTWVPLGNQTDLFPDADFRPVHDDILIALLRPGQEIDVLMHCVKGI | |
8950 GKDHAKFSPVATASYRLLPDITLLQPVEDEAAETLQKCFSPGVIEIQNIKGKKVARVA | |
8951 NARLDTFSREVFRHEGLKNLVRLARVRNHYIFSVESTGILPPDVLVTEAIKILMGKCQ | |
8952 RFLNELDSVPME" | |
8953 ORIGIN | |
8954 1 cttccggcgg cgatggcggc caagaggagc atggacgagt tgagggagcg cgtggtgctg | |
8955 61 ggcgagttcg gcgtccgcaa cgtccacacc accgacttcc ccggcaacta ccccggctac | |
8956 121 gacgacgcgt gggaccagcg gcgcttcgag gaggcgttcc gcgtggacgt ggtgcgggag | |
8957 181 gaggacggcg tgctggagtt cgacatggtg ggcatcgacg cggccatcgc caacgccttc | |
8958 241 cgccgcatcc tgctcgccga ggtgccaacg atggctgtgg agaaagtgtt tgtgtacaac | |
8959 301 aacacgtcca tcgtgcagga tgagatcctg gcgcaccgcc tgggccttat ccccatccgg | |
8960 361 gccgaccctc gactctttga gtacaggaat caaggagatg aagaggggac agaaattgat | |
8961 421 actctgcagt ttcagctgaa aataaaatgc agccggaatc ctcaggcagc caaggaatca | |
8962 481 tctgacccaa atgaactgta tttcaatcac aaagtgtaca gtaagcacat gacatgggtg | |
8963 541 cccttgggga atcagacaga cctctttccg gatgctgact tccgacctgt ccatgatgac | |
8964 601 atcctcatag cactgttgcg acctgggcag gaaatagatg tgctcatgca ctgtgtcaag | |
8965 661 ggcataggta aagatcatgc caagttctct cctgtggcca cagctagtta tcgactgctt | |
8966 721 cctgacatta ctctcctgca gcctgttgag gatgaggcag ccgagacgtt acagaagtgc | |
8967 781 ttttcccctg gagtcattga gatccagaac atcaagggaa aaaaggtggc aagagtagcc | |
8968 841 aacgcacggt tggacacatt cagcagggaa gtcttccgac atgagggtct gaaaaacctt | |
8969 901 gtgcgcctgg caagagtgcg aaatcattac atcttttcag tggagtcgac aggtatcttg | |
8970 961 cctccagatg tgctggtgac cgaagccatc aagatactga tgggaaagtg tcagcgtttc | |
8971 1021 ctgaatgaac tggacagcgt gcctatggag tgagcacgct gtagccaaga agcagaaccc | |
8972 1081 tgtgctgctg ttttgggctt cctgctccag cctgcaggag tggttcttct gccctaggca | |
8973 1141 tgagttttga gatggatttg ttaagagccc tgggaccatc tctttgaact ggttttgtgt | |
8974 1201 gtgatgagcc tcagtgagga gatgcaccaa aataaaagct ttcttttacc tcc | |
8975 // | |
8976 | |
8977 LOCUS NM_001271966 1033 bp mRNA linear VRT 04-JAN-2017 | |
8978 DEFINITION Gallus gallus calcitonin related polypeptide alpha (CALCA), | |
8979 transcript variant 4, mRNA. | |
8980 ACCESSION NM_001271966 | |
8981 VERSION NM_001271966.1 | |
8982 KEYWORDS RefSeq. | |
8983 SOURCE Gallus gallus (chicken) | |
8984 ORGANISM Gallus gallus | |
8985 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
8986 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
8987 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
8988 Phasianidae; Phasianinae; Gallus. | |
8989 REFERENCE 1 (bases 1 to 1033) | |
8990 AUTHORS Nakagawa-Mizuyachi K, Takahashi T and Kawashima M. | |
8991 TITLE Calcitonin directly increases adrenocorticotropic | |
8992 hormone-stimulated corticosterone production in the hen adrenal | |
8993 gland | |
8994 JOURNAL Poult. Sci. 88 (10), 2199-2205 (2009) | |
8995 PUBMED 19762876 | |
8996 REMARK GeneRIF: Calcitonin acts directly on adrenocortical cells via its | |
8997 receptor binding and increases responsiveness of ACTH on | |
8998 corticosterone production in the laying hen. | |
8999 REFERENCE 2 (bases 1 to 1033) | |
9000 AUTHORS Krzysik-Walker SM, Ocon-Grove OM, Maddineni SB, Hendricks GL 3rd | |
9001 and Ramachandran R. | |
9002 TITLE Identification of calcitonin expression in the chicken ovary: | |
9003 influence of follicular maturation and ovarian steroids | |
9004 JOURNAL Biol. Reprod. 77 (4), 626-635 (2007) | |
9005 PUBMED 17582014 | |
9006 REMARK GeneRIF: Ovarian CALCA is possibly involved in regulating | |
9007 follicular maturation in the chicken ovary. | |
9008 REFERENCE 3 (bases 1 to 1033) | |
9009 AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R, | |
9010 Burnside J, Aggrey SE, Simon J and Cogburn LA. | |
9011 TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs | |
9012 from single and multiple tissue cDNA libraries and CAP3 assembly of | |
9013 a chicken gene index | |
9014 JOURNAL Physiol. Genomics 25 (3), 514-524 (2006) | |
9015 PUBMED 16554550 | |
9016 REFERENCE 4 (bases 1 to 1033) | |
9017 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
9018 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
9019 TITLE A comprehensive collection of chicken cDNAs | |
9020 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
9021 PUBMED 12445392 | |
9022 REFERENCE 5 (bases 1 to 1033) | |
9023 AUTHORS Tirunagaru VG, Sofer L, Cui J and Burnside J. | |
9024 TITLE An expressed sequence tag database of T-cell-enriched activated | |
9025 chicken splenocytes: sequence analysis of 5251 clones | |
9026 JOURNAL Genomics 66 (2), 144-151 (2000) | |
9027 PUBMED 10860659 | |
9028 REFERENCE 6 (bases 1 to 1033) | |
9029 AUTHORS Minvielle S, Cressent M, Delehaye MC, Segond N, Milhaud G, | |
9030 Jullienne A, Moukhtar MS and Lasmoles F. | |
9031 TITLE Sequence and expression of the chicken calcitonin gene | |
9032 JOURNAL FEBS Lett. 223 (1), 63-68 (1987) | |
9033 PUBMED 3666142 | |
9034 REFERENCE 7 (bases 1 to 1033) | |
9035 AUTHORS Homma,T., Watanabe,M., Hirose,S., Kanai,A., Kangawa,K. and | |
9036 Matsuo,H. | |
9037 TITLE Isolation and determination of the amino acid sequence of chicken | |
9038 calcitonin I from chicken ultimobranchial glands | |
9039 JOURNAL J. Biochem. 100 (2), 459-467 (1986) | |
9040 PUBMED 3782060 | |
9041 REFERENCE 8 (bases 1 to 1033) | |
9042 AUTHORS Minvielle,S., Cressent,M., Lasmoles,F., Jullienne,A., Milhaud,G. | |
9043 and Moukhtar,M.S. | |
9044 TITLE Isolation and partial characterization of the calcitonin gene in a | |
9045 lower vertebrate. Predicted structure of avian calcitonin | |
9046 gene-related peptide | |
9047 JOURNAL FEBS Lett. 203 (1), 7-10 (1986) | |
9048 PUBMED 3487468 | |
9049 REFERENCE 9 (bases 1 to 1033) | |
9050 AUTHORS Lasmoles,F., Jullienne,A., Day,F., Minvielle,S., Milhaud,G. and | |
9051 Moukhtar,M.S. | |
9052 TITLE Elucidation of the nucleotide sequence of chicken calcitonin mRNA: | |
9053 direct evidence for the expression of a lower vertebrate | |
9054 calcitonin-like gene in man and rat | |
9055 JOURNAL EMBO J. 4 (10), 2603-2607 (1985) | |
9056 PUBMED 4054101 | |
9057 REFERENCE 10 (bases 1 to 1033) | |
9058 AUTHORS Lasmoles,F., Jullienne,A., Desplan,C., Milhaud,G. and Moukhtar,M.S. | |
9059 TITLE Structure of chicken calcitonin predicted by partial nucleotide | |
9060 sequence of its precursor | |
9061 JOURNAL FEBS Lett. 180 (1), 113-116 (1985) | |
9062 PUBMED 3838160 | |
9063 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
9064 preliminary review. The reference sequence was derived from | |
9065 AADN04000235.1, BU262345.1 and AI980061.1. | |
9066 | |
9067 Transcript Variant: This variant (4) differs in the 5' UTR and | |
9068 includes an alternate 3' coding region and 3' UTR, compared to | |
9069 variant 1. The encoded isoform (3) is shorter and has a distinct | |
9070 C-terminus, compared to isoform 1. This isoform is cleaved to yield | |
9071 calcitonin gene-related peptide (CGRP). | |
9072 | |
9073 Sequence Note: This RefSeq record was created from transcripts and | |
9074 genomic sequence data because no single transcript from the same | |
9075 breed was available for the full length of the gene. The extent of | |
9076 this transcript is supported by transcript alignments. | |
9077 | |
9078 ##Evidence-Data-START## | |
9079 Transcript exon combination :: BU262345.1 [ECO:0000332] | |
9080 RNAseq introns :: single sample supports all introns | |
9081 SAMEA2201366, SAMEA2201368 | |
9082 [ECO:0000348] | |
9083 ##Evidence-Data-END## | |
9084 COMPLETENESS: complete on the 3' end. | |
9085 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
9086 1-117 AADN04000235.1 2647646-2647762 | |
9087 118-626 BU262345.1 115-623 | |
9088 627-635 AADN04000235.1 2659325-2659333 | |
9089 636-1003 AI980061.1 1-368 | |
9090 1004-1033 AADN04000235.1 2659702-2659731 | |
9091 FEATURES Location/Qualifiers | |
9092 source 1..1033 | |
9093 /organism="Gallus gallus" | |
9094 /mol_type="mRNA" | |
9095 /db_xref="taxon:9031" | |
9096 /chromosome="5" | |
9097 /map="5" | |
9098 /breed="Red Jungle Fowl" | |
9099 gene 1..1033 | |
9100 /gene="CALCA" | |
9101 /gene_synonym="CALC; CGRP" | |
9102 /note="calcitonin related polypeptide alpha" | |
9103 /db_xref="CGNC:49721" | |
9104 /db_xref="GeneID:396256" | |
9105 misc_feature 60..62 | |
9106 /gene="CALCA" | |
9107 /gene_synonym="CALC; CGRP" | |
9108 /note="upstream in-frame stop codon" | |
9109 CDS 144..521 | |
9110 /gene="CALCA" | |
9111 /gene_synonym="CALC; CGRP" | |
9112 /note="isoform 3 preproprotein is encoded by transcript | |
9113 variant 4; calcitonin gene-related peptide; | |
9114 calcitonin/calcitonin-related polypeptide, alpha" | |
9115 /codon_start=1 | |
9116 /product="calcitonin gene-related peptide isoform 3 | |
9117 preproprotein" | |
9118 /protein_id="NP_001258895.1" | |
9119 /db_xref="CGNC:49721" | |
9120 /db_xref="GeneID:396256" | |
9121 /translation="MVMLKISSFLAVYALVVCQMDSFQAAPVRPGLESITDRVTLSDY | |
9122 EARRLLNALVKEFIQMTAEELEQASEGNSVTAQKRACNTATCVTHRLADFLSRSGGVG | |
9123 KNNFVPTNVGSKAFGRRRRSVQI" | |
9124 sig_peptide 144..218 | |
9125 /gene="CALCA" | |
9126 /gene_synonym="CALC; CGRP" | |
9127 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
9128 mat_peptide 381..491 | |
9129 /gene="CALCA" | |
9130 /gene_synonym="CALC; CGRP" | |
9131 /product="Calcitonin gene-related peptide" | |
9132 /experiment="experimental evidence, no additional details | |
9133 recorded" | |
9134 /note="propagated from UniProtKB/Swiss-Prot (P10286.2)" | |
9135 misc_feature 489..491 | |
9136 /gene="CALCA" | |
9137 /gene_synonym="CALC; CGRP" | |
9138 /experiment="experimental evidence, no additional details | |
9139 recorded" | |
9140 /note="Phenylalanine amide. {ECO:0000250}; propagated from | |
9141 UniProtKB/Swiss-Prot (P10286.2); amidation site" | |
9142 ORIGIN | |
9143 1 gcgtctgatg aggagttact gacttgagag cacgtggcct ggaggctgag gatggcccct | |
9144 61 gatgctgttc agaaggcagg cgaagacgaa atcaagcaca gcaaaagcat cgctttgaga | |
9145 121 gcatagagaa gagagaggaa atcatggtca tgctgaagat ttcatctttc cttgctgttt | |
9146 181 atgccttggt tgtgtgccag atggacagct tccaggcagc cccagtcaga cctggcttgg | |
9147 241 agtccatcac agatcgagtg acgctcagtg attacgaagc tcggagatta ttaaatgcgc | |
9148 301 tggtgaaaga gttcatacag atgacggcag aagagctgga gcaagcctct gaggggaaca | |
9149 361 gcgtaacagc acagaaaagg gcatgcaaca cagctacctg cgtgacccat cgtctggcag | |
9150 421 acttcctgag caggtcagga ggagtgggca agaacaactt tgtcccaacc aacgtgggct | |
9151 481 ctaaggcttt cggcaggcga agaagaagcg ttcaaatata agaagctgaa tgacaacatg | |
9152 541 cctacggttg atgtgcaatt gaagactcaa cttcaatttc taatgaatgg aactcttctc | |
9153 601 cacaaatcaa gacagccaaa aagaagatta attttgcatc ctaatattga aagcattttg | |
9154 661 tttaagatga aaatgagaac acttctgtta tgtatagtac aagggactca agttattcaa | |
9155 721 gttaaattat tgtatattct ttttatatgc aactccattt caaataaaat gtgacagcat | |
9156 781 ctattattta tttatcttct agcatatatg tgatccatgc tatttatcct ggcactgctg | |
9157 841 ccaaaactcg gggagttata ctgaactgct gcctagcgag gcgtgtgtgt ataacatggt | |
9158 901 gtgctgtgcc ttggtgttaa acacttaact aacctgattg tacagtatgt ttaaaagcaa | |
9159 961 aacaaaagcc aacctcttaa ctattgtatc atttgtgaat ttaagcaaaa ttaaaaaaaa | |
9160 1021 gtatttttag ata | |
9161 // | |
9162 | |
9163 LOCUS NM_001271965 1036 bp mRNA linear VRT 04-JAN-2017 | |
9164 DEFINITION Gallus gallus calcitonin related polypeptide alpha (CALCA), | |
9165 transcript variant 3, mRNA. | |
9166 ACCESSION NM_001271965 | |
9167 VERSION NM_001271965.1 | |
9168 KEYWORDS RefSeq. | |
9169 SOURCE Gallus gallus (chicken) | |
9170 ORGANISM Gallus gallus | |
9171 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
9172 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
9173 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
9174 Phasianidae; Phasianinae; Gallus. | |
9175 REFERENCE 1 (bases 1 to 1036) | |
9176 AUTHORS Nakagawa-Mizuyachi K, Takahashi T and Kawashima M. | |
9177 TITLE Calcitonin directly increases adrenocorticotropic | |
9178 hormone-stimulated corticosterone production in the hen adrenal | |
9179 gland | |
9180 JOURNAL Poult. Sci. 88 (10), 2199-2205 (2009) | |
9181 PUBMED 19762876 | |
9182 REMARK GeneRIF: Calcitonin acts directly on adrenocortical cells via its | |
9183 receptor binding and increases responsiveness of ACTH on | |
9184 corticosterone production in the laying hen. | |
9185 REFERENCE 2 (bases 1 to 1036) | |
9186 AUTHORS Krzysik-Walker SM, Ocon-Grove OM, Maddineni SB, Hendricks GL 3rd | |
9187 and Ramachandran R. | |
9188 TITLE Identification of calcitonin expression in the chicken ovary: | |
9189 influence of follicular maturation and ovarian steroids | |
9190 JOURNAL Biol. Reprod. 77 (4), 626-635 (2007) | |
9191 PUBMED 17582014 | |
9192 REMARK GeneRIF: Ovarian CALCA is possibly involved in regulating | |
9193 follicular maturation in the chicken ovary. | |
9194 REFERENCE 3 (bases 1 to 1036) | |
9195 AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R, | |
9196 Burnside J, Aggrey SE, Simon J and Cogburn LA. | |
9197 TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs | |
9198 from single and multiple tissue cDNA libraries and CAP3 assembly of | |
9199 a chicken gene index | |
9200 JOURNAL Physiol. Genomics 25 (3), 514-524 (2006) | |
9201 PUBMED 16554550 | |
9202 REFERENCE 4 (bases 1 to 1036) | |
9203 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
9204 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
9205 TITLE A comprehensive collection of chicken cDNAs | |
9206 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
9207 PUBMED 12445392 | |
9208 REFERENCE 5 (bases 1 to 1036) | |
9209 AUTHORS Tirunagaru VG, Sofer L, Cui J and Burnside J. | |
9210 TITLE An expressed sequence tag database of T-cell-enriched activated | |
9211 chicken splenocytes: sequence analysis of 5251 clones | |
9212 JOURNAL Genomics 66 (2), 144-151 (2000) | |
9213 PUBMED 10860659 | |
9214 REFERENCE 6 (bases 1 to 1036) | |
9215 AUTHORS Minvielle S, Cressent M, Delehaye MC, Segond N, Milhaud G, | |
9216 Jullienne A, Moukhtar MS and Lasmoles F. | |
9217 TITLE Sequence and expression of the chicken calcitonin gene | |
9218 JOURNAL FEBS Lett. 223 (1), 63-68 (1987) | |
9219 PUBMED 3666142 | |
9220 REFERENCE 7 (bases 1 to 1036) | |
9221 AUTHORS Homma,T., Watanabe,M., Hirose,S., Kanai,A., Kangawa,K. and | |
9222 Matsuo,H. | |
9223 TITLE Isolation and determination of the amino acid sequence of chicken | |
9224 calcitonin I from chicken ultimobranchial glands | |
9225 JOURNAL J. Biochem. 100 (2), 459-467 (1986) | |
9226 PUBMED 3782060 | |
9227 REFERENCE 8 (bases 1 to 1036) | |
9228 AUTHORS Minvielle,S., Cressent,M., Lasmoles,F., Jullienne,A., Milhaud,G. | |
9229 and Moukhtar,M.S. | |
9230 TITLE Isolation and partial characterization of the calcitonin gene in a | |
9231 lower vertebrate. Predicted structure of avian calcitonin | |
9232 gene-related peptide | |
9233 JOURNAL FEBS Lett. 203 (1), 7-10 (1986) | |
9234 PUBMED 3487468 | |
9235 REFERENCE 9 (bases 1 to 1036) | |
9236 AUTHORS Lasmoles,F., Jullienne,A., Day,F., Minvielle,S., Milhaud,G. and | |
9237 Moukhtar,M.S. | |
9238 TITLE Elucidation of the nucleotide sequence of chicken calcitonin mRNA: | |
9239 direct evidence for the expression of a lower vertebrate | |
9240 calcitonin-like gene in man and rat | |
9241 JOURNAL EMBO J. 4 (10), 2603-2607 (1985) | |
9242 PUBMED 4054101 | |
9243 REFERENCE 10 (bases 1 to 1036) | |
9244 AUTHORS Lasmoles,F., Jullienne,A., Desplan,C., Milhaud,G. and Moukhtar,M.S. | |
9245 TITLE Structure of chicken calcitonin predicted by partial nucleotide | |
9246 sequence of its precursor | |
9247 JOURNAL FEBS Lett. 180 (1), 113-116 (1985) | |
9248 PUBMED 3838160 | |
9249 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
9250 preliminary review. The reference sequence was derived from | |
9251 BU262345.1, BU203257.1, AADN04000235.1 and AI980061.1. | |
9252 | |
9253 Transcript Variant: This variant (3) differs in the 5' UTR and | |
9254 includes an alternate 3' coding region and 3' UTR, compared to | |
9255 variant 1. The encoded isoform (2) is shorter and has a distinct | |
9256 C-terminus, compared to isoform 1. This isoform is cleaved to yield | |
9257 calcitonin gene-related peptide (CGRP). | |
9258 | |
9259 Sequence Note: This RefSeq record was created from transcripts and | |
9260 genomic sequence data because no single transcript from the same | |
9261 breed was available for the full length of the gene. The extent of | |
9262 this transcript is supported by transcript alignments. | |
9263 | |
9264 ##Evidence-Data-START## | |
9265 Transcript exon combination :: BU213401.1, BU203257.1 [ECO:0000332] | |
9266 RNAseq introns :: single sample supports all introns | |
9267 SAMEA2201366, SAMEA2201375 | |
9268 [ECO:0000348] | |
9269 ##Evidence-Data-END## | |
9270 COMPLETENESS: complete on the 3' end. | |
9271 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
9272 1-1 BU262345.1 1-1 | |
9273 2-65 BU203257.1 3-66 | |
9274 66-70 AADN04000235.1 2647711-2647715 | |
9275 71-211 BU203257.1 73-213 | |
9276 212-213 AADN04000235.1 2655456-2655457 | |
9277 214-728 BU203257.1 217-731 | |
9278 729-1006 AI980061.1 91-368 | |
9279 1007-1036 AADN04000235.1 2659702-2659731 | |
9280 FEATURES Location/Qualifiers | |
9281 source 1..1036 | |
9282 /organism="Gallus gallus" | |
9283 /mol_type="mRNA" | |
9284 /db_xref="taxon:9031" | |
9285 /chromosome="5" | |
9286 /map="5" | |
9287 /breed="Leghorn" | |
9288 gene 1..1036 | |
9289 /gene="CALCA" | |
9290 /gene_synonym="CALC; CGRP" | |
9291 /note="calcitonin related polypeptide alpha" | |
9292 /db_xref="CGNC:49721" | |
9293 /db_xref="GeneID:396256" | |
9294 misc_feature 60..62 | |
9295 /gene="CALCA" | |
9296 /gene_synonym="CALC; CGRP" | |
9297 /note="upstream in-frame stop codon" | |
9298 CDS 144..524 | |
9299 /gene="CALCA" | |
9300 /gene_synonym="CALC; CGRP" | |
9301 /note="isoform 2 preproprotein is encoded by transcript | |
9302 variant 3; calcitonin gene-related peptide; | |
9303 calcitonin/calcitonin-related polypeptide, alpha" | |
9304 /codon_start=1 | |
9305 /product="calcitonin gene-related peptide isoform 2 | |
9306 preproprotein" | |
9307 /protein_id="NP_001258894.1" | |
9308 /db_xref="CGNC:49721" | |
9309 /db_xref="GeneID:396256" | |
9310 /translation="MVMLKISSFLAVYALVVCQMDSFQAAPVRPGLESITDRVTLSDY | |
9311 EARRLLNALVKEFIQMTAEELEQASEGNSSVTAQKRACNTATCVTHRLADFLSRSGGV | |
9312 GKNNFVPTNVGSKAFGRRRRSVQI" | |
9313 sig_peptide 144..218 | |
9314 /gene="CALCA" | |
9315 /gene_synonym="CALC; CGRP" | |
9316 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
9317 mat_peptide 384..494 | |
9318 /gene="CALCA" | |
9319 /gene_synonym="CALC; CGRP" | |
9320 /product="Calcitonin gene-related peptide" | |
9321 /experiment="experimental evidence, no additional details | |
9322 recorded" | |
9323 /note="propagated from UniProtKB/Swiss-Prot (P10286.2)" | |
9324 misc_feature 492..494 | |
9325 /gene="CALCA" | |
9326 /gene_synonym="CALC; CGRP" | |
9327 /experiment="experimental evidence, no additional details | |
9328 recorded" | |
9329 /note="Phenylalanine amide. {ECO:0000250}; propagated from | |
9330 UniProtKB/Swiss-Prot (P10286.2); amidation site" | |
9331 ORIGIN | |
9332 1 gcgtctgatg aggagttact gacttgagag cacgtggcct ggaggctgag gatggcccct | |
9333 61 gatgctgttc agaaggcagg cgaagacgaa atcaagcaca gcaaaagcat cgctttgaga | |
9334 121 gcatagagaa gagagaggaa atcatggtca tgctgaagat ttcatctttc cttgctgttt | |
9335 181 atgccttggt tgtgtgccag atggacagct tccaggcagc cccagtcaga cctggcttgg | |
9336 241 agtccatcac agatcgagtg acgctcagtg attacgaagc tcggagatta ttaaatgcgc | |
9337 301 tggtgaaaga gttcatacag atgacggcag aagagctgga gcaagcctct gaggggaaca | |
9338 361 gcagcgtaac agcacagaaa agggcatgca acacagctac ctgcgtgacc catcgtctgg | |
9339 421 cagacttcct gagcaggtca ggaggagtgg gcaagaacaa ctttgtccca accaacgtgg | |
9340 481 gctctaaggc tttcggcagg cgaagaagaa gcgttcaaat ataagaagct gaatgacaac | |
9341 541 atgcctacgg ttgatgtgca attgaagact caacttcaat ttctaatgaa tggaactctt | |
9342 601 ctccacaaat caagacagcc aaaaagaaga ttaattttgc atcctaatat tgaaagcatt | |
9343 661 ttgtttaaga tgaaaatgag aacacttctg ttatgtatag tacaagggac tcaagttatt | |
9344 721 caagttaaat tattgtatat tctttttata tgcaactcca tttcaaataa aatgtgacag | |
9345 781 catctattat ttatttatct tctagcatat atgtgatcca tgctatttat cctggcactg | |
9346 841 ctgccaaaac tcggggagtt atactgaact gctgcctagc gaggcgtgtg tgtataacat | |
9347 901 ggtgtgctgt gccttggtgt taaacactta actaacctga ttgtacagta tgtttaaaag | |
9348 961 caaaacaaaa gccaacctct taactattgt atcatttgtg aatttaagca aaattaaaaa | |
9349 1021 aaagtatttt tagata | |
9350 // | |
9351 | |
9352 LOCUS NM_001271964 912 bp mRNA linear VRT 04-JAN-2017 | |
9353 DEFINITION Gallus gallus calcitonin related polypeptide alpha (CALCA), | |
9354 transcript variant 2, mRNA. | |
9355 ACCESSION NM_001271964 | |
9356 VERSION NM_001271964.1 | |
9357 KEYWORDS RefSeq. | |
9358 SOURCE Gallus gallus (chicken) | |
9359 ORGANISM Gallus gallus | |
9360 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
9361 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
9362 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
9363 Phasianidae; Phasianinae; Gallus. | |
9364 REFERENCE 1 (bases 1 to 912) | |
9365 AUTHORS Nakagawa-Mizuyachi K, Takahashi T and Kawashima M. | |
9366 TITLE Calcitonin directly increases adrenocorticotropic | |
9367 hormone-stimulated corticosterone production in the hen adrenal | |
9368 gland | |
9369 JOURNAL Poult. Sci. 88 (10), 2199-2205 (2009) | |
9370 PUBMED 19762876 | |
9371 REMARK GeneRIF: Calcitonin acts directly on adrenocortical cells via its | |
9372 receptor binding and increases responsiveness of ACTH on | |
9373 corticosterone production in the laying hen. | |
9374 REFERENCE 2 (bases 1 to 912) | |
9375 AUTHORS Krzysik-Walker SM, Ocon-Grove OM, Maddineni SB, Hendricks GL 3rd | |
9376 and Ramachandran R. | |
9377 TITLE Identification of calcitonin expression in the chicken ovary: | |
9378 influence of follicular maturation and ovarian steroids | |
9379 JOURNAL Biol. Reprod. 77 (4), 626-635 (2007) | |
9380 PUBMED 17582014 | |
9381 REMARK GeneRIF: Ovarian CALCA is possibly involved in regulating | |
9382 follicular maturation in the chicken ovary. | |
9383 REFERENCE 3 (bases 1 to 912) | |
9384 AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R, | |
9385 Burnside J, Aggrey SE, Simon J and Cogburn LA. | |
9386 TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs | |
9387 from single and multiple tissue cDNA libraries and CAP3 assembly of | |
9388 a chicken gene index | |
9389 JOURNAL Physiol. Genomics 25 (3), 514-524 (2006) | |
9390 PUBMED 16554550 | |
9391 REFERENCE 4 (bases 1 to 912) | |
9392 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
9393 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
9394 TITLE A comprehensive collection of chicken cDNAs | |
9395 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
9396 PUBMED 12445392 | |
9397 REFERENCE 5 (bases 1 to 912) | |
9398 AUTHORS Tirunagaru VG, Sofer L, Cui J and Burnside J. | |
9399 TITLE An expressed sequence tag database of T-cell-enriched activated | |
9400 chicken splenocytes: sequence analysis of 5251 clones | |
9401 JOURNAL Genomics 66 (2), 144-151 (2000) | |
9402 PUBMED 10860659 | |
9403 REFERENCE 6 (bases 1 to 912) | |
9404 AUTHORS Minvielle S, Cressent M, Delehaye MC, Segond N, Milhaud G, | |
9405 Jullienne A, Moukhtar MS and Lasmoles F. | |
9406 TITLE Sequence and expression of the chicken calcitonin gene | |
9407 JOURNAL FEBS Lett. 223 (1), 63-68 (1987) | |
9408 PUBMED 3666142 | |
9409 REFERENCE 7 (bases 1 to 912) | |
9410 AUTHORS Homma,T., Watanabe,M., Hirose,S., Kanai,A., Kangawa,K. and | |
9411 Matsuo,H. | |
9412 TITLE Isolation and determination of the amino acid sequence of chicken | |
9413 calcitonin I from chicken ultimobranchial glands | |
9414 JOURNAL J. Biochem. 100 (2), 459-467 (1986) | |
9415 PUBMED 3782060 | |
9416 REFERENCE 8 (bases 1 to 912) | |
9417 AUTHORS Minvielle,S., Cressent,M., Lasmoles,F., Jullienne,A., Milhaud,G. | |
9418 and Moukhtar,M.S. | |
9419 TITLE Isolation and partial characterization of the calcitonin gene in a | |
9420 lower vertebrate. Predicted structure of avian calcitonin | |
9421 gene-related peptide | |
9422 JOURNAL FEBS Lett. 203 (1), 7-10 (1986) | |
9423 PUBMED 3487468 | |
9424 REFERENCE 9 (bases 1 to 912) | |
9425 AUTHORS Lasmoles,F., Jullienne,A., Day,F., Minvielle,S., Milhaud,G. and | |
9426 Moukhtar,M.S. | |
9427 TITLE Elucidation of the nucleotide sequence of chicken calcitonin mRNA: | |
9428 direct evidence for the expression of a lower vertebrate | |
9429 calcitonin-like gene in man and rat | |
9430 JOURNAL EMBO J. 4 (10), 2603-2607 (1985) | |
9431 PUBMED 4054101 | |
9432 REFERENCE 10 (bases 1 to 912) | |
9433 AUTHORS Lasmoles,F., Jullienne,A., Desplan,C., Milhaud,G. and Moukhtar,M.S. | |
9434 TITLE Structure of chicken calcitonin predicted by partial nucleotide | |
9435 sequence of its precursor | |
9436 JOURNAL FEBS Lett. 180 (1), 113-116 (1985) | |
9437 PUBMED 3838160 | |
9438 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
9439 preliminary review. The reference sequence was derived from | |
9440 BU262345.1, BU213401.1, BU335410.1, EU367492.1 and AADN04000235.1. | |
9441 | |
9442 Transcript Variant: This variant (2) differs in the 5' UTR, | |
9443 compared to variant 1. Variants 1 and 2 encode the same isoform | |
9444 (1), which is cleaved to yield calcitonin. | |
9445 | |
9446 Sequence Note: This RefSeq record was created from transcripts and | |
9447 genomic sequence data because no single transcript from the same | |
9448 breed was available for the full length of the gene. The extent of | |
9449 this transcript is supported by transcript alignments. | |
9450 | |
9451 ##Evidence-Data-START## | |
9452 Transcript exon combination :: BU335410.1 [ECO:0000332] | |
9453 RNAseq introns :: single sample supports all introns | |
9454 SAMEA2201361, SAMEA2201362 | |
9455 [ECO:0000348] | |
9456 ##Evidence-Data-END## | |
9457 COMPLETENESS: complete on the 3' end. | |
9458 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
9459 1-1 BU262345.1 1-1 | |
9460 2-103 BU213401.1 1-102 | |
9461 104-186 BU335410.1 1-83 | |
9462 187-560 EU367492.1 44-417 | |
9463 561-912 AADN04000235.1 2656930-2657281 | |
9464 FEATURES Location/Qualifiers | |
9465 source 1..912 | |
9466 /organism="Gallus gallus" | |
9467 /mol_type="mRNA" | |
9468 /db_xref="taxon:9031" | |
9469 /chromosome="5" | |
9470 /map="5" | |
9471 /breed="Leghorn" | |
9472 gene 1..912 | |
9473 /gene="CALCA" | |
9474 /gene_synonym="CALC; CGRP" | |
9475 /note="calcitonin related polypeptide alpha" | |
9476 /db_xref="CGNC:49721" | |
9477 /db_xref="GeneID:396256" | |
9478 misc_feature 60..62 | |
9479 /gene="CALCA" | |
9480 /gene_synonym="CALC; CGRP" | |
9481 /note="upstream in-frame stop codon" | |
9482 CDS 144..560 | |
9483 /gene="CALCA" | |
9484 /gene_synonym="CALC; CGRP" | |
9485 /note="isoform 1 preproprotein is encoded by transcript | |
9486 variant 2; calcitonin gene-related peptide; | |
9487 calcitonin/calcitonin-related polypeptide, alpha" | |
9488 /codon_start=1 | |
9489 /product="calcitonin isoform 1 preproprotein" | |
9490 /protein_id="NP_001258893.1" | |
9491 /db_xref="CGNC:49721" | |
9492 /db_xref="GeneID:396256" | |
9493 /translation="MVMLKISSFLAVYALVVCQMDSFQAAPVRPGLESITDRVTLSDY | |
9494 EARRLLNALVKEFIQMTAEELEQASEGNSLDRPISKRCASLSTCVLGKLSQELHKLQT | |
9495 YPRTDVGAGTPGKKRNVLNDLDHERYANYGETLGNN" | |
9496 sig_peptide 144..218 | |
9497 /gene="CALCA" | |
9498 /gene_synonym="CALC; CGRP" | |
9499 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
9500 misc_feature 480..482 | |
9501 /gene="CALCA" | |
9502 /gene_synonym="CALC; CGRP" | |
9503 /experiment="experimental evidence, no additional details | |
9504 recorded" | |
9505 /note="Proline amide. {ECO:0000250}; propagated from | |
9506 UniProtKB/Swiss-Prot (P07660.2); amidation site" | |
9507 ORIGIN | |
9508 1 gcgtctgatg aggagttact gacttgagag cacgtggcct ggaggctgag gatggcccct | |
9509 61 gatgctgttc agaaggcagg cgaagacgaa atcaagcaca gcaaaagcat cgctttgaga | |
9510 121 gcatagagaa gagagaggaa atcatggtca tgctgaagat ttcatctttc cttgctgttt | |
9511 181 atgccttggt tgtgtgccag atggacagct tccaggcagc cccagtcaga cctggcttgg | |
9512 241 agtccatcac agatcgagtg acgctcagtg attacgaagc tcggagatta ttaaatgcgc | |
9513 301 tggtgaaaga gttcatacag atgacggcag aagagctgga gcaagcctct gaggggaaca | |
9514 361 gcctggatag acctatttcc aaacgctgtg ccagtctgag tacttgtgtg ctgggcaaac | |
9515 421 tgtctcaaga attgcacaaa ttgcaaactt accctcgtac tgacgtcggg gctggaactc | |
9516 481 ctggcaagaa aagaaatgtg ctgaatgacc tggaccatga acgctatgca aactatgggg | |
9517 541 aaaccctagg aaacaactag acgtgcttaa ttccgccctt ctccccccct cttttttttt | |
9518 601 ttttttcctt aacctgatgc atgtcgatct aactttgatt gctaactctg ctatgttctt | |
9519 661 ttgattctgt ttttgacaga gaatgtttga ggtggaccta atgttaggaa gacagaacat | |
9520 721 aacacacaca tcaagctagg ggaaaaataa atacaaatag acagcgctgc ctcgatttca | |
9521 781 aataatctta gatattgatt tttaaaaaca aatctagacg aggctcttca tttctggcta | |
9522 841 ctaaatgtac acgtagactc tttttgtgcc tgcccatgca cttgttcaat aaacctattt | |
9523 901 ttctataagg at | |
9524 // | |
9525 | |
9526 LOCUS NM_001113708 843 bp mRNA linear VRT 04-JAN-2017 | |
9527 DEFINITION Gallus gallus calcitonin related polypeptide alpha (CALCA), | |
9528 transcript variant 1, mRNA. | |
9529 ACCESSION NM_001113708 XM_420997 | |
9530 VERSION NM_001113708.1 | |
9531 KEYWORDS RefSeq. | |
9532 SOURCE Gallus gallus (chicken) | |
9533 ORGANISM Gallus gallus | |
9534 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
9535 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
9536 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
9537 Phasianidae; Phasianinae; Gallus. | |
9538 REFERENCE 1 (bases 1 to 843) | |
9539 AUTHORS Nakagawa-Mizuyachi K, Takahashi T and Kawashima M. | |
9540 TITLE Calcitonin directly increases adrenocorticotropic | |
9541 hormone-stimulated corticosterone production in the hen adrenal | |
9542 gland | |
9543 JOURNAL Poult. Sci. 88 (10), 2199-2205 (2009) | |
9544 PUBMED 19762876 | |
9545 REMARK GeneRIF: Calcitonin acts directly on adrenocortical cells via its | |
9546 receptor binding and increases responsiveness of ACTH on | |
9547 corticosterone production in the laying hen. | |
9548 REFERENCE 2 (bases 1 to 843) | |
9549 AUTHORS Krzysik-Walker SM, Ocon-Grove OM, Maddineni SB, Hendricks GL 3rd | |
9550 and Ramachandran R. | |
9551 TITLE Identification of calcitonin expression in the chicken ovary: | |
9552 influence of follicular maturation and ovarian steroids | |
9553 JOURNAL Biol. Reprod. 77 (4), 626-635 (2007) | |
9554 PUBMED 17582014 | |
9555 REMARK GeneRIF: Ovarian CALCA is possibly involved in regulating | |
9556 follicular maturation in the chicken ovary. | |
9557 REFERENCE 3 (bases 1 to 843) | |
9558 AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R, | |
9559 Burnside J, Aggrey SE, Simon J and Cogburn LA. | |
9560 TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs | |
9561 from single and multiple tissue cDNA libraries and CAP3 assembly of | |
9562 a chicken gene index | |
9563 JOURNAL Physiol. Genomics 25 (3), 514-524 (2006) | |
9564 PUBMED 16554550 | |
9565 REFERENCE 4 (bases 1 to 843) | |
9566 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
9567 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
9568 TITLE A comprehensive collection of chicken cDNAs | |
9569 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
9570 PUBMED 12445392 | |
9571 REFERENCE 5 (bases 1 to 843) | |
9572 AUTHORS Tirunagaru VG, Sofer L, Cui J and Burnside J. | |
9573 TITLE An expressed sequence tag database of T-cell-enriched activated | |
9574 chicken splenocytes: sequence analysis of 5251 clones | |
9575 JOURNAL Genomics 66 (2), 144-151 (2000) | |
9576 PUBMED 10860659 | |
9577 REFERENCE 6 (bases 1 to 843) | |
9578 AUTHORS Minvielle S, Cressent M, Delehaye MC, Segond N, Milhaud G, | |
9579 Jullienne A, Moukhtar MS and Lasmoles F. | |
9580 TITLE Sequence and expression of the chicken calcitonin gene | |
9581 JOURNAL FEBS Lett. 223 (1), 63-68 (1987) | |
9582 PUBMED 3666142 | |
9583 REFERENCE 7 (bases 1 to 843) | |
9584 AUTHORS Homma,T., Watanabe,M., Hirose,S., Kanai,A., Kangawa,K. and | |
9585 Matsuo,H. | |
9586 TITLE Isolation and determination of the amino acid sequence of chicken | |
9587 calcitonin I from chicken ultimobranchial glands | |
9588 JOURNAL J. Biochem. 100 (2), 459-467 (1986) | |
9589 PUBMED 3782060 | |
9590 REFERENCE 8 (bases 1 to 843) | |
9591 AUTHORS Minvielle,S., Cressent,M., Lasmoles,F., Jullienne,A., Milhaud,G. | |
9592 and Moukhtar,M.S. | |
9593 TITLE Isolation and partial characterization of the calcitonin gene in a | |
9594 lower vertebrate. Predicted structure of avian calcitonin | |
9595 gene-related peptide | |
9596 JOURNAL FEBS Lett. 203 (1), 7-10 (1986) | |
9597 PUBMED 3487468 | |
9598 REFERENCE 9 (bases 1 to 843) | |
9599 AUTHORS Lasmoles,F., Jullienne,A., Day,F., Minvielle,S., Milhaud,G. and | |
9600 Moukhtar,M.S. | |
9601 TITLE Elucidation of the nucleotide sequence of chicken calcitonin mRNA: | |
9602 direct evidence for the expression of a lower vertebrate | |
9603 calcitonin-like gene in man and rat | |
9604 JOURNAL EMBO J. 4 (10), 2603-2607 (1985) | |
9605 PUBMED 4054101 | |
9606 REFERENCE 10 (bases 1 to 843) | |
9607 AUTHORS Lasmoles,F., Jullienne,A., Desplan,C., Milhaud,G. and Moukhtar,M.S. | |
9608 TITLE Structure of chicken calcitonin predicted by partial nucleotide | |
9609 sequence of its precursor | |
9610 JOURNAL FEBS Lett. 180 (1), 113-116 (1985) | |
9611 PUBMED 3838160 | |
9612 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
9613 preliminary review. The reference sequence was derived from | |
9614 AADN04000235.1 and BM490287.1. | |
9615 On Dec 20, 2012 this sequence version replaced gi:118091210. | |
9616 | |
9617 Transcript Variant: This variant (1) represents the shortest | |
9618 transcript and encodes the longest isoform (1). Variants 1 and 2 | |
9619 encode the same isoform (1), which is cleaved to yield calcitonin. | |
9620 | |
9621 Sequence Note: This RefSeq record was created from transcripts and | |
9622 genomic sequence data because no single transcript from the same | |
9623 breed was available for the full length of the gene. The extent of | |
9624 this transcript is supported by transcript alignments. | |
9625 | |
9626 ##Evidence-Data-START## | |
9627 Transcript exon combination :: CV890417.1, CV037669.1 [ECO:0000332] | |
9628 RNAseq introns :: single sample supports all introns | |
9629 SAMEA2201357, SAMEA2201361 | |
9630 [ECO:0000348] | |
9631 ##Evidence-Data-END## | |
9632 COMPLETENESS: complete on the 3' end. | |
9633 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
9634 1-9 AADN04000235.1 2654365-2654373 | |
9635 10-467 BM490287.1 1-458 | |
9636 468-843 AADN04000235.1 2656906-2657281 | |
9637 FEATURES Location/Qualifiers | |
9638 source 1..843 | |
9639 /organism="Gallus gallus" | |
9640 /mol_type="mRNA" | |
9641 /db_xref="taxon:9031" | |
9642 /chromosome="5" | |
9643 /map="5" | |
9644 /breed="Red Jungle Fowl" | |
9645 gene 1..843 | |
9646 /gene="CALCA" | |
9647 /gene_synonym="CALC; CGRP" | |
9648 /note="calcitonin related polypeptide alpha" | |
9649 /db_xref="CGNC:49721" | |
9650 /db_xref="GeneID:396256" | |
9651 misc_feature 48..50 | |
9652 /gene="CALCA" | |
9653 /gene_synonym="CALC; CGRP" | |
9654 /note="upstream in-frame stop codon" | |
9655 CDS 75..491 | |
9656 /gene="CALCA" | |
9657 /gene_synonym="CALC; CGRP" | |
9658 /note="isoform 1 preproprotein is encoded by transcript | |
9659 variant 1; calcitonin gene-related peptide; | |
9660 calcitonin/calcitonin-related polypeptide, alpha" | |
9661 /codon_start=1 | |
9662 /product="calcitonin isoform 1 preproprotein" | |
9663 /protein_id="NP_001107180.1" | |
9664 /db_xref="CGNC:49721" | |
9665 /db_xref="GeneID:396256" | |
9666 /translation="MVMLKISSFLAVYALVVCQMDSFQAAPVRPGLESITDRVTLSDY | |
9667 EARRLLNALVKEFIQMTAEELEQASEGNSLDRPISKRCASLSTCVLGKLSQELHKLQT | |
9668 YPRTDVGAGTPGKKRNVLNDLDHERYANYGETLGNN" | |
9669 sig_peptide 75..149 | |
9670 /gene="CALCA" | |
9671 /gene_synonym="CALC; CGRP" | |
9672 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
9673 misc_feature 411..413 | |
9674 /gene="CALCA" | |
9675 /gene_synonym="CALC; CGRP" | |
9676 /experiment="experimental evidence, no additional details | |
9677 recorded" | |
9678 /note="Proline amide. {ECO:0000250}; propagated from | |
9679 UniProtKB/Swiss-Prot (P07660.2); amidation site" | |
9680 ORIGIN | |
9681 1 gcggctcggc ggcagcattc ggcctccgct ccgtgcggca ccgcagctga gacccgcacc | |
9682 61 gccgagagga aatcatggtc atgctgaaga tttcatcttt ccttgctgtt tatgccttgg | |
9683 121 ttgtgtgcca gatggacagc ttccaggcag ccccagtcag acctggcttg gagtccatca | |
9684 181 cagatcgagt gacgctcagt gattacgaag ctcggagatt attaaatgcg ctggtgaaag | |
9685 241 agttcataca gatgacggca gaagagctgg agcaagcctc tgaggggaac agcctggata | |
9686 301 gacctatttc caaacgctgt gccagtctga gtacttgtgt gctgggcaaa ctgtctcaag | |
9687 361 aattgcacaa attgcaaact taccctcgta ctgacgtcgg ggctggaact cctggcaaga | |
9688 421 aaagaaatgt gctgaatgac ctggaccatg aacgctatgc aaactatggg gaaaccctag | |
9689 481 gaaacaacta gacgtgctta attccgccct tctccccccc tctttttttt tttttttcct | |
9690 541 taacctgatg catgtcgatc taactttgat tgctaactct gctatgttct tttgattctg | |
9691 601 tttttgacag agaatgtttg aggtggacct aatgttagga agacagaaca taacacacac | |
9692 661 atcaagctag gggaaaaata aatacaaata gacagcgctg cctcgatttc aaataatctt | |
9693 721 agatattgat ttttaaaaac aaatctagac gaggctcttc atttctggct actaaatgta | |
9694 781 cacgtagact ctttttgtgc ctgcccatgc acttgttcaa taaacctatt tttctataag | |
9695 841 gat | |
9696 // | |
9697 | |
9698 LOCUS NM_001271936 2756 bp mRNA linear VRT 04-JAN-2017 | |
9699 DEFINITION Gallus gallus iron-sulfur cluster assembly 1 (ISCA1), mRNA. | |
9700 ACCESSION NM_001271936 NM_001012946 XM_425036 | |
9701 VERSION NM_001271936.1 | |
9702 KEYWORDS RefSeq. | |
9703 SOURCE Gallus gallus (chicken) | |
9704 ORGANISM Gallus gallus | |
9705 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
9706 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
9707 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
9708 Phasianidae; Phasianinae; Gallus. | |
9709 REFERENCE 1 (bases 1 to 2756) | |
9710 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
9711 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
9712 P, Hayashizaki Y and Buerstedde JM. | |
9713 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
9714 gene function analysis | |
9715 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
9716 PUBMED 15642098 | |
9717 REFERENCE 2 (bases 1 to 2756) | |
9718 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
9719 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
9720 TITLE A comprehensive collection of chicken cDNAs | |
9721 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
9722 PUBMED 12445392 | |
9723 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
9724 preliminary review. The reference sequence was derived from | |
9725 BU398918.1 and AJ720560.1. | |
9726 On Dec 18, 2012 this sequence version replaced gi:61098433. | |
9727 | |
9728 Sequence Note: This RefSeq record was created from transcripts of | |
9729 different breeds because no single transcript from the same breed | |
9730 was available for the full length of the gene. The extent of this | |
9731 transcript is supported by transcript alignments. | |
9732 | |
9733 ##Evidence-Data-START## | |
9734 Transcript exon combination :: AJ720560.1, BU110305.1 [ECO:0000332] | |
9735 RNAseq introns :: single sample supports all introns | |
9736 SAMEA2201368, SAMEA2201375 | |
9737 [ECO:0000348] | |
9738 ##Evidence-Data-END## | |
9739 | |
9740 ##RefSeq-Attributes-START## | |
9741 gene product(s) localized to mito. :: inferred from homology | |
9742 ##RefSeq-Attributes-END## | |
9743 COMPLETENESS: complete on the 3' end. | |
9744 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
9745 1-41 BU398918.1 1-41 | |
9746 42-2756 AJ720560.1 1-2715 | |
9747 FEATURES Location/Qualifiers | |
9748 source 1..2756 | |
9749 /organism="Gallus gallus" | |
9750 /mol_type="mRNA" | |
9751 /db_xref="taxon:9031" | |
9752 /chromosome="Z" | |
9753 /map="Z" | |
9754 /breed="Leghorn" | |
9755 gene 1..2756 | |
9756 /gene="ISCA1" | |
9757 /gene_synonym="HBLD2" | |
9758 /note="iron-sulfur cluster assembly 1" | |
9759 /db_xref="CGNC:9567" | |
9760 /db_xref="GeneID:427463" | |
9761 CDS 95..484 | |
9762 /gene="ISCA1" | |
9763 /gene_synonym="HBLD2" | |
9764 /note="iron sulfur assembly protein IscA; HESB-like | |
9765 domain-containing protein 2" | |
9766 /codon_start=1 | |
9767 /product="iron-sulfur cluster assembly 1 homolog, | |
9768 mitochondrial" | |
9769 /protein_id="NP_001258865.1" | |
9770 /db_xref="CGNC:9567" | |
9771 /db_xref="GeneID:427463" | |
9772 /translation="MASSVVRATVRAVSKRKIQATRAALTLTPSAVQKIKQLLKDQPE | |
9773 HVGVKVGVRTRGCNGLSYTLEYTKSKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYV | |
9774 EDKLSSEFVFNNPNIKGTCGCGESFNI" | |
9775 transit_peptide 95..130 | |
9776 /gene="ISCA1" | |
9777 /gene_synonym="HBLD2" | |
9778 /experiment="experimental evidence, no additional details | |
9779 recorded" | |
9780 /note="Mitochondrion. {ECO:0000255}; propagated from | |
9781 UniProtKB/Swiss-Prot (Q5ZJ74.1)" | |
9782 mat_peptide 131..481 | |
9783 /gene="ISCA1" | |
9784 /gene_synonym="HBLD2" | |
9785 /product="Iron-sulfur cluster assembly 1 homolog, | |
9786 mitochondrial" | |
9787 /experiment="experimental evidence, no additional details | |
9788 recorded" | |
9789 /note="propagated from UniProtKB/Swiss-Prot (Q5ZJ74.1)" | |
9790 ORIGIN | |
9791 1 ggcggatggc ggaagcgcgt cgggaggggt ggtgtcgcgg cgtgacgtcg gtggtgccca | |
9792 61 tggcagaggg cagaggacgg ggtggagggg cgtgatggca tcgtcggtgg tgcgggccac | |
9793 121 ggtgcgcgcc gtcagcaaga ggaagatcca ggccacccgc gccgccctca ctctgacccc | |
9794 181 gtcagccgtc cagaagataa aacaacttct taaagaccag cctgagcatg taggtgtgaa | |
9795 241 agtaggtgtt cgtacaaggg gatgcaatgg actttcttat acattagaat atacaaagtc | |
9796 301 taaaggagac tctgatgaag aagtagttca agatggggtt agagtgttta ttgagaagaa | |
9797 361 agcgcagctg acactcctag gaactgaaat ggactatgta gaagataaat tgtccagtga | |
9798 421 atttgtcttc aataatccaa acattaaagg aacatgtggc tgtggagaaa gctttaacat | |
9799 481 ttgaaatctc aggactactt ctttgacttt aaacatcaca agacacttgc tagttggctt | |
9800 541 tcagaagcag atcaattttc ttcagtttct agggtgtgta aagtctggac accactaagg | |
9801 601 aaaataaagt taagtcatgt tgaatatgta aattgtgtgt taaattgcag cactgatgca | |
9802 661 gttatgctgt aacttgtgat gagttggaat ccgaaaggta agaacagtaa gtgctatcat | |
9803 721 aatgtcactg tacttttaca tgccaaggaa ataaaactct aatattcttt tcctttgcaa | |
9804 781 ttttctttgt ccactccact cattccccat ccagaactga tgcaatctgc aaaagtatat | |
9805 841 tgccagtata ttctgagttg atttaaagga gggaaaaaag aaaaatcacc gtttatagat | |
9806 901 gttttatata cacagacata tggtcttcag tttcaaagtt cactgattat gtaaatgctt | |
9807 961 actttccttt cttagatttc tgatactttc atgtttttat gcgtaggttt tctggtagcc | |
9808 1021 tactttcctc caaatccaga gaagtccaaa aagaagtttg tatattagtg tagtggtagg | |
9809 1081 ctgttgcagc actgcttgta gaaatactca aaaatgtact cactgaattt taatcccgtt | |
9810 1141 ccttgccttg ttgaaggcac agcctatgtt gtacttagtg attttcaaaa acataaaata | |
9811 1201 tattgaggta ctggagtgct aaggcaggat acagcccttg ttcctcacat ttctgttgtt | |
9812 1261 tctttcgtga cttaaatggc agaggtgtta aaaattatcc agattttgat tctgtattca | |
9813 1321 cagaatgtgt ctgtattctc attatgctat ctgtctacca aagccataag ccgctttttc | |
9814 1381 tgggagagaa atcttaactt ttttttaacc gtgcgtgcta ctcgttctgt tagaactcta | |
9815 1441 aactctgctt agtaactgtg tagcactagg atttttcatt tcaaaagctt acagtaacct | |
9816 1501 ctatgtaacg gctaaccaaa ggttaattta gtaacaggaa accactcatc atttaaaaaa | |
9817 1561 aaaaaaaaaa gcttttattg agtaattatt ttaaaaataa ttctgtcagt aattaaaaaa | |
9818 1621 atatatatca gattactcct aattagatta ttccctttct gaagcattgt ttttcaagct | |
9819 1681 gatggtcttc cactggaaat caggcagaag tgtaaacatt tctccaggcc ttccaagagc | |
9820 1741 tgataggaga aaagtacagt tccatccttt tatctttaat ttccctgatt gtctaaagag | |
9821 1801 ggcactgtgc agctaagcta cttccttttg tagacaagat agtatcttgt taatctggga | |
9822 1861 aactaacctg aacacttagt cagaagagtg gagttagaaa gtagaggatt ctggggactg | |
9823 1921 ggctcttagc atcatgtatg cttgcctgta acaacttggc agtagtgaca tactaaagat | |
9824 1981 gtagacttgc agccagttag atctggcttg agaaaatatg tagagacaag aataaaaatg | |
9825 2041 aaaaacttac atcgttcttg atatgtactg cataggaatt gaaggccaga atttccagag | |
9826 2101 ctatagttta atattagatg cttgaatttc agttgtatac tatgtcacct tttggtataa | |
9827 2161 aaacactttt tcctttagta gtcaactgtt atacacagtt actttatttt atacagtaat | |
9828 2221 ccaggagtaa ctggtgtaac actggttagg tgaatttata gtgccgtaaa cgctttcgtc | |
9829 2281 ttgccaaaca aaaatccggt taatgtgata gtatgtctaa aacttcaagc taagggcatt | |
9830 2341 tcttcagatt ggtgtttctg tgctccttgc tagcagataa gaccatgaat gtggtagcac | |
9831 2401 tggtgtttgc taagagtgct ttgactttac tcatttcact tgtttcagtg tgcatctggt | |
9832 2461 tttggggatg tttttggacc tgtgcacaca cattaatctt tttcgtgtgt tttgtgtata | |
9833 2521 tgccttgaat ggaagtttga attttcatac tctcatgaaa taatctttta aaatgtgtta | |
9834 2581 atttactgac ccataacgca cagtctgtta aagtaagctt ctgcttaagt gctatttact | |
9835 2641 gttctatagg cacatggttt tgtcagttga tacaattttg tgcaatactg tatgtagagt | |
9836 2701 tctgagttat tataataaat attgcctgtt ggtaaatgtg aaaaaaaaaa aaaaaa | |
9837 // | |
9838 | |
9839 LOCUS NM_001271894 5056 bp mRNA linear VRT 04-JAN-2017 | |
9840 DEFINITION Gallus gallus podocalyxin like (PODXL), mRNA. | |
9841 ACCESSION NM_001271894 XM_003640324 XM_416475 | |
9842 VERSION NM_001271894.1 | |
9843 KEYWORDS RefSeq. | |
9844 SOURCE Gallus gallus (chicken) | |
9845 ORGANISM Gallus gallus | |
9846 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
9847 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
9848 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
9849 Phasianidae; Phasianinae; Gallus. | |
9850 REFERENCE 1 (bases 1 to 5056) | |
9851 AUTHORS Nielsen JS, Graves ML, Chelliah S, Vogl AW, Roskelley CD and | |
9852 McNagny KM. | |
9853 TITLE The CD34-related molecule podocalyxin is a potent inducer of | |
9854 microvillus formation | |
9855 JOURNAL PLoS ONE 2 (2), E237 (2007) | |
9856 PUBMED 17311105 | |
9857 REMARK GeneRIF: Recombinant chicken podocalyxin recruits NHERF-1 to the | |
9858 apical domain of human MCF-7 cells and promotes microvillus | |
9859 formation. Podocalyxin. | |
9860 Publication Status: Online-Only | |
9861 REFERENCE 2 (bases 1 to 5056) | |
9862 AUTHORS McNagny KM, Pettersson I, Rossi F, Flamme I, Shevchenko A, Mann M | |
9863 and Graf T. | |
9864 TITLE Thrombomucin, a novel cell surface protein that defines | |
9865 thrombocytes and multipotent hematopoietic progenitors | |
9866 JOURNAL J. Cell Biol. 138 (6), 1395-1407 (1997) | |
9867 PUBMED 9298993 | |
9868 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
9869 preliminary review. The reference sequence was derived from | |
9870 AADN04000326.1 and Y13978.1. | |
9871 On or before Dec 12, 2012 this sequence version replaced | |
9872 gi:363727360, gi:363727362. | |
9873 | |
9874 Sequence Note: This RefSeq record was created from transcript and | |
9875 genomic sequence data because no single transcript from the same | |
9876 breed was available for the full length of the gene. The extent of | |
9877 this transcript is supported by transcript alignments. | |
9878 | |
9879 ##Evidence-Data-START## | |
9880 Transcript exon combination :: Y13978.1 [ECO:0000332] | |
9881 RNAseq introns :: single sample supports all introns | |
9882 SAMEA2201357, SAMEA2201358 | |
9883 [ECO:0000348] | |
9884 ##Evidence-Data-END## | |
9885 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
9886 1-4 AADN04000326.1 968732-968735 c | |
9887 5-1466 Y13978.1 15-1476 | |
9888 1467-1467 AADN04000326.1 934002-934002 c | |
9889 1468-1909 Y13978.1 1478-1919 | |
9890 1910-5056 AADN04000326.1 928033-931179 c | |
9891 FEATURES Location/Qualifiers | |
9892 source 1..5056 | |
9893 /organism="Gallus gallus" | |
9894 /mol_type="mRNA" | |
9895 /db_xref="taxon:9031" | |
9896 /chromosome="1" | |
9897 /map="1" | |
9898 /breed="Red Jungle Fowl" | |
9899 gene 1..5056 | |
9900 /gene="PODXL" | |
9901 /gene_synonym="MEP21; PC; PCLP-1" | |
9902 /note="podocalyxin like" | |
9903 /db_xref="CGNC:49459" | |
9904 /db_xref="GeneID:395755" | |
9905 CDS 50..1765 | |
9906 /gene="PODXL" | |
9907 /gene_synonym="MEP21; PC; PCLP-1" | |
9908 /note="thrombomucin; podocalyxin-like protein 1" | |
9909 /codon_start=1 | |
9910 /product="podocalyxin precursor" | |
9911 /protein_id="NP_001258823.1" | |
9912 /db_xref="CGNC:49459" | |
9913 /db_xref="GeneID:395755" | |
9914 /translation="MRAPLLLPLLPLLLFGVSSGNNDKTTHSTTVSPETTKQITTITV | |
9915 TTSQVQGSISASKPSSTAPTAVMSFTKAQEAATSSKQHDSSTSSIPPPSTSITPSIIT | |
9916 TSPQGKTPSTPALTHTPDQNTKTTGRQDDTSHVSVASTSASQQVSSSASAAVPTTTSA | |
9917 VTSSATQQKVSPTDSSEILLKPSASPNSTQVTSPSRTPKGFLSTVTTSPHIADNGSTA | |
9918 LNQLKSTVSSSEVPVSSFLDKDHSVSSSTSATNQHLSLSSHRPTSPVPKFECSTPHSG | |
9919 SVPSTSSKTSLSSPSSSTKNATVTTTMTTAKAAYTSQGDGSVTHKSGVTAQSPTSAPL | |
9920 PTPTLKDHMKSKSPDQTHSNVSPPNEVICEDQIGEVRPILNLKEEKTCDDWKKASNEA | |
9921 FFEVFCSGRRHAFNSTRDRCTVKLASSNHRRWAVHVIVHRVLDPAAVFEELKEKRNEL | |
9922 EKLGITNVTYLNQEMEEEIKDQFSTPLIITIVTLAGSLLLIAAIYGCCHQRFSQKKSQ | |
9923 QRLTEELQTMENGYHDNPTLEVMETGSEMQEKKVNLNGELGDSWIVPLDTIMKEDLEE | |
9924 EDTHL" | |
9925 sig_peptide 50..109 | |
9926 /gene="PODXL" | |
9927 /gene_synonym="MEP21; PC; PCLP-1" | |
9928 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
9929 ORIGIN | |
9930 1 aacggggaga gcgccgggag ccggagcggg gacggccgca cagagcacca tgcgggcacc | |
9931 61 gctgctgctg ccgctgctcc cgctgctgct gttcggtgtc agctctggca ataatgataa | |
9932 121 aactacacat tcgaccacag tgagtccaga aacaactaag cagatcacca ctattacagt | |
9933 181 caccaccagc caggtgcaag ggagtatctc tgcaagcaaa ccaagcagca cagctcccac | |
9934 241 cgctgtgatg tccttcacca aagctcaaga ggcagccact tcaagcaaac aacatgactc | |
9935 301 ttcaacatca tccatcccac caccatcaac cagcatcacc cccagcatca tcactacaag | |
9936 361 cccacaggga aaaacaccat ccactcctgc attgacacac accccagatc aaaacaccaa | |
9937 421 gaccacaggc agacaagatg acacatcaca tgtctcagtg gcatcaacca gtgcatctca | |
9938 481 gcaggtcagc tcttcagcca gcgccgctgt cccaacaacc acctctgctg tcacctccag | |
9939 541 tgctacacag cagaaggtga gccctacaga cagctcagaa atcttactca aacccagtgc | |
9940 601 aagtcctaat tccactcaag taaccagccc ttcacgcacc ccaaaaggct tcctgtctac | |
9941 661 tgtcacaaca tctccacaca tagcagacaa tggaagcact gctttaaacc agttgaaaag | |
9942 721 tactgtgtca agttctgaag tcccagtgag cagctttttg gacaaggacc acagtgtctc | |
9943 781 ttcttctaca tctgccacca accagcatct ctcactttcc agtcatcgtc ccacttctcc | |
9944 841 agtcccgaaa tttgaatgtt ctacccctca tagtggatcc gtgccctcta ccagcagtaa | |
9945 901 aacatctctg tcttcgccat ctagcagcac aaagaatgcc acagtcacaa ccaccatgac | |
9946 961 aactgctaaa gcagcataca caagccaggg agatggatct gtgacacaca aatctggagt | |
9947 1021 tactgctcag agccccacca gtgcaccact gccaacaccg accctgaaag accacatgaa | |
9948 1081 gagcaagagt cctgaccaga cacactcgaa tgtttctccc ccaaatgagg tgatttgtga | |
9949 1141 agaccagata ggagaggtgc ggcccatcct aaatctgaaa gaagagaaaa cttgtgacga | |
9950 1201 ctggaagaaa gccagtaatg aggccttctt cgaggtcttc tgctcaggca ggcggcacgc | |
9951 1261 attcaacagc acgagagaca ggtgcacggt gaaactggcc tcctccaatc atcgtcgctg | |
9952 1321 ggctgtgcat gtcattgtgc atcgcgttct ggaccctgca gcagtctttg aagagctgaa | |
9953 1381 agaaaagagg aatgagttag agaagcttgg catcaccaac gtcacctacc tcaaccagga | |
9954 1441 gatggaggaa gagatcaagg atcagttcag cacacccctc ataatcacca ttgtcaccct | |
9955 1501 ggctggctcc ctgctgctca tcgcagcaat ctacggctgc tgtcaccaac gcttctccca | |
9956 1561 aaagaagagc cagcagcgcc tgacagagga gctacagaca atggagaatg gctaccatga | |
9957 1621 taaccccaca ctggaggtga tggaaacggg ctctgaaatg caggagaaga aggtgaacct | |
9958 1681 taacggggag ctgggggaca gctggatcgt tcctcttgac accatcatga aggaggacct | |
9959 1741 agaggaagag gatacgcatt tatagggtgc aggatttgag caagcaaaaa acaaccccct | |
9960 1801 gaaacaccta atccctttcc ctaaaaaaca gaaaacaaac ataaccctcc tgtacatgta | |
9961 1861 cacaattcca aaggaaggca gaattccaaa caaaccccag aaaacccctt gtgagctaat | |
9962 1921 cacagccacc acacagggtg aaggatggaa gagaaggaca caagaagaca cctccatggc | |
9963 1981 acatcaccaa catgacacag tggccacatc cagtccagca gctctgtcac ccatgggtgc | |
9964 2041 tcctggggac ctgtccagca gattggccaa tcctagcagg gatggctttg ctgctctgct | |
9965 2101 ctctccaaac agggatgctt gaggctttct agcagcaggg atgctgtatc ccctcccgtt | |
9966 2161 ccccaagtgc atcctccagc ttccaagtga ttcgaaaagt aaaaagaaat gtagtgagga | |
9967 2221 tgggagaggg agcacagctt gtgatagcca gctggcactt agaagataga gctagaaaaa | |
9968 2281 tcctctggcc catgctgttt aatcatcgtc ctcccctaca gctcccttgg aaaacaccca | |
9969 2341 gggactgagc acaaagagct ggaatgctcc atttgctcct ttcttatcca ctttccatcc | |
9970 2401 tcacccaact gctctttaaa aatgcacact ggccacactt tatggcataa gcaaatgcat | |
9971 2461 gcatccaggc atggctggac tgggggtgtt gaggccaaat cccacactgc ctttgtcagc | |
9972 2521 cccacaaagg gctggggcag gttctggtta cagaccagaa gagatgaagg ggatagtgca | |
9973 2581 gcaccttcca gtgagaggga gaggaaaagg tgtcactcct tgattttgta tctctaaggg | |
9974 2641 agtgtttaat gagacaaaga ccaaccgaat gctgtaggtg gttttggttg taaaggagcc | |
9975 2701 cagctgtaac acagaccagt tctatggttg catttagcta cggaagcatc cgatcacctc | |
9976 2761 ccagtagtga tgcagcacac ccattttctc ctgaggctgg tgctgatgcg tgcagcgatg | |
9977 2821 ctttgttctg gcagcgaatt ctgtgctcat gttgtcttgt gctaactaca gaaacaatac | |
9978 2881 aagagcagca gaggtgtgag ccaggtaact tggctgcagt cagagttttc catccgttca | |
9979 2941 gctcttggtg tttcctctcc atgaggttgg tgatctccat cctcatcctc aaggttttcc | |
9980 3001 tcttcagaag tacttaaaat agcagacatc tgtgaagaag cctccagcaa ggcttgtact | |
9981 3061 gaacctcggt ttcctgtcaa ggtctccctt tgcgataaat cttcaaaggg aaaaaaaaaa | |
9982 3121 aaaaaggagc agaaaatggc tggactaagg ccatttgtgg atttcccatt cctgccacag | |
9983 3181 ttcctcagtg gctctagaag gagagcttca cagcaggcag tctggtgtgg aagggacctg | |
9984 3241 aagtcccttg ggtgagggca tctcctgtca tctcatgcat catcacagca cgccgaggtt | |
9985 3301 ggaacgaacc tctgggttca tctggtctaa tccctgcacc agcagggaca cccagagctc | |
9986 3361 tgcccaggac cacgtccagg tgggtttgaa gatctccaag ggagaaatgc tcacattgag | |
9987 3421 gtgctgtgca gcaaatccac agcagtcctg gtgaggcaga ggagctccag gtcaatgcaa | |
9988 3481 tggagaagcc attcctaagg ctgtcccaga agatgggcaa agataaagag gtgaggagaa | |
9989 3541 atgaaaacaa tggcaaaact ctgctctagc tcatcagagt tgctcacaaa tagagtggtc | |
9990 3601 agagcagctt gctcagctcc aggacagaag ctggcagaag atgcatcttc tcccatgggc | |
9991 3661 cagctatttt ccttctctcc cgcactgaag gacatagttg aaagcgttca agcctatcta | |
9992 3721 tttttgtatg taaatattac tgctattcat tagcaatgta ttccgcacac ttcacttatc | |
9993 3781 tgtgcactgc agtacgggga agcaattttg gagggggaaa attaaaaaac aaaaaaaaaa | |
9994 3841 tactaaaaaa gctaaaggcc tgtctggtag gggattgcaa ctcaacagat agcaggagaa | |
9995 3901 catctgatga agctgctcgg ataaccccat gctgctgcac gtcagcatcg tgttaacatt | |
9996 3961 ggcaaattgg tcttggggtg ggcagcagca cgttcagctc ttaatgtcca aaccagcctt | |
9997 4021 aaggaactgc tctggttgtt tgtaatgctt ttggaagcat gttgcttccc agctgcccag | |
9998 4081 gatgggtctt tggactcata tttctgtcct tagcataaaa taaaagcagt acgtgcctaa | |
9999 4141 ggtccccttc cagtgaagag atgccaaagt gctttaatga atcaggtcca aagactttcc | |
10000 4201 cagagaaccc tatgaaggct tgaaatcaag caaccttaaa tctttcagag cagagaccgg | |
10001 4261 tggagatagt aactgctcgg caagtgctta cagtgattta tatttgaata ggaattgtac | |
10002 4321 atttatttat ttttccagac accatatttt taaaccacta atattttata gtagattttc | |
10003 4381 cttcccctat ttaaagaact atttccttgg gaaaaaaaaa ataataaagt ttttatgttg | |
10004 4441 gtaacattct ttttgcaaaa aaataaaaca tcaggtagga aatgcagcat cttcagcctt | |
10005 4501 aacaattccc ttcatagact gtagccacaa ctgttagacc aaaaagatct acccatgcat | |
10006 4561 ttcctccctg cccctctctc cttccccttg ctcctcttct cttccccaaa atagctttaa | |
10007 4621 cacccaatat gctgtacaag gactattacc ttttggtaag acttttgtaa gcagttcaga | |
10008 4681 tgttcttgca agagactttt ctatttgcag attcacaagg agcatgtaaa tactttagga | |
10009 4741 ccatttatct cccactcaca gtgccatgac ccaaccgagc aggttgatgc tgcgtcttgc | |
10010 4801 ctacagccga agatgtaacc cacaatgggc tgcagaagga gaacctattt cccgaggcag | |
10011 4861 ctatccattg aaccttgcaa atattgtaga gctctcatgt actgtatagc agcatctctc | |
10012 4921 gtggggacag gagtctgatt tacactggaa tttaatgagg aactggattg tagagattat | |
10013 4981 tcttgcattt tcctacaaat atattttgaa agcatcatgt atttctgtca ataaacattc | |
10014 5041 gtatgtaaga gattca | |
10015 // | |
10016 | |
10017 LOCUS NM_205450 772 bp mRNA linear VRT 04-JAN-2017 | |
10018 DEFINITION Gallus gallus troponin C2, fast skeletal type (TNNC2), mRNA. | |
10019 ACCESSION NM_205450 | |
10020 VERSION NM_205450.2 | |
10021 KEYWORDS RefSeq. | |
10022 SOURCE Gallus gallus (chicken) | |
10023 ORGANISM Gallus gallus | |
10024 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
10025 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
10026 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
10027 Phasianidae; Phasianinae; Gallus. | |
10028 REFERENCE 1 (bases 1 to 772) | |
10029 AUTHORS Knowles AC, Irving M and Sun YB. | |
10030 TITLE Conformation of the troponin core complex in the thin filaments of | |
10031 skeletal muscle during relaxation and active contraction | |
10032 JOURNAL J. Mol. Biol. 421 (1), 125-137 (2012) | |
10033 PUBMED 22579625 | |
10034 REMARK GeneRIF: A model of the orientation of the C-terminal lobe of | |
10035 troponin C (TnC) in skeletal muscle. | |
10036 REFERENCE 2 (bases 1 to 772) | |
10037 AUTHORS Pearson DS, Swartz DR and Geeves MA. | |
10038 TITLE Fast pressure jumps can perturb calcium and magnesium binding to | |
10039 troponin C F29W | |
10040 JOURNAL Biochemistry 47 (46), 12146-12158 (2008) | |
10041 PUBMED 18942859 | |
10042 REMARK GeneRIF: Fast pressure jumps can perturb calcium and magnesium | |
10043 binding to troponin C F29W.( | |
10044 REFERENCE 3 (bases 1 to 772) | |
10045 AUTHORS Fidalgo da Silva E, Freire MM, Barrabin H, Sorenson MM, Tikunova S, | |
10046 Johnson JD, Chandra M, Pearlstone JR and Scofano HM. | |
10047 TITLE Troponin C/calmodulin chimeras as erythrocyte plasma membrane | |
10048 Ca2+-ATPase activators | |
10049 JOURNAL Int. J. Biochem. Cell Biol. 38 (2), 209-221 (2006) | |
10050 PUBMED 16213185 | |
10051 REMARK GeneRIF: Data show that a recombinant troponin C/calmodulin | |
10052 chimera, in which the carboxyl-terminal domain of TnC is replaced | |
10053 by that of CaM, has the same ability as CaM to bind and transmit | |
10054 the signal to calcium sites on the enzyme. | |
10055 REFERENCE 4 (bases 1 to 772) | |
10056 AUTHORS Murakami K, Yumoto F, Ohki SY, Yasunaga T, Tanokura M and | |
10057 Wakabayashi T. | |
10058 TITLE Structural basis for Ca2+-regulated muscle relaxation at | |
10059 interaction sites of troponin with actin and tropomyosin | |
10060 JOURNAL J. Mol. Biol. 352 (1), 178-201 (2005) | |
10061 PUBMED 16061251 | |
10062 REMARK GeneRIF: Results describe the solution structures of a 'mobile' | |
10063 actin-binding domain (approximately 6.1 kDa) in the troponin | |
10064 ternary complex. | |
10065 REFERENCE 5 (bases 1 to 772) | |
10066 AUTHORS Satyshur KA, Pyzalska D, Greaser M, Rao ST and Sundaralingam M. | |
10067 TITLE Structure of chicken skeletal muscle troponin C at 1.78 A | |
10068 resolution | |
10069 JOURNAL Acta Crystallogr. D Biol. Crystallogr. 50 (PT 1), 40-49 (1994) | |
10070 PUBMED 15299475 | |
10071 REFERENCE 6 (bases 1 to 772) | |
10072 AUTHORS Shaw GS, Hodges RS and Sykes BD. | |
10073 TITLE Determination of the solution structure of a synthetic two-site | |
10074 calcium-binding homodimeric protein domain by NMR spectroscopy | |
10075 JOURNAL Biochemistry 31 (40), 9572-9580 (1992) | |
10076 PUBMED 1390738 | |
10077 REFERENCE 7 (bases 1 to 772) | |
10078 AUTHORS Golosinska K, Pearlstone JR, Borgford T, Oikawa K, Kay CM, | |
10079 Carpenter MR and Smillie LB. | |
10080 TITLE Determination of and corrections to sequences of turkey and chicken | |
10081 troponins-C. Effects of Thr-130 to Ile mutation on Ca2+ affinity | |
10082 JOURNAL J. Biol. Chem. 266 (24), 15797-15809 (1991) | |
10083 PUBMED 1908459 | |
10084 REFERENCE 8 (bases 1 to 772) | |
10085 AUTHORS Reinach FC and Karlsson R. | |
10086 TITLE Cloning, expression, and site-directed mutagenesis of chicken | |
10087 skeletal muscle troponin C | |
10088 JOURNAL J. Biol. Chem. 263 (5), 2371-2376 (1988) | |
10089 PUBMED 2963002 | |
10090 REFERENCE 9 (bases 1 to 772) | |
10091 AUTHORS Satyshur KA, Rao ST, Pyzalska D, Drendel W, Greaser M and | |
10092 Sundaralingam M. | |
10093 TITLE Refined structure of chicken skeletal muscle troponin C in the | |
10094 two-calcium state at 2-A resolution | |
10095 JOURNAL J. Biol. Chem. 263 (4), 1628-1647 (1988) | |
10096 PUBMED 3338985 | |
10097 REFERENCE 10 (bases 1 to 772) | |
10098 AUTHORS Wilkinson,J.M. | |
10099 TITLE The amino acid sequence of troponin C from chicken skeletal muscle | |
10100 JOURNAL FEBS Lett. 70 (1), 254-256 (1976) | |
10101 PUBMED 992069 | |
10102 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
10103 NCBI review. The reference sequence was derived from M19027.1. | |
10104 On Aug 31, 2012 this sequence version replaced gi:45382066. | |
10105 | |
10106 Publication Note: This RefSeq record includes a subset of the | |
10107 publications that are available for this gene. Please see the Gene | |
10108 record to access additional publications. | |
10109 | |
10110 ##Evidence-Data-START## | |
10111 Transcript exon combination :: M19027.1, BU217608.1 [ECO:0000332] | |
10112 RNAseq introns :: single sample supports all introns | |
10113 SAMEA2201369, SAMEA2201373 | |
10114 [ECO:0000348] | |
10115 ##Evidence-Data-END## | |
10116 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
10117 1-772 M19027.1 5-776 | |
10118 FEATURES Location/Qualifiers | |
10119 source 1..772 | |
10120 /organism="Gallus gallus" | |
10121 /mol_type="mRNA" | |
10122 /db_xref="taxon:9031" | |
10123 /chromosome="20" | |
10124 /map="20" | |
10125 gene 1..772 | |
10126 /gene="TNNC2" | |
10127 /note="troponin C2, fast skeletal type" | |
10128 /db_xref="CGNC:49802" | |
10129 /db_xref="GeneID:396434" | |
10130 CDS 39..530 | |
10131 /gene="TNNC2" | |
10132 /note="troponin C (TNC); troponin C type 2 (fast)" | |
10133 /codon_start=1 | |
10134 /product="troponin C, skeletal muscle" | |
10135 /protein_id="NP_990781.1" | |
10136 /db_xref="CGNC:49802" | |
10137 /db_xref="GeneID:396434" | |
10138 /translation="MASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELG | |
10139 TVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELANC | |
10140 FRIFDKNADGFIDIEELGEILRATGEHVIEEDIEDLMKDSDKNNDGRIDFDEFLKMME | |
10141 GVQ" | |
10142 ORIGIN | |
10143 1 aggaagaggt gactccctgc gggaggagag cagcaaagat ggcgtcaatg acggaccagc | |
10144 61 aggcggaggc ccgcgccttc ctcagcgagg agatgattgc tgagttcaaa gctgcctttg | |
10145 121 acatgtttga tgcggacggt ggtggggaca tcagcaccaa ggagttgggc acggtgatga | |
10146 181 ggatgctggg ccagaacccc accaaagagg agctggatgc catcatcgag gaggtggacg | |
10147 241 aggatggcag cggcaccatc gacttcgagg agttcctggt gatgatggtg cgccagatga | |
10148 301 aagaggacgc caagggcaag tctgaggagg agctggccaa ctgcttccgc atcttcgaca | |
10149 361 agaacgctga tgggttcatc gacatcgagg agctgggtga gattctcagg gccactgggg | |
10150 421 agcacgtcat cgaggaggac atagaagacc tcatgaagga ttcagacaag aacaatgacg | |
10151 481 gccgcattga cttcgatgag ttcctgaaga tgatggaggg tgtgcagtaa gggatcagac | |
10152 541 attcctgggg ccggatgcgg cagccagccc tgctcctctg cccaggagcg gctccgctgc | |
10153 601 agcacctggc cttgctgccc acccgctgga gccctgcagc agctcgtgcc cctcggccgg | |
10154 661 cggctgagct tttccttgac tctgacagat gtggtttatg gatgaacctc attaaaaggg | |
10155 721 gaaaggctga aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa | |
10156 // | |
10157 | |
10158 LOCUS NM_204650 384 bp mRNA linear VRT 04-JAN-2017 | |
10159 DEFINITION Gallus gallus avian beta-defensin 3 (AvBD3), mRNA. | |
10160 ACCESSION NM_204650 | |
10161 VERSION NM_204650.2 | |
10162 KEYWORDS RefSeq. | |
10163 SOURCE Gallus gallus (chicken) | |
10164 ORGANISM Gallus gallus | |
10165 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
10166 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
10167 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
10168 Phasianidae; Phasianinae; Gallus. | |
10169 REFERENCE 1 (bases 1 to 384) | |
10170 AUTHORS Cuperus T, Coorens M, van Dijk A and Haagsman HP. | |
10171 TITLE Avian host defense peptides | |
10172 JOURNAL Dev. Comp. Immunol. 41 (3), 352-369 (2013) | |
10173 PUBMED 23644014 | |
10174 REMARK Review article | |
10175 REFERENCE 2 (bases 1 to 384) | |
10176 AUTHORS Sonoda Y, Abdel Mageed AM, Isobe N and Yoshimura Y. | |
10177 TITLE Induction of avian beta-defensins by CpG oligodeoxynucleotides and | |
10178 proinflammatory cytokines in hen vaginal cells in vitro | |
10179 JOURNAL Reproduction 145 (6), 621-631 (2013) | |
10180 PUBMED 23625580 | |
10181 REMARK GeneRIF: Data suggest that DEFB1 and DEFB3 are involved in | |
10182 mechanisms by which the vaginal mucosa forms a more efficient | |
10183 defense system against bacterial infection; proinflammatory | |
10184 cytokines induce DEFB1 and DEFB3 in vagina mucosa cells. | |
10185 Publication Status: Online-Only | |
10186 REFERENCE 3 (bases 1 to 384) | |
10187 AUTHORS Zhang HH, Yang XM, Xie QM, Ma JY, Luo YN, Cao YC, Chen F and Bi YZ. | |
10188 TITLE The potent adjuvant effects of chicken beta-defensin-1 when | |
10189 genetically fused with infectious bursal disease virus VP2 gene | |
10190 JOURNAL Vet. Immunol. Immunopathol. 136 (1-2), 92-97 (2010) | |
10191 PUBMED 20334934 | |
10192 REMARK GeneRIF: potent adjuvant effects of beta-defensin-1 when | |
10193 genetically fused with infectious bursal disease virus VP2 gene | |
10194 REFERENCE 4 (bases 1 to 384) | |
10195 AUTHORS Derache C, Esnault E, Bonsergent C, Le Vern Y, Quere P and | |
10196 Lalmanach AC. | |
10197 TITLE Differential modulation of beta-defensin gene expression by | |
10198 Salmonella Enteritidis in intestinal epithelial cells from | |
10199 resistant and susceptible chicken inbred lines | |
10200 JOURNAL Dev. Comp. Immunol. 33 (9), 959-966 (2009) | |
10201 PUBMED 19539093 | |
10202 REMARK GeneRIF: intestinal epithelium express beta-defensin antimicrobial | |
10203 peptides that may play a role in immunoprotection against | |
10204 Salmonella Enteritidis. | |
10205 REFERENCE 5 (bases 1 to 384) | |
10206 AUTHORS Shimizu M, Watanabe Y, Isobe N and Yoshimura Y. | |
10207 TITLE Expression of avian beta-defensin 3, an antimicrobial peptide, by | |
10208 sperm in the male reproductive organs and oviduct in chickens: an | |
10209 immunohistochemical study | |
10210 JOURNAL Poult. Sci. 87 (12), 2653-2659 (2008) | |
10211 PUBMED 19038823 | |
10212 REMARK GeneRIF: AvBD-3 is synthesized by late stage of spermatids in the | |
10213 testis, and this molecule is retained by the sperm during the | |
10214 passage of male reproductive tract, and even in the sperm storage | |
10215 tubules of oviduct. | |
10216 REFERENCE 6 (bases 1 to 384) | |
10217 AUTHORS Lynn,D.J., Higgs,R., Lloyd,A.T., O'Farrelly,C., Herve-Grepinet,V., | |
10218 Nys,Y., Brinkman,F.S., Yu,P.L., Soulier,A., Kaiser,P., Zhang,G. and | |
10219 Lehrer,R.I. | |
10220 TITLE Avian beta-defensin nomenclature: a community proposed update | |
10221 JOURNAL Immunol. Lett. 110 (1), 86-89 (2007) | |
10222 PUBMED 17467809 | |
10223 REFERENCE 7 (bases 1 to 384) | |
10224 AUTHORS Yoshimura Y, Ohashi H, Subedi K, Nishibori M and Isobe N. | |
10225 TITLE Effects of age, egg-laying activity, and Salmonella-inoculation on | |
10226 the expressions of gallinacin mRNA in the vagina of the hen oviduct | |
10227 JOURNAL J. Reprod. Dev. 52 (2), 211-218 (2006) | |
10228 PUBMED 16394622 | |
10229 REMARK GeneRIF: mRNA expression of Gal-1, -2 and -3 in the vagina of | |
10230 laying hens increases with age but decreases in the regressed | |
10231 oviduct during the non-laying phase, and may increase in response | |
10232 to Salmonella enteritidis (SE) and lipopolysaccharide | |
10233 REFERENCE 8 (bases 1 to 384) | |
10234 AUTHORS Xiao Y, Hughes AL, Ando J, Matsuda Y, Cheng JF, Skinner-Noble D and | |
10235 Zhang G. | |
10236 TITLE A genome-wide screen identifies a single beta-defensin gene cluster | |
10237 in the chicken: implications for the origin and evolution of | |
10238 mammalian defensins | |
10239 JOURNAL BMC Genomics 5 (1), 56 (2004) | |
10240 PUBMED 15310403 | |
10241 REMARK GeneRIF: The chicken genome encodes only beta-defensins. The 13 | |
10242 chicken beta-defensin genes are clustered densely within a 86-Kb | |
10243 distance on the chromosome 3q3.5-q3.7. The deduced peptides share | |
10244 the characteristic defensin motif. | |
10245 Publication Status: Online-Only | |
10246 REFERENCE 9 (bases 1 to 384) | |
10247 AUTHORS Zhao C, Nguyen T, Liu L, Sacco RE, Brogden KA and Lehrer RI. | |
10248 TITLE Gallinacin-3, an inducible epithelial beta-defensin in the chicken | |
10249 JOURNAL Infect. Immun. 69 (4), 2684-2691 (2001) | |
10250 PUBMED 11254635 | |
10251 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
10252 NCBI review. The reference sequence was derived from AF181952.1. | |
10253 On Aug 31, 2012 this sequence version replaced gi:45382830. | |
10254 | |
10255 ##Evidence-Data-START## | |
10256 Transcript exon combination :: AF181952.1, DQ677634.1 [ECO:0000332] | |
10257 RNAseq introns :: single sample supports all introns | |
10258 SAMEA2201357, SAMEA2201364 | |
10259 [ECO:0000348] | |
10260 ##Evidence-Data-END## | |
10261 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
10262 1-384 AF181952.1 4-387 | |
10263 FEATURES Location/Qualifiers | |
10264 source 1..384 | |
10265 /organism="Gallus gallus" | |
10266 /mol_type="mRNA" | |
10267 /db_xref="taxon:9031" | |
10268 /chromosome="3" | |
10269 /map="3" | |
10270 gene 1..384 | |
10271 /gene="AvBD3" | |
10272 /gene_synonym="DEFB1; GAL 3; gal-3; GAL3" | |
10273 /note="avian beta-defensin 3" | |
10274 /db_xref="CGNC:12490" | |
10275 /db_xref="GeneID:395363" | |
10276 CDS 3..245 | |
10277 /gene="AvBD3" | |
10278 /gene_synonym="DEFB1; GAL 3; gal-3; GAL3" | |
10279 /note="beta-defensin prepropeptide; gallinacin-3; | |
10280 antimicrobial peptide-3; defensin, beta 1; beta-defensin 3 | |
10281 antimicrobial peptide" | |
10282 /codon_start=1 | |
10283 /product="gallinacin-3 precursor" | |
10284 /protein_id="NP_989981.1" | |
10285 /db_xref="CGNC:12490" | |
10286 /db_xref="GeneID:395363" | |
10287 /translation="MRIVYLLIPFFLLFLQGAAGTATQCRIRGGFCRVGSCRFPHIAI | |
10288 GKCATFISCCGRAYEVDALNSVRTSPWLLAPGNNPH" | |
10289 sig_peptide 3..62 | |
10290 /gene="AvBD3" | |
10291 /gene_synonym="DEFB1; GAL 3; gal-3; GAL3" | |
10292 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
10293 mat_peptide 69..242 | |
10294 /gene="AvBD3" | |
10295 /gene_synonym="DEFB1; GAL 3; gal-3; GAL3" | |
10296 /product="Gallinacin-3" | |
10297 /experiment="experimental evidence, no additional details | |
10298 recorded" | |
10299 /note="propagated from UniProtKB/Swiss-Prot (Q9DG58.1)" | |
10300 ORIGIN | |
10301 1 ccatgcggat cgtgtacctg ctcatcccct tcttcctctt gtttctccag ggtgctgcag | |
10302 61 gaactgccac tcagtgcaga ataagaggag gattctgtcg tgttgggagc tgccgcttcc | |
10303 121 cacacatagc tattgggaaa tgtgcaacat ttatttcctg ctgtggaaga gcatatgagg | |
10304 181 ttgatgccct gaattctgtg aggacatcgc cgtggcttct cgctcctgga aacaaccccc | |
10305 241 attgacctct ccccttccca cctctgcagt ctcccatggt atgaccgtgg cagtggaagc | |
10306 301 tggagacacc tcgctgtggg cctgcagttg tttggccaga tgctgctttt ccctgctgaa | |
10307 361 taaaggcgtg cagtttggca ttgc | |
10308 // | |
10309 | |
10310 LOCUS NM_205307 2182 bp mRNA linear VRT 04-JAN-2017 | |
10311 DEFINITION Gallus gallus Raf-1 proto-oncogene, serine/threonine kinase (RAF1), | |
10312 mRNA. | |
10313 ACCESSION NM_205307 | |
10314 VERSION NM_205307.2 | |
10315 KEYWORDS RefSeq. | |
10316 SOURCE Gallus gallus (chicken) | |
10317 ORGANISM Gallus gallus | |
10318 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
10319 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
10320 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
10321 Phasianidae; Phasianinae; Gallus. | |
10322 REFERENCE 1 (bases 1 to 2182) | |
10323 AUTHORS Magarinos M, Aburto MR, Sanchez-Calderon H, Munoz-Agudo C, Rapp UR | |
10324 and Varela-Nieto I. | |
10325 TITLE RAF kinase activity regulates neuroepithelial cell proliferation | |
10326 and neuronal progenitor cell differentiation during early inner ear | |
10327 development | |
10328 JOURNAL PLoS ONE 5 (12), E14435 (2010) | |
10329 PUBMED 21203386 | |
10330 REMARK GeneRIF: RAF kinase activity is essential to establish the balance | |
10331 between cell proliferation and death in neuroepithelial otic | |
10332 precursors, and for otic neuron differentiation and axonal growth | |
10333 at the acoustic-vestibular ganglion | |
10334 Publication Status: Online-Only | |
10335 REFERENCE 2 (bases 1 to 2182) | |
10336 AUTHORS Brummer T, Stehelin D, Misawa Y and Reth M. | |
10337 TITLE A revised and complete map of the chicken c-mil/raf-1 locus | |
10338 JOURNAL Oncogene 23 (17), 3128-3131 (2004) | |
10339 PUBMED 14968114 | |
10340 REMARK GeneRIF: a complete map of the c-mil/raf-1 gene and a revision of | |
10341 the exon numbers | |
10342 REFERENCE 3 (bases 1 to 2182) | |
10343 AUTHORS Brummer T, Shaw PE, Reth M and Misawa Y. | |
10344 TITLE Inducible gene deletion reveals different roles for B-Raf and Raf-1 | |
10345 in B-cell antigen receptor signalling | |
10346 JOURNAL EMBO J. 21 (21), 5611-5622 (2002) | |
10347 PUBMED 12411479 | |
10348 REMARK GeneRIF: Inducible gene deletion of the c-mil/raf-1 gene in chicken | |
10349 DT40 B cells revealed that, in addition to B-Raf, Raf-1 acts as an | |
10350 accessory ERK activator following engagement of the B cell antigen | |
10351 receptor. | |
10352 REFERENCE 4 (bases 1 to 2182) | |
10353 AUTHORS Dozier C, Denhez F, Henry C, Coll J, Begue A, Quatannens B, Saule S | |
10354 and Stehelin D. | |
10355 TITLE Alternative splicing of RNAs transcribed from the chicken c-mil | |
10356 gene | |
10357 JOURNAL Mol. Cell. Biol. 8 (4), 1835-1838 (1988) | |
10358 PUBMED 2837658 | |
10359 REFERENCE 5 (bases 1 to 2182) | |
10360 AUTHORS Koenen M, Sippel AE, Trachmann C and Bister K. | |
10361 TITLE Primary structure of the chicken c-mil protein:identification of | |
10362 domains shared with or absent from the retroviral v-mil protein | |
10363 JOURNAL Oncogene 2 (2), 179-185 (1988) | |
10364 PUBMED 3285296 | |
10365 REFERENCE 6 (bases 1 to 2182) | |
10366 AUTHORS Jansen,H.W. and Bister,K. | |
10367 TITLE Nucleotide sequence analysis of the chicken gene c-mil, the | |
10368 progenitor of the retroviral oncogene v-mil | |
10369 JOURNAL Virology 143 (2), 359-367 (1985) | |
10370 PUBMED 2998016 | |
10371 REFERENCE 7 (bases 1 to 2182) | |
10372 AUTHORS Flordellis,C.S., Kan,N.C., Lautenberger,J.A., Samuel,K.P., | |
10373 Garon,C.F. and Papas,T.S. | |
10374 TITLE Analysis of the cellular proto-oncogene mht/raf: relationship to | |
10375 the 5' sequences of v-mht in avian carcinoma virus MH2 and v-raf in | |
10376 murine sarcoma virus 3611 | |
10377 JOURNAL Virology 141 (2), 267-274 (1985) | |
10378 PUBMED 3002017 | |
10379 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
10380 NCBI review. The reference sequence was derived from X07017.1. | |
10381 On Aug 30, 2012 this sequence version replaced gi:45384313. | |
10382 | |
10383 ##Evidence-Data-START## | |
10384 Transcript exon combination :: X07017.1 [ECO:0000332] | |
10385 RNAseq introns :: mixed/partial sample support | |
10386 SAMEA2201357, SAMEA2201358 | |
10387 [ECO:0000350] | |
10388 ##Evidence-Data-END## | |
10389 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
10390 1-2182 X07017.1 3-2184 | |
10391 FEATURES Location/Qualifiers | |
10392 source 1..2182 | |
10393 /organism="Gallus gallus" | |
10394 /mol_type="mRNA" | |
10395 /db_xref="taxon:9031" | |
10396 /chromosome="12" | |
10397 /map="12" | |
10398 gene 1..2182 | |
10399 /gene="RAF1" | |
10400 /note="Raf-1 proto-oncogene, serine/threonine kinase" | |
10401 /db_xref="CGNC:3714" | |
10402 /db_xref="GeneID:396245" | |
10403 misc_feature 41..43 | |
10404 /gene="RAF1" | |
10405 /note="upstream in-frame stop codon" | |
10406 CDS 71..2014 | |
10407 /gene="RAF1" | |
10408 /EC_number="2.7.11.1" | |
10409 /note="c-mil protein; C-RAF; MIL proto-oncogene | |
10410 serine/threonine-protein kinase; v-raf-1 murine leukemia | |
10411 viral oncogene homolog 1" | |
10412 /codon_start=1 | |
10413 /product="RAF proto-oncogene serine/threonine-protein | |
10414 kinase" | |
10415 /protein_id="NP_990638.1" | |
10416 /db_xref="CGNC:3714" | |
10417 /db_xref="GeneID:396245" | |
10418 /translation="MEHIQGAWKTISNGFGLKDSVFDGPNCISPTIVQQFGYQRRASD | |
10419 DGKISDTSKTSNTIRVFLPNKQRTVVNVRNGMTLHDCLMKALKVRGLQPECCAVFRLV | |
10420 TEPKGKKVRLDWNTDAASLIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLL | |
10421 NGFRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNSNISDSGVPALPPLTMRRMR | |
10422 ESVSRIPVSSQHRYSTPHVFTFNTSNPSSEGTLSQRQRSTSTPNVHMVSTTMPVDSRI | |
10423 IEDAIRNHSESASPSALSGSPNNMSPTGWSQPKTPVPAQRERAPGTNTQEKNKIRPRG | |
10424 QRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRN | |
10425 EVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIAR | |
10426 QTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGS | |
10427 ILWMAPEVIRMQDSNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYA | |
10428 SPDLSKLYKNCPKAMKRLVADCLKKVREERPLFPQILSSIELLQHSLPKINRSASEPS | |
10429 LHRASHTEDINSCTLTSTRLPVF" | |
10430 misc_feature 197..199 | |
10431 /gene="RAF1" | |
10432 /experiment="experimental evidence, no additional details | |
10433 recorded" | |
10434 /note="Phosphoserine. {ECO:0000250}; propagated from | |
10435 UniProtKB/Swiss-Prot (P05625.1); phosphorylation site" | |
10436 misc_feature 845..847 | |
10437 /gene="RAF1" | |
10438 /experiment="experimental evidence, no additional details | |
10439 recorded" | |
10440 /note="Phosphoserine. {ECO:0000250}; propagated from | |
10441 UniProtKB/Swiss-Prot (P05625.1); phosphorylation site" | |
10442 misc_feature 872..874 | |
10443 /gene="RAF1" | |
10444 /experiment="experimental evidence, no additional details | |
10445 recorded" | |
10446 /note="Phosphothreonine, by autocatalysis. {ECO:0000250}; | |
10447 propagated from UniProtKB/Swiss-Prot (P05625.1); | |
10448 phosphorylation site" | |
10449 misc_feature 1082..1084 | |
10450 /gene="RAF1" | |
10451 /experiment="experimental evidence, no additional details | |
10452 recorded" | |
10453 /note="Phosphoserine. {ECO:0000250}; propagated from | |
10454 UniProtKB/Swiss-Prot (P05625.1); phosphorylation site" | |
10455 misc_feature 1565..1567 | |
10456 /gene="RAF1" | |
10457 /experiment="experimental evidence, no additional details | |
10458 recorded" | |
10459 /note="Phosphoserine. {ECO:0000250}; propagated from | |
10460 UniProtKB/Swiss-Prot (P05625.1); phosphorylation site" | |
10461 misc_feature 1931..1933 | |
10462 /gene="RAF1" | |
10463 /experiment="experimental evidence, no additional details | |
10464 recorded" | |
10465 /note="Phosphoserine. {ECO:0000250}; propagated from | |
10466 UniProtKB/Swiss-Prot (P05625.1); phosphorylation site" | |
10467 ORIGIN | |
10468 1 catagatgat gcacttcatc attttgtcat aggacttcac tgacataaag gaaaacgaaa | |
10469 61 gactgcatcc atggagcaca ttcagggagc ttggaagact atcagtaatg gttttggact | |
10470 121 caaggattct gtctttgatg gcccaaactg catttcaccg accattgtcc agcagtttgg | |
10471 181 ttatcagcgc cgagcatctg atgatggcaa gatatcagat acttccaaaa ccagtaatac | |
10472 241 cattcgagtt ttcttgccca acaagcaacg tacagtggta aatgtgcgaa atgggatgac | |
10473 301 cttacatgat tgtctcatga aggcacttaa agtaagaggt ctgcagccag aatgctgtgc | |
10474 361 agtttttcgt cttgttactg aaccaaaagg taaaaaagtg cgtttggatt ggaacactga | |
10475 421 tgctgcctcc ttgattggtg aggaactgca ggtggacttt cttgatcacg ttccgctcac | |
10476 481 tacacacaat tttgctcgga agacatttct aaagcttgct ttctgtgaca tctgccagaa | |
10477 541 gttcctccta aatgggtttc ggtgtcagac gtgtggttat aaattccacg agcactgcag | |
10478 601 cactaaagtt ccaaccatgt gcgtcgactg gagcaatatc aggcaactct tattgttccc | |
10479 661 aaattcaaat atcagtgaca gtggtgtccc tgcactacct cccttgacaa tgagacggat | |
10480 721 gcgggagtct gtctcccgga tacctgttag ctcccagcac aggtattcta cacctcatgt | |
10481 781 ctttacattc aacacatcaa atccttcctc tgagggcacc ctttcccaaa gacagcgatc | |
10482 841 tacatccaca ccaaatgtcc acatggttag cactacaatg ccagtagaca gccggataat | |
10483 901 tgaggatgca attcgaaacc atagtgaatc agcttcaccc tccgctctgt ctgggagtcc | |
10484 961 taacaatatg agcccgactg gctggtctca gcccaaaacg ccagtcccag cccagaggga | |
10485 1021 gagagccccc ggaacgaata cacaggagaa aaataaaatt aggcctcgtg gacaaagaga | |
10486 1081 ttctagttat tactgggaaa tagaagcaag cgaagtcatg ctttctacca gaatagggtc | |
10487 1141 aggttctttt ggaactgttt acaaaggcaa atggcatggg gatgtagcag tgaaaatatt | |
10488 1201 aaaggttgta gatccaaccc cagaacagtt tcaggctttc agaaacgaag tggctgtatt | |
10489 1261 aaggaagacc cggcatgtta atattttgct cttcatgggc tacatgacta aagataacct | |
10490 1321 ggccattgtc acacagtggt gtgaaggcag cagtctgtat aaacacctgc acgttcaaga | |
10491 1381 gaccaagttc caaatgttcc agctcattga cattgctcgg cagacagcgc agggaatgga | |
10492 1441 ctatttgcat gcaaagaata tcatccacag agacatgaaa tccaataata tatttcttca | |
10493 1501 tgaaggcctc acagtgaaaa taggagactt tggtctagca actgtaaaat ccaggtggag | |
10494 1561 tggatcgcag caggtggagc aacccactgg ttccattttg tggatggcac cagaagtgat | |
10495 1621 acggatgcaa gacagcaatc cgttcagttt tcagtcagat gtctactcct atggaatagt | |
10496 1681 attgtatgag ctaatgacag gagagctgcc atactcccac ataaacaacc gcgaccagat | |
10497 1741 tattttcatg gttggtcgag gatatgcttc tccagacctc agcaagttgt acaagaactg | |
10498 1801 ccccaaagca atgaagaggc tcgtagcaga ttgtttgaag aaagttaggg aagaaagacc | |
10499 1861 cttgtttccg caaatactgt cttccattga attgctgcaa cattctttac ccaaaatcaa | |
10500 1921 ccggagtgct tccgaaccat ctctgcaccg cgcatcccat acagaggaca taaattcttg | |
10501 1981 cacgttaaca tccacaagac tgcctgtttt ttagaattgt gctccccttc ccttaatctc | |
10502 2041 tccagtgatg ggaaaggaac agaagtaaga gaagttgtgc ttttaatgcc tcagtgtaca | |
10503 2101 ggatcagtgc cagcaggatc atccgcatcc ccgtttaaga acaagctgct aaggatgttt | |
10504 2161 gcagttctta ccctgcaggg ac | |
10505 // | |
10506 | |
10507 LOCUS NM_001257373 1096 bp mRNA linear VRT 04-JAN-2017 | |
10508 DEFINITION Gallus gallus mitochondrial ribosome associated GTPase 1 (MTG1), | |
10509 mRNA. | |
10510 ACCESSION NM_001257373 XM_003641467 | |
10511 VERSION NM_001257373.1 | |
10512 KEYWORDS RefSeq. | |
10513 SOURCE Gallus gallus (chicken) | |
10514 ORGANISM Gallus gallus | |
10515 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
10516 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
10517 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
10518 Phasianidae; Phasianinae; Gallus. | |
10519 REFERENCE 1 (bases 1 to 1096) | |
10520 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
10521 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
10522 TITLE A comprehensive collection of chicken cDNAs | |
10523 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
10524 PUBMED 12445392 | |
10525 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
10526 preliminary review. The reference sequence was derived from | |
10527 BU380401.1, CR389870.1, BU362947.1 and BU282820.1. | |
10528 On Apr 11, 2012 this sequence version replaced gi:363735154. | |
10529 | |
10530 Sequence Note: This RefSeq record was created from transcript data | |
10531 from different strains because no single transcript from the same | |
10532 strain was available for the full length of the gene. The extent of | |
10533 this transcript is supported by transcript alignments and | |
10534 orthologous data. | |
10535 | |
10536 ##Evidence-Data-START## | |
10537 Transcript exon combination :: CR389870.1, BU259549.1 [ECO:0000332] | |
10538 RNAseq introns :: single sample supports all introns | |
10539 SAMEA2201376 [ECO:0000348] | |
10540 ##Evidence-Data-END## | |
10541 | |
10542 ##RefSeq-Attributes-START## | |
10543 gene product(s) localized to mito. :: inferred from homology | |
10544 ##RefSeq-Attributes-END## | |
10545 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
10546 1-14 BU380401.1 1-14 | |
10547 15-55 CR389870.1 14-54 | |
10548 56-56 BU362947.1 54-54 | |
10549 57-509 CR389870.1 56-508 | |
10550 510-510 BU362947.1 508-508 | |
10551 511-1089 CR389870.1 510-1088 | |
10552 1090-1096 BU282820.1 756-762 | |
10553 FEATURES Location/Qualifiers | |
10554 source 1..1096 | |
10555 /organism="Gallus gallus" | |
10556 /mol_type="mRNA" | |
10557 /db_xref="taxon:9031" | |
10558 /chromosome="6" | |
10559 /map="6" | |
10560 /breed="Leghorn" | |
10561 gene 1..1096 | |
10562 /gene="MTG1" | |
10563 /note="mitochondrial ribosome associated GTPase 1" | |
10564 /db_xref="CGNC:59226" | |
10565 /db_xref="GeneID:791224" | |
10566 CDS 16..1005 | |
10567 /gene="MTG1" | |
10568 /note="mitochondrial GTPase 1 homolog" | |
10569 /codon_start=1 | |
10570 /product="mitochondrial ribosome-associated GTPase 1" | |
10571 /protein_id="NP_001244302.1" | |
10572 /db_xref="CGNC:59226" | |
10573 /db_xref="GeneID:791224" | |
10574 /translation="MRRWVGALRAAATVASGPCLESGGFRTRFDFGSRDAASWFPGHM | |
10575 AKGLRQMRASLRRADCLVEVHDARIPLSGRNPVLQEVLGIRPHLLVLNKMDLADPRQQ | |
10576 SRVLEQLRQQGCSYVVFTDCQRDSNVKKIVPLVAKLVNSSPRYHRAESTEYSIMVIGV | |
10577 PNVGKSSLINSLRRLHLKKGKATAVGGEPGVTKAVLTRIQVCETPLVYLVDTPGVLPP | |
10578 KLADVETGMKLALCGAIRDHLVGEDIMADYLLYVLNQQQQFGYMELYGLPEASDNIRH | |
10579 VLKYVAVALGKTQKVKVLTGTGNVNMTMLDYSAAAYEFLRAFRAGRLGRLTLD" | |
10580 ORIGIN | |
10581 1 cgcaccggaa gtgtcatgag gcgctgggtg ggagcgctgc gggccgccgc caccgtcgcc | |
10582 61 tcagggccgt gcttggagtc cggcgggttc cgcacccgct tcgatttcgg cagccgcgat | |
10583 121 gcggcctcct ggttccctgg gcacatggcc aaagggctgc ggcagatgcg ggcctccctg | |
10584 181 cggcgtgccg actgcctcgt cgaagtgcac gacgctcgca tcccactgtc aggccgtaat | |
10585 241 cctgtgctgc aggaggtgct gggcatccgc ccgcatcttt tggtgctgaa caagatggac | |
10586 301 ctggctgacc cacgccagca gtcaagagtc ctggagcaac tgaggcagca gggatgctcg | |
10587 361 tatgttgtct tcactgattg tcagcgggac agcaatgtca agaagatcgt gcccctggtt | |
10588 421 gccaagctag tcaacagcag cccacgctac cacagggctg agagtactga gtacagcatc | |
10589 481 atggtgatcg gtgtgcccaa cgtaggcaaa tcatcgctta tcaactcttt gcggaggttg | |
10590 541 cacctcaaaa agggaaaagc cacagcagtg ggcggtgagc caggtgtcac caaggcggtg | |
10591 601 ctgacccgga tccaggtgtg cgagactccc ctggtgtatc tggtggacac gccaggtgtg | |
10592 661 ctgcccccaa agttggccga tgtggagacg gggatgaagc tggcattgtg tggagcgatc | |
10593 721 cgtgaccact tggtgggtga ggacatcatg gctgactacc tgctgtatgt actgaaccag | |
10594 781 cagcagcagt ttgggtacat ggagctctat ggactgcccg aggccagtga caacatcagg | |
10595 841 catgtgctga agtatgttgc ggtcgccctg ggcaagacgc agaaggtgaa ggtgctgaca | |
10596 901 ggcacaggga atgtcaacat gacgatgctc gactactcgg ctgctgccta tgagttcctg | |
10597 961 cgggccttcc gtgctgggcg cctgggtaga ctgacactgg actgagggtc ctggagtaga | |
10598 1021 gcaggacatc ccacatctcc gccagctcca ggtggtggtt tggtgtgatt aaagctgctt | |
10599 1081 tgttcctgga tgggtc | |
10600 // | |
10601 | |
10602 LOCUS NM_001128828 6982 bp mRNA linear VRT 04-JAN-2017 | |
10603 DEFINITION Gallus gallus neural cell adhesion molecule 1 (NCAM1), transcript | |
10604 variant 1, mRNA. | |
10605 ACCESSION NM_001128828 XM_425812 | |
10606 VERSION NM_001128828.2 | |
10607 KEYWORDS RefSeq. | |
10608 SOURCE Gallus gallus (chicken) | |
10609 ORGANISM Gallus gallus | |
10610 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
10611 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
10612 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
10613 Phasianidae; Phasianinae; Gallus. | |
10614 REFERENCE 1 (bases 1 to 6982) | |
10615 AUTHORS Nakata D and Troy FA 2nd. | |
10616 TITLE Degree of polymerization (DP) of polysialic acid (polySia) on | |
10617 neural cell adhesion molecules (N-CAMS): development and | |
10618 application of a new strategy to accurately determine the DP of | |
10619 polySia chains on N-CAMS | |
10620 JOURNAL J. Biol. Chem. 280 (46), 38305-38316 (2005) | |
10621 PUBMED 16172115 | |
10622 REMARK GeneRIF: analysis of polymerization of polysialic acid on neural | |
10623 cell adhesion molecules | |
10624 REFERENCE 2 (bases 1 to 6982) | |
10625 AUTHORS Milev P, Maurel P, Haring M, Margolis RK and Margolis RU. | |
10626 TITLE TAG-1/axonin-1 is a high-affinity ligand of neurocan, | |
10627 phosphacan/protein-tyrosine phosphatase-zeta/beta, and N-CAM | |
10628 JOURNAL J. Biol. Chem. 271 (26), 15716-15723 (1996) | |
10629 PUBMED 8663515 | |
10630 REFERENCE 3 (bases 1 to 6982) | |
10631 AUTHORS Colwell G, Li B, Forrest D and Brackenbury R. | |
10632 TITLE Conserved regulatory elements in the promoter region of the N-CAM | |
10633 gene | |
10634 JOURNAL Genomics 14 (4), 875-882 (1992) | |
10635 PUBMED 1478668 | |
10636 REFERENCE 4 (bases 1 to 6982) | |
10637 AUTHORS Rao Y, Wu XF, Gariepy J, Rutishauser U and Siu CH. | |
10638 TITLE Identification of a peptide sequence involved in homophilic binding | |
10639 in the neural cell adhesion molecule NCAM | |
10640 JOURNAL J. Cell Biol. 118 (4), 937-949 (1992) | |
10641 PUBMED 1380002 | |
10642 REFERENCE 5 (bases 1 to 6982) | |
10643 AUTHORS Cunningham,B.A., Hemperly,J.J., Murray,B.A., Prediger,E.A., | |
10644 Brackenbury,R. and Edelman,G.M. | |
10645 TITLE Neural cell adhesion molecule: structure, immunoglobulin-like | |
10646 domains, cell surface modulation, and alternative RNA splicing | |
10647 JOURNAL Science 236 (4803), 799-806 (1987) | |
10648 PUBMED 3576199 | |
10649 REFERENCE 6 (bases 1 to 6982) | |
10650 AUTHORS Hemperly,J.J., Edelman,G.M. and Cunningham,B.A. | |
10651 TITLE cDNA clones of the neural cell adhesion molecule (N-CAM) lacking a | |
10652 membrane-spanning region consistent with evidence for membrane | |
10653 attachment via a phosphatidylinositol intermediate | |
10654 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 83 (24), 9822-9826 (1986) | |
10655 PUBMED 3467341 | |
10656 REMARK Erratum:[Proc Natl Acad Sci U S A 1987 May;84(9):3069] | |
10657 REFERENCE 7 (bases 1 to 6982) | |
10658 AUTHORS Cole,G.J., Loewy,A., Cross,N.V., Akeson,R. and Glaser,L. | |
10659 TITLE Topographic localization of the heparin-binding domain of the | |
10660 neural cell adhesion molecule N-CAM | |
10661 JOURNAL J. Cell Biol. 103 (5), 1739-1744 (1986) | |
10662 PUBMED 2430978 | |
10663 REFERENCE 8 (bases 1 to 6982) | |
10664 AUTHORS Murray,B.A., Owens,G.C., Prediger,E.A., Crossin,K.L., | |
10665 Cunningham,B.A. and Edelman,G.M. | |
10666 TITLE Cell surface modulation of the neural cell adhesion molecule | |
10667 resulting from alternative mRNA splicing in a tissue-specific | |
10668 developmental sequence | |
10669 JOURNAL J. Cell Biol. 103 (4), 1431-1439 (1986) | |
10670 PUBMED 3771645 | |
10671 REFERENCE 9 (bases 1 to 6982) | |
10672 AUTHORS Hemperly,J.J., Murray,B.A., Edelman,G.M. and Cunningham,B.A. | |
10673 TITLE Sequence of a cDNA clone encoding the polysialic acid-rich and | |
10674 cytoplasmic domains of the neural cell adhesion molecule N-CAM | |
10675 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 83 (9), 3037-3041 (1986) | |
10676 PUBMED 3458261 | |
10677 REMARK Erratum:[Proc Natl Acad Sci U S A 1988 Mar;85(6):2008] | |
10678 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
10679 preliminary review. The reference sequence was derived from | |
10680 AADN04000117.1. | |
10681 On Apr 6, 2012 this sequence version replaced gi:193220937. | |
10682 | |
10683 Transcript Variant: This variant (1) represents the longer | |
10684 transcript and encodes the longer protein (isoform 1). | |
10685 | |
10686 Sequence Note: The RefSeq transcript and protein were derived from | |
10687 genomic sequence to make the sequence consistent with the reference | |
10688 genome assembly. The genomic coordinates used for the transcript | |
10689 record were based on alignments. | |
10690 | |
10691 ##Evidence-Data-START## | |
10692 RNAseq introns :: mixed/partial sample support SAMEA2201357, | |
10693 SAMEA2201358 [ECO:0000350] | |
10694 ##Evidence-Data-END## | |
10695 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
10696 1-242 AADN04000117.1 1215672-1215913 c | |
10697 243-317 AADN04000117.1 1179523-1179597 c | |
10698 318-536 AADN04000117.1 1177762-1177980 c | |
10699 537-680 AADN04000117.1 1177055-1177198 c | |
10700 681-818 AADN04000117.1 1176052-1176189 c | |
10701 819-936 AADN04000117.1 1175462-1175579 c | |
10702 937-1106 AADN04000117.1 1174938-1175107 c | |
10703 1107-1249 AADN04000117.1 1174679-1174821 c | |
10704 1250-1400 AADN04000117.1 1167323-1167473 c | |
10705 1401-1585 AADN04000117.1 1166565-1166749 c | |
10706 1586-1682 AADN04000117.1 1166116-1166212 c | |
10707 1683-1853 AADN04000117.1 1165618-1165788 c | |
10708 1854-1985 AADN04000117.1 1165055-1165186 c | |
10709 1986-2110 AADN04000117.1 1153742-1153866 c | |
10710 2111-2291 AADN04000117.1 1152847-1153027 c | |
10711 2292-2499 AADN04000117.1 1143238-1143445 c | |
10712 2500-2616 AADN04000117.1 1142932-1143048 c | |
10713 2617-3399 AADN04000117.1 1140940-1141722 c | |
10714 3400-6982 AADN04000117.1 1135018-1138600 c | |
10715 FEATURES Location/Qualifiers | |
10716 source 1..6982 | |
10717 /organism="Gallus gallus" | |
10718 /mol_type="mRNA" | |
10719 /db_xref="taxon:9031" | |
10720 /chromosome="24" | |
10721 /map="24" | |
10722 /breed="Red Jungle Fowl" | |
10723 gene 1..6982 | |
10724 /gene="NCAM1" | |
10725 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1" | |
10726 /note="neural cell adhesion molecule 1" | |
10727 /db_xref="CGNC:5910" | |
10728 /db_xref="GeneID:428253" | |
10729 CDS 191..3520 | |
10730 /gene="NCAM1" | |
10731 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1" | |
10732 /EC_number="2.7.11.1" | |
10733 /note="isoform 1 precursor is encoded by transcript | |
10734 variant 1" | |
10735 /codon_start=1 | |
10736 /product="neural cell adhesion molecule 1 isoform 1 | |
10737 precursor" | |
10738 /protein_id="NP_001122300.2" | |
10739 /db_xref="CGNC:5910" | |
10740 /db_xref="GeneID:428253" | |
10741 /translation="MLPAAALPWTLFFLGAAASLQVDIVPSQGEISVGESKFFLCQVA | |
10742 GEAKYKDISWFSPNGEKLTPNQQRISVVRNDDFSSTLTIYNANIDDAGIYKCVVSSVE | |
10743 EGDSEATVNVKIFQKLMFKNAPTPQEFKEGDDAVIVCDVVSSLPPTIIWKHKGRDVIL | |
10744 KKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPSVRARQ | |
10745 STMNATANLSQSVTLACDADGFPEPTMTWTKDGEPIEQEDNEEKYSFNYDGSELIIKK | |
10746 VDKSDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENKTAMELEDQITLTCEASGD | |
10747 PIPSITWKTSTRNISNEEKTLDGRIVVRSHARVSSLTLKEIQYTDAGEYVCTASNTIG | |
10748 QDSQAMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSAVISWFRDGQLLPSSNY | |
10749 SNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESSEFILVQADTPSSPSIDRV | |
10750 EPYSSTARVEFDEPEATGGVPILKYKAEWRALGEGEWHSRLYDAKEANVEGTITISGL | |
10751 KPETTYSVRLSAVNGKGVGEISLPSDFKTQPVREPSAPKLEGQMGEDGNSIKVNVIKQ | |
10752 DDGGSPIRHYLIKYKAKHSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVIAENQQGK | |
10753 SKPAHYAFRTSAQPTVIPASTSPTSGLGTAAIVGILIVIFVLLLVAVDVTCYFLNKCG | |
10754 LLMCIAVNLCGKSGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTE | |
10755 PNETTPLTEPEHTADTAATVEDMLPSVTTGTTNSDTITETFATAQNSPTSETTTLTSS | |
10756 IAPPATAIPDSNAMSPGQATPAKAGASPVSPPPPSSTPKVAPLVDLSDTPSSAPATNN | |
10757 LSSSVLSNQGAVLSPSTVANMAETSKAAAGNKSAAPTPANLTSPPAPSEPKQEVSSTK | |
10758 SPEKEAAQPSTVKSPTETAKNPSNPKSEAASGGTTNPSQNEDFKMDEGTFKTPDIDLA | |
10759 KDVFAALGTTTPASVASGQARELASSTADSSVPAAPAKTEKTPVEDKSEVQATETKTP | |
10760 PAEVKTVPNEATQTNENESKA" | |
10761 sig_peptide 191..247 | |
10762 /gene="NCAM1" | |
10763 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1" | |
10764 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
10765 misc_feature 644..658 | |
10766 /gene="NCAM1" | |
10767 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1" | |
10768 /experiment="experimental evidence, no additional details | |
10769 recorded" | |
10770 /note="propagated from UniProtKB/Swiss-Prot (P13590.3); | |
10771 Region: Heparin-binding. {ECO:0000255}" | |
10772 misc_feature 671..685 | |
10773 /gene="NCAM1" | |
10774 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1" | |
10775 /experiment="experimental evidence, no additional details | |
10776 recorded" | |
10777 /note="propagated from UniProtKB/Swiss-Prot (P13590.3); | |
10778 Region: Heparin-binding. {ECO:0000255}" | |
10779 misc_feature 2324..2377 | |
10780 /gene="NCAM1" | |
10781 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1" | |
10782 /experiment="experimental evidence, no additional details | |
10783 recorded" | |
10784 /note="propagated from UniProtKB/Swiss-Prot (P13590.3); | |
10785 transmembrane region" | |
10786 ORIGIN | |
10787 1 gtcacggcgg cggcgccggg aggcggccgg ggcgcagcgg gcggagcggg gacacgcgcg | |
10788 61 gagcggagcg gagcggcgcg aaggggacgc ggggcaaaaa cgggaagatc catccggagg | |
10789 121 gccgcgtggt gctccgcccg cacggaacgg ctatttcgga gcggcccctc tcgccccccc | |
10790 181 gccggctgcg atgctgcccg ccgccgcgct gccctggacg ttgttttttc tcggagccgc | |
10791 241 agcctctcta caagtggata ttgttccaag tcagggagag atcagcgttg gagaatccaa | |
10792 301 gttcttctta tgtcaagtgg caggggaagc caaatacaaa gacatttcct ggttttcccc | |
10793 361 taacggtgag aagctgacgc ccaaccaaca gcgcatctca gtggtgcgaa atgatgactt | |
10794 421 ctcctccacc ctcaccatct acaacgccaa cattgatgat gctggcatct ataaatgtgt | |
10795 481 tgtcagcagc gtggaggagg gagactctga agccaccgtc aatgtgaaaa ttttccaaaa | |
10796 541 gctcatgttc aagaatgccc ccactcctca ggaattcaag gaaggggatg atgctgtgat | |
10797 601 tgtgtgtgat gtggtcagct cgctgcctcc taccatcatc tggaaacaca aaggcaggga | |
10798 661 tgtcatccta aaaaaagatg ttcggtttat agtgctgtcc aacaactacc tgcagatccg | |
10799 721 gggaatcaag aaaacagatg aagggacgta ccgctgtgag ggccgcatcc tggctcgtgg | |
10800 781 ggagatcaac ttcaaagata ttcaggtcat tgtaaatgta cctccttctg tgcgtgccag | |
10801 841 gcagagcact atgaacgcca ctgccaacct cagccagtct gtcaccttag catgtgatgc | |
10802 901 tgatggcttt cctgagccaa ccatgacgtg gacaaaggat ggagagccaa tagagcagga | |
10803 961 ggataacgaa gagaaataca gttttaacta tgatgggtcc gagctgatca tcaagaaggt | |
10804 1021 ggataagagt gacgaagcag agtacatctg catcgctgag aacaaggctg gcgagcagga | |
10805 1081 tgccaccatt catctcaaag tctttgcaaa acccaaaatc acatatgtgg agaataaaac | |
10806 1141 agctatggag ctggaggatc agatcacact gacctgtgag gcctctgggg acccaatccc | |
10807 1201 ttccatcacg tggaaaactt ccacccggaa catcagcaat gaagagaaga ccctggatgg | |
10808 1261 gcgcatcgtg gtgcgcagcc acgcgcgggt atcgtccctg actctcaaag aaatccagta | |
10809 1321 cacagacgcc ggagagtacg tgtgcacggc cagcaacacc atcgggcagg actcacaggc | |
10810 1381 catgtacctc gaagtgcagt atgctcccaa gcttcagggc cctgtggctg tctatacctg | |
10811 1441 ggaagggaat caagtgaaca tcacctgtga ggtatttgct tatcccagtg ctgtcatctc | |
10812 1501 ctggttccga gatggacagc tgcttcccag ctcaaactac agcaacatca agatctacaa | |
10813 1561 cactccatca gcaagctacc tggaggtgac accagactct gaaaatgact ttggcaacta | |
10814 1621 caactgcact gctgtgaacc gcattggcca ggaatcctca gagttcattc ttgtgcaggc | |
10815 1681 ggatactccg tcctctcctt ctattgacag agtggagccc tactctagta ctgcccgtgt | |
10816 1741 ggagttcgat gagcctgaag ctactggtgg ggtgcccatc ctcaaataca aagcagagtg | |
10817 1801 gagagcactg ggtgaaggag aatggcactc aagattgtat gatgcaaaag aggcaaatgt | |
10818 1861 ggagggcacg atcactatca gtggcctgaa acctgagaca acctactcag tgagactgtc | |
10819 1921 tgcagtcaat ggcaagggtg tgggtgagat tagcctgcca tccgacttca agacacagcc | |
10820 1981 agttcgggaa cccagtgcac ccaaactgga agggcagatg ggagaagacg gaaactccat | |
10821 2041 caaagtgaac gttatcaagc aggatgatgg tggctcccca atcaggcatt acctgatcaa | |
10822 2101 atacaaagct aaacattcct cagaatggaa accagagatc agactgcctt ctggcagtga | |
10823 2161 ccacgtcatg ctcaagtctc tggactggaa tgcagagtat gaggtttatg tgatagctga | |
10824 2221 aaaccagcag gggaagtcca aacccgctca ctacgctttc cggacatctg ctcagcctac | |
10825 2281 tgtcatccca gccagcacta gccctacgtc aggcctgggg actgctgcca tcgtaggcat | |
10826 2341 tctcattgtt atctttgtgc tgctcctggt ggctgtggac gtcacctgct acttcctgaa | |
10827 2401 caaatgtggc ctgctcatgt gcattgctgt caacttatgt ggcaagtctg gaccaggagc | |
10828 2461 caagggcaaa gacatggagg agggcaaagc tgccttctcg aaagatgagt ccaaggagcc | |
10829 2521 tattgtggaa gtgcggactg aagaggagcg gacccccaac catgatgggg gaaaacacac | |
10830 2581 agagcccaac gagaccaccc cactaacaga accagagcac accgccgata ctgcagctac | |
10831 2641 tgttgaggac atgctgcctt ctgtaactac gggcaccact aactctgaca ctatcactga | |
10832 2701 aacttttgcc actgctcaga acagccccac gagcgagacc accaccctga cctccagtat | |
10833 2761 tgccccgcca gccacggcca ttcctgactc aaacgccatg tcgcctggcc aggctactcc | |
10834 2821 agccaaagcg ggagcctccc ctgtctctcc accaccaccc tcctctacgc ccaaagtggc | |
10835 2881 cccccttgtt gatctcagcg ataccccaag ctctgctcca gctactaata atttgtcttc | |
10836 2941 aagtgtcctg tccaaccaag gtgcagtgct gagccccagc actgttgcta acatggccga | |
10837 3001 gacctccaaa gcagcagctg gtaacaagtc agctgcccca acccctgcaa acctcactag | |
10838 3061 tcctccagct ccatcagagc ccaagcagga ggtctcaagc accaagagcc ccgagaaaga | |
10839 3121 agctgcgcag cccagtacag tgaagagccc aacagagaca gccaagaatc caagcaatcc | |
10840 3181 gaagagtgag gctgcttcag gcggcaccac aaacccctcc cagaatgagg actttaaaat | |
10841 3241 ggacgaaggg accttcaaga caccagacat tgatcttgca aaggatgttt ttgcagctct | |
10842 3301 tggcactact actcctgcca gtgtggctag tgggcaagct cgtgagcttg cttcttccac | |
10843 3361 tgcagacagc tctgtacctg ctgcacctgc aaagaccgag aaaaccccag tagaagacaa | |
10844 3421 atctgaagtg caagcaacgg aaactaagac acctccagca gaagtgaaga cggtccccaa | |
10845 3481 cgaagccaca caaacaaatg agaatgagag caaagcatga tcagcgacag atgaaaaacc | |
10846 3541 atggcagaac gacttcaccc aagcatttac aacacgaaac acaacacaca tctcattcct | |
10847 3601 ctagtgtctg ttgccttttt tttaaaaaac aaacaaacaa acaaaacaga aaatgcataa | |
10848 3661 atggggaggg gggggttctc tctttttttc tttttctttt tcttaagatt tttaggaagg | |
10849 3721 ttctatttgt tgtgtacttg cttttaaaaa gtaacacgtt ttaaaaacag ggttaaaccc | |
10850 3781 atcaccagat cgggggctca gctgtcccct ggtatgttca aacaagcaga attgcagaat | |
10851 3841 accacttaga gcatcgctga ggagctcaga gtcacccagt cgtagacgaa aggaaaaaaa | |
10852 3901 gagaaaagaa aaaagaagac cctgttcttt ccttggttag aatagtagat ttaaccactg | |
10853 3961 tactgcttgc ctgcttggta caggcggtac ttagtgaaca aagtccacaa tttattttta | |
10854 4021 tacttttcag tcgagtttga aatatgtaaa gcctcataaa taagttataa tttctgttca | |
10855 4081 ccttgtgttc agtatgcaaa gtgtcgtgag cattttgtgg ctgaattctg ttctcctcgt | |
10856 4141 tagacattga ttttggggtt tattattttt gttaggaaga atgccaaaat tgcagcttcg | |
10857 4201 ggggatgtat ttcaatttgc agtattcaga ctctacattt ctttaaattt tatgttaatt | |
10858 4261 tttgccaact tttgttctct ccagtgttta caattgacat ttttttaact tttgttgtgt | |
10859 4321 ttaaatgtat ttgtaaaata gctgcctttt ttttaaagta aatccagact ctagctacta | |
10860 4381 ggttagcagc atgcttgctt tgcaaaggga gacattttga aatatcgatg tttacagtag | |
10861 4441 tttccccctt tatctttttt aattattatt attattataa ttattattat tatttcttac | |
10862 4501 tggagtaaga aaaaagagta atgctggtct ttggtttgtt ttaggggggt ggggcgtggg | |
10863 4561 gaatattcca accacttgtc accaatcgag gtctgtatcc agcaatccac ataaacacac | |
10864 4621 ttcactttga acgagagagt tgctggagag agtttcctta tatacttaaa tttattaaga | |
10865 4681 gtgtaagtcc cttgctggac ctgggcctga atgcataaga aaaatatcat ctctgctttt | |
10866 4741 ttaggacatt cttctctttc cttcatggaa ccctcccaga gctttgagaa gcagaagagg | |
10867 4801 gattgtacag ttagggctgg gctggtcttg tctccactgt ttgactacat ccatttctct | |
10868 4861 gtagaatgtt gataactgcc atttcctttg accccagaaa ctgatttaaa agcaatgcct | |
10869 4921 ttccgcactt aaataaagtt tccttttgag gagtggtaac actaaaaaca gaacatcctg | |
10870 4981 ctctcatgtg ggtgatgttc atgagcagag ggtgcttggc agcatgcagg tgtccttact | |
10871 5041 cattgcaggg aagttggact agatgaccct taagggtccc ttccaaccca aacgattcta | |
10872 5101 tgactctcca taagacccct tctgcaaagt cagctccagc acattgtgtc tgataagtca | |
10873 5161 tccgtgtatg ctttgcatca tccaggccat gtatccatgg ctgagtgctt gggcatcagt | |
10874 5221 gccaacgctc ccattgatgt ccctgctctt ctcatcatgc ttttagcagt cagagaaagg | |
10875 5281 ggctgatgtc acacatgcgt tgttgtggtc gtcactggga gtcatggagt aacactgaga | |
10876 5341 cttcagggtg ggaagaagag aaggttgagc agcaggaagg cagaggaaga ccagcccatt | |
10877 5401 gtatagaggt gctccttctc tgggggtttt gctttgtttg tttttctttt attttccatt | |
10878 5461 cttttttttt ttttttttct actttagatc tgcaagcttg tgcactgtgg gtgcgtgact | |
10879 5521 tttagtgtga aacgtgtttt ttgtcatagt attgaaataa ttgaaaaaaa aaaaaagctt | |
10880 5581 caacatagtt tggatgtgga aggtgtagcg gataggtcag atttaaaata tatatattca | |
10881 5641 ggaaaaaaaa aaagagaaca acttctagga ggaacacaag cctttaaatg acaaacccga | |
10882 5701 gctgatgatg gcatcattgc atcgcgccat ggggacgagc agaagggtga tggggttggg | |
10883 5761 gagatcatgc ttggctcggg tgaactgagc cactatcgtt ggtgtgtcct tctgagtatg | |
10884 5821 cagtctttta cagtggcatc acatgatttc aaacagtgta aaacagtggt tttgtcattt | |
10885 5881 gctaagtgtg gggtttttgc attttttcct cagctcctgg ggatggaagt ggaggatggc | |
10886 5941 tggctatgca ggcacagaca ctcaggcaat accatcccag gcagaacagc agggcaggac | |
10887 6001 aggttcccac ttgagagcct tgtgtcagat tcagcccatg cttgacccat gacagcagcg | |
10888 6061 ttgatgtaag taaggcgaaa tttggtccgt ggtccctagg accttatata tcatgcctcc | |
10889 6121 ccgagcagca acaggagcaa acgctgctca gcgcagtgac ccggagtatg tccagtgcca | |
10890 6181 ctgatcagca cccattgggt ggcactgtgg tggctgtcac ccagactggt gtttctgcca | |
10891 6241 tgtaaggcca ccagcccagg gccccatcca gcacccggcc gtgtcacagt gcccggtacc | |
10892 6301 tgctgggttg tgtcctgtgg atggagcctc tgtgctgctc ccttagtgcc cctgtgacct | |
10893 6361 ccccatcccc agaaccctta gattaatttt ggagagtgtt tttatacttg cccttaatgg | |
10894 6421 agaataattt gttttaactt ataaatatcc cattcccaag gtagcttagg cttcattgct | |
10895 6481 tttatttaaa cctttgaaga gggaccaacc tgatgccgtt tgcgctgtat atgtttatat | |
10896 6541 atgtatccat gccatacata tatatatcta tatggcaact cagactgatc agcttctagt | |
10897 6601 tgtggagtga catttcatgc tgcaccatac gtaacgatga tgaggtaata gtgcatccag | |
10898 6661 ttgttcagct tttagagtgg aattttattt tcacactttt ctatggagcc ttcaaacccc | |
10899 6721 aggttttcac actaggctgt tttgatagtt gttctcagac ctccactgac atccttaccc | |
10900 6781 agcattccct acttttgggg gccttctatc ttgttaaaaa aacaaaaaaa caaaaaatct | |
10901 6841 ttttaccgag tgaaacatca gttccacctt tattcccatt ctcactggtg taaatactga | |
10902 6901 tactaactga ggattttgac tttgcattct gtcagaatac tgtgttcaaa taaaaattac | |
10903 6961 aaaaaaaaaa taccaacaaa aa | |
10904 // | |
10905 | |
10906 LOCUS NM_001252284 2790 bp mRNA linear VRT 04-JAN-2017 | |
10907 DEFINITION Gallus gallus myelin protein zero like 2 (MPZL2), mRNA. | |
10908 ACCESSION NM_001252284 | |
10909 VERSION NM_001252284.1 | |
10910 KEYWORDS RefSeq. | |
10911 SOURCE Gallus gallus (chicken) | |
10912 ORGANISM Gallus gallus | |
10913 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
10914 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
10915 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
10916 Phasianidae; Phasianinae; Gallus. | |
10917 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
10918 NCBI review. The reference sequence was derived from | |
10919 AADN04000117.1. | |
10920 | |
10921 Sequence Note: The RefSeq transcript and protein were derived from | |
10922 genomic sequence to make the sequence consistent with the reference | |
10923 genome assembly. The genomic coordinates used for the transcript | |
10924 record were based on alignments. | |
10925 | |
10926 ##Evidence-Data-START## | |
10927 Transcript exon combination :: BU399092.1, BX932694.1 [ECO:0000332] | |
10928 RNAseq introns :: mixed/partial sample support | |
10929 SAMEA2201357, SAMEA2201358 | |
10930 [ECO:0000350] | |
10931 ##Evidence-Data-END## | |
10932 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
10933 1-354 AADN04000117.1 800833-801186 c | |
10934 355-521 AADN04000117.1 798706-798872 c | |
10935 522-732 AADN04000117.1 797908-798118 c | |
10936 733-2790 AADN04000117.1 795605-797662 c | |
10937 FEATURES Location/Qualifiers | |
10938 source 1..2790 | |
10939 /organism="Gallus gallus" | |
10940 /mol_type="mRNA" | |
10941 /db_xref="taxon:9031" | |
10942 /chromosome="24" | |
10943 /map="24" | |
10944 /breed="Red Jungle Fowl" | |
10945 gene 1..2790 | |
10946 /gene="MPZL2" | |
10947 /gene_synonym="eva; EVA1" | |
10948 /note="myelin protein zero like 2" | |
10949 /db_xref="CGNC:51090" | |
10950 /db_xref="GeneID:419779" | |
10951 misc_feature 132..134 | |
10952 /gene="MPZL2" | |
10953 /gene_synonym="eva; EVA1" | |
10954 /note="upstream in-frame stop codon" | |
10955 CDS 300..881 | |
10956 /gene="MPZL2" | |
10957 /gene_synonym="eva; EVA1" | |
10958 /note="epithelial V-like antigen 1" | |
10959 /codon_start=1 | |
10960 /product="myelin protein zero-like protein 2 precursor" | |
10961 /protein_id="NP_001239213.1" | |
10962 /db_xref="CGNC:51090" | |
10963 /db_xref="GeneID:419779" | |
10964 /translation="MPGPTWLGAVLVLGVQLRALWPVAAIEVYTSKEVYAVNGTSLRL | |
10965 KCTFSSSSPISPLLSVTWNFQPEDLSSHEPVFYYLKEPYTPSAGRFKGRITWDGHIER | |
10966 HDVSIVIWDLQPTDNGTFTCQVKNPRDIDGTIGEVRLRVVQKVNFSEIHFLAIAIGSA | |
10967 CGLMIIVVTLVIICRHRRKKQQEKMIEVADTEL" | |
10968 sig_peptide 300..374 | |
10969 /gene="MPZL2" | |
10970 /gene_synonym="eva; EVA1" | |
10971 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
10972 ORIGIN | |
10973 1 ggatgattgc aacacaaaag agcaggggaa tatgggaggc agaagaaatt aatcttacct | |
10974 61 tgaaaatctg cctgctttac acgcagaagt gaaccgtctg actgccccac ctcaccttca | |
10975 121 gtgcagggca gtgacggggc aggaagacgt attgccttcc aggccaagct gagaaaaagg | |
10976 181 aatttactca accggcccgg gaaggctttg agaaactcat cttttatccg gttttcaaga | |
10977 241 gcctgaaaca aacttccccc tgtgctgctc agcccgcaga gcacggactt gtttccccga | |
10978 301 tgcctggccc cacctggctg ggggctgtgc tcgtccttgg ggtacagctc cgagcactgt | |
10979 361 ggcctgttgc agccatagaa gtttatactt ctaaggaggt gtatgctgtg aatggaacta | |
10980 421 gcctacggct caaatgcacc ttctccagca gcagccctat tagcccactg ctgtcagtga | |
10981 481 cctggaactt ccagcccgag gacctaagct ctcatgagcc agtattttat tatctcaagg | |
10982 541 agccctacac gccgtctgct ggacgattta aagggcgaat cacttgggat gggcatattg | |
10983 601 agcgtcatga tgtttccatc gttatctggg atttacagcc cactgacaat ggaacattca | |
10984 661 cctgccaagt gaagaaccca cgagacatcg atggcaccat tggagaagtg cgactcagag | |
10985 721 ttgtgcagaa agtgaatttc tcagaaatcc acttccttgc catagccatt gggtctgcat | |
10986 781 gtggtctgat gatcattgtg gtgacacttg tgattatctg tcggcatcgt cggaagaaac | |
10987 841 agcaagagaa gatgatcgag gtggcagaca ctgaactgta agcacaaaag gggagaggga | |
10988 901 gaaaggcttc tgggaaagct tgtcaaatat atcttcatgg gcattctgaa tcattggctt | |
10989 961 gggtcctata ttaagcatct acaatgcaaa actgccaaca taattagcaa taattggctg | |
10990 1021 cttacttgca gtcagaacag agccccaggg acgaatgaac tttggagtct tcattttgct | |
10991 1081 cttctacttt gaggtggctc cttactcaga gtagaagccc atacaaattc ctgttatata | |
10992 1141 ctatgtatgt tgtatgtagc tcagaacctc actgctgctc aggatatctg atgctgattt | |
10993 1201 tctttttttt tccttttttt attattgttt tgtcactttt ttcatagcag cagagaaaag | |
10994 1261 gagaagctga agaatattgg agagaaggaa atcactccat tagaagacta gaggtctctg | |
10995 1321 atagtatata caatgcaggt atctaatcaa acattctcta attaatgtgt tggtgttact | |
10996 1381 gcagactttc tagacagttt tatttacgta tttcacatcc attctgcagt cagcaggcca | |
10997 1441 cagtggccat aaatatgaac aactaagacc acagacacat gttgctcttg aggaaccttc | |
10998 1501 agaggaagac tgaaaactga ataggcggtc gtgacagagc ttaaccttaa tctctcttaa | |
10999 1561 ccataagagg gatttctcca ccttattgct gaggatcatt gcaggaaagc aattattgct | |
11000 1621 gctttccatg ttgtgcttgc tctgtggaga gaggaataaa ttccctttca ctagttttga | |
11001 1681 atatgctttt tgattcactt aatctttaat tccttataat cgctacagga agactgaaac | |
11002 1741 tctttccaga tttgctggcc ttactgaaat atttcagccc agtttttccc cattcaattt | |
11003 1801 ctgaggtcaa cagatgcttc ccccatgttt gttttcaaca ataatcatga gtaatgaatg | |
11004 1861 ttttgttttt cttccaatcc tccttctcag gtacttctaa agcagatggt gaaagcttgt | |
11005 1921 aattttggat cttagaacaa agctgaatta cagacgcctg atgctggaag tgtggtatcc | |
11006 1981 ctgctcaacc tgaaattctt gcaagaaaag agagtgacct taacataagt tgtaaagtgt | |
11007 2041 tatttccttc actgaagaac aacaggaaga ccttgcccca cgaacaggga gccgtcctta | |
11008 2101 atctccacag ctgccaaacg tgaacaaatt ggttgtgagg atgcaatgtc agccgatttg | |
11009 2161 aaccaaacgc cgagatgagt gactggatag atatttgctg tgtctgagca ggcacacgct | |
11010 2221 cgtgcacctt aaaaattgaa aggtaccttt gtgctgccag attattgtgt ctggtgtcac | |
11011 2281 ctaaaggaag accattaggt gagggatcag aggagctgct acaacgtact ttaagtcgct | |
11012 2341 ttgctactgt aagtggaaag tgttacagat aaggaatgtc tgctgtttcc tgttagggat | |
11013 2401 aactggacca gtgggtgtgt ttttcacgcc agtaggcttt gtccatggaa tagctgagaa | |
11014 2461 aacatcctcc cactggcaca gcactgtttc tctggatgtt gcttaaagcc ccacatagca | |
11015 2521 ccagcacatc ttacccctgt aaatccacct gtttaacaca ttccctgtat tttcatcgaa | |
11016 2581 cctcaagcaa acggaacccc gggtcactaa aaccactgag ctatttgggt gtttaaccaa | |
11017 2641 cactaaatca aaatatcagc ctgtttattc aaagagtaac tttatggctt tataactctt | |
11018 2701 gagtgtaaca tgctgaccaa gttatctgtt tgtacagttt tgttttctat cgtgtccatc | |
11019 2761 ataaataaac gcggtttgtg ggtagaagtg | |
11020 // | |
11021 | |
11022 LOCUS NM_001006305 971 bp mRNA linear VRT 04-JAN-2017 | |
11023 DEFINITION Gallus gallus NFU1 iron-sulfur cluster scaffold (NFU1), mRNA. | |
11024 ACCESSION NM_001006305 XM_417664 | |
11025 VERSION NM_001006305.2 | |
11026 KEYWORDS RefSeq. | |
11027 SOURCE Gallus gallus (chicken) | |
11028 ORGANISM Gallus gallus | |
11029 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
11030 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
11031 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
11032 Phasianidae; Phasianinae; Gallus. | |
11033 REFERENCE 1 (bases 1 to 971) | |
11034 AUTHORS Shin JH, Kim H, Lim D, Jeon M, Han BK, Park TS, Kim JK, Lillehoj | |
11035 HS, Cho BW and Han JY. | |
11036 TITLE Analysis of chicken embryonic gonad expressed sequenced tags | |
11037 JOURNAL Anim. Genet. 37 (1), 85-86 (2006) | |
11038 PUBMED 16441308 | |
11039 REFERENCE 2 (bases 1 to 971) | |
11040 AUTHORS Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, | |
11041 Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci | |
11042 P, Hayashizaki Y and Buerstedde JM. | |
11043 TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate | |
11044 gene function analysis | |
11045 JOURNAL Genome Biol. 6 (1), R6 (2005) | |
11046 PUBMED 15642098 | |
11047 REFERENCE 3 (bases 1 to 971) | |
11048 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
11049 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
11050 TITLE A comprehensive collection of chicken cDNAs | |
11051 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
11052 PUBMED 12445392 | |
11053 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
11054 preliminary review. The reference sequence was derived from | |
11055 CN210054.1, CV862347.1 and BU403624.1. | |
11056 On Sep 27, 2011 this sequence version replaced gi:57529446. | |
11057 | |
11058 ##Evidence-Data-START## | |
11059 Transcript exon combination :: AJ721119.1, BU330969.1 [ECO:0000332] | |
11060 RNAseq introns :: single sample supports all introns | |
11061 SAMEA2201357, SAMEA2201358 | |
11062 [ECO:0000348] | |
11063 ##Evidence-Data-END## | |
11064 | |
11065 ##RefSeq-Attributes-START## | |
11066 gene product(s) localized to mito. :: inferred from homology | |
11067 ##RefSeq-Attributes-END## | |
11068 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
11069 1-679 CN210054.1 1-679 | |
11070 680-905 CV862347.1 613-838 | |
11071 906-968 CV862347.1 839-901 | |
11072 969-971 BU403624.1 705-707 | |
11073 FEATURES Location/Qualifiers | |
11074 source 1..971 | |
11075 /organism="Gallus gallus" | |
11076 /mol_type="mRNA" | |
11077 /db_xref="taxon:9031" | |
11078 /chromosome="22" | |
11079 /map="22" | |
11080 /breed="Leghorn" | |
11081 gene 1..971 | |
11082 /gene="NFU1" | |
11083 /gene_synonym="HIRIP5" | |
11084 /note="NFU1 iron-sulfur cluster scaffold" | |
11085 /db_xref="CGNC:14" | |
11086 /db_xref="GeneID:419513" | |
11087 CDS 30..788 | |
11088 /gene="NFU1" | |
11089 /gene_synonym="HIRIP5" | |
11090 /note="HIRA interacting protein 5" | |
11091 /codon_start=1 | |
11092 /product="NFU1 iron-sulfur cluster scaffold homolog, | |
11093 mitochondrial" | |
11094 /protein_id="NP_001006305.2" | |
11095 /db_xref="CGNC:14" | |
11096 /db_xref="GeneID:419513" | |
11097 /translation="MAAARWLGAAAGLGGRICHTMLKGHNLTTQQPFHQLARRKQLLP | |
11098 SAVLHNTVRCMFIQTQDTPNPNSLKFIPGKEVLESRTMEFSSPAAAFCSPLARQLFRI | |
11099 EGVKSVFFGPDFITITKESEDLDWNLLKPDIYATIMDFFASGLPVLTEEAPRTDTAQS | |
11100 EEDDEVVLMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLK | |
11101 NGIQNMLQFYIPEVEGVEQVVDDDDDVEKEANST" | |
11102 ORIGIN | |
11103 1 gcggagcggc ggccgtgagg aacgccaaga tggcggctgc gcggtggctc ggcgcggctg | |
11104 61 cggggctggg cggccggatt tgtcacacga tgttaaaagg tcataacctg acaactcaac | |
11105 121 agcccttcca ccaacttgca aggaggaaac agcttcttcc atctgcagtg ttgcataata | |
11106 181 cagtaagatg catgtttatt caaactcagg acacaccaaa cccaaacagc ctgaagttta | |
11107 241 ttccaggcaa agaagtgctg gagtccagga ctatggagtt ttccagccca gctgcagcat | |
11108 301 tttgctcacc tctagcaagg cagttattca gaattgaagg agttaaaagc gttttctttg | |
11109 361 ggccagactt catcaccatc accaaggaga gtgaagacct ggattggaac ttgctgaaac | |
11110 421 cagatattta tgcaactata atggatttct ttgcctcagg tttacctgta cttactgaag | |
11111 481 aggcacctag gacagataca gctcagtcag aagaagacga tgaagttgtg ttaatgatta | |
11112 541 aagaactgct ggatacaaga ataaggccaa cagtgcaaga agatggtggt gatgttattt | |
11113 601 ataaaggctt tgaggatggc attgtgcagc tgaagttgca gggttcatgc accagctgtc | |
11114 661 ccagttccat catcaccctg aagaacggga tacagaacat gctccagttc tacatccctg | |
11115 721 aagtggaagg cgtggaacag gttgttgatg atgatgatga tgtggagaaa gaagcaaatt | |
11116 781 ctacgtgagc ttccatcatc cgtggccaaa tcagtattta tttcatgtac gtaaatcagc | |
11117 841 ctcgttctgt ggaacaacca aatctgcctt tctcatcaga aaaagagtca cacttccacc | |
11118 901 tgtgagagtg tctgctcagt gtcagcagcg tgttcactaa tttattaaat gctgtctgtt | |
11119 961 caaacaaaga a | |
11120 // | |
11121 | |
11122 LOCUS NM_001024456 3708 bp mRNA linear VRT 04-JAN-2017 | |
11123 DEFINITION Gallus gallus N-ethylmaleimide sensitive factor, vesicle fusing | |
11124 ATPase (NSF), mRNA. | |
11125 ACCESSION NM_001024456 XM_418094 | |
11126 VERSION NM_001024456.1 | |
11127 KEYWORDS RefSeq. | |
11128 SOURCE Gallus gallus (chicken) | |
11129 ORGANISM Gallus gallus | |
11130 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
11131 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
11132 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
11133 Phasianidae; Phasianinae; Gallus. | |
11134 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
11135 NCBI review. The reference sequence was derived from CR406350.1. | |
11136 On Sep 21, 2011 this sequence version replaced gi:118102798. | |
11137 | |
11138 ##Evidence-Data-START## | |
11139 Transcript exon combination :: CR406350.1 [ECO:0000332] | |
11140 RNAseq introns :: mixed/partial sample support | |
11141 SAMEA2201357, SAMEA2201358 | |
11142 [ECO:0000350] | |
11143 ##Evidence-Data-END## | |
11144 FEATURES Location/Qualifiers | |
11145 source 1..3708 | |
11146 /organism="Gallus gallus" | |
11147 /mol_type="mRNA" | |
11148 /db_xref="taxon:9031" | |
11149 /chromosome="27" | |
11150 /map="27" | |
11151 /breed="Leghorn" | |
11152 gene 1..3708 | |
11153 /gene="NSF" | |
11154 /note="N-ethylmaleimide sensitive factor, vesicle fusing | |
11155 ATPase" | |
11156 /db_xref="CGNC:715" | |
11157 /db_xref="GeneID:419972" | |
11158 CDS 6..2228 | |
11159 /gene="NSF" | |
11160 /EC_number="3.6.4.6" | |
11161 /codon_start=1 | |
11162 /product="vesicle-fusing ATPase" | |
11163 /protein_id="NP_001019627.1" | |
11164 /db_xref="CGNC:715" | |
11165 /db_xref="GeneID:419972" | |
11166 /translation="MAGRPMQAARCPTDELSLTNCAVVNDTDFPSGQHVVVKTSPNHK | |
11167 YIFTLRTHPSVVPGNIAFSLPQRKWAGLSIGQEIDVSLYTFDKSKQCIATMTIEIDFL | |
11168 QKKNIDSNPYDTDKMAAEFIQQFNSQAFSVGQQLVFSFNDKLFGLLVKSMEGMDPSIL | |
11169 KGESGASKKQKIEVGLVFGNSQVAFEKAENSSLNLIGKSKTKENRQSIINPDWNFEKM | |
11170 GIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTLMARQIGKM | |
11171 LNAREPKVVNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGVHIIIFDEIDAIC | |
11172 KQRGSMAGSTGVHDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVK | |
11173 MEIGLPDEKGRFQILHIHTVRMREHQLLAEDVDIAELAVETKNFSGAELEGLVRAAQS | |
11174 TAMNRHIKASTKVEVDMEKAESLRVTRGDFFASLENDIKPAFGTNQEDYASYIMNGII | |
11175 KWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIK | |
11176 ICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQ | |
11177 ALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLMEALEL | |
11178 LGNFKDKERSTIAQNVKGKSVWIGIKKLLMLIEMSLQMDPEYRVKKFLALLREEGTVP | |
11179 " | |
11180 ORIGIN | |
11181 1 acaagatggc ggggcggcct atgcaagcag cacgatgtcc cactgatgaa ctgtcattaa | |
11182 61 cgaactgtgc ggtggtgaat gacacagact tcccatctgg acaacacgtt gtggtgaaga | |
11183 121 cttctcccaa tcacaaatac atcttcacac tgagaacaca tccctctgtt gttcctggca | |
11184 181 acatcgcctt cagcttgccc cagagaaaat gggctggact ttccatagga caagagatag | |
11185 241 acgtttccct gtacactttc gacaagtcta agcagtgtat tgccacgatg acgattgaga | |
11186 301 tagactttct gcagaagaag aacattgact ccaacccata tgacacagac aagatggctg | |
11187 361 ctgagttcat ccagcagttc aacagccagg ccttctctgt agggcagcag cttgtgttca | |
11188 421 gttttaacga caaacttttc ggcctgttgg taaagtccat ggaaggaatg gatcccagca | |
11189 481 tcctcaaagg agagtctgga gcaagcaaaa agcagaagat tgaggtgggt ttggtttttg | |
11190 541 gaaacagcca agtggccttt gaaaaagctg agaattcctc tctcaatctg attggtaaat | |
11191 601 caaagaccaa agagaaccgc cagtccatca tcaacccaga ctggaatttt gagaaaatgg | |
11192 661 gcattggggg cctcgacaaa gagttctcag atatcttccg acgagctttt gcttctcgag | |
11193 721 tttttccacc tgaaattgtg gagcaaatgg gctgcaagca tgtgaaaggc attctgctgt | |
11194 781 atggacctcc aggctgtggt aaaacgctta tggccagaca gattggcaag atgctgaatg | |
11195 841 ccagagaacc aaaagtggtc aacgggccag aaatcctcaa taaatacgtg ggcgagtctg | |
11196 901 aggccaacat ccgcaagctg tttgctgatg cagaagagga acaaagaagg cttggagcaa | |
11197 961 acagtggtgt tcatatcatc attttcgatg agattgatgc aatctgcaag cagcgaggaa | |
11198 1021 gcatggcagg aagcactgga gttcacgata ccgttgtcaa ccagctgctg tctaaaattg | |
11199 1081 atggagtgga gcaactcaat aacatcctgg tgattggaat gaccaacaga cctgacctga | |
11200 1141 ttgatgaagc tctgctgaga ccagggagac tggaggtgaa aatggagatt ggtttgccag | |
11201 1201 atgagaaggg tcgattccag attctccata tccacacagt aaggatgcgg gaacaccagc | |
11202 1261 tgctggctga agatgtggac attgcagaac tggcagttga gacaaaaaac ttcagtggtg | |
11203 1321 ctgaattaga aggtttagtt cgagctgctc agtctactgc aatgaacaga catatcaagg | |
11204 1381 ccagcaccaa agtggaagta gacatggaga aggcagaaag cttacgtgtg acaagaggag | |
11205 1441 acttctttgc atccttggag aatgatatca aaccagcatt tggaaccaac caggaagact | |
11206 1501 acgcgagtta tatcatgaat ggcattatta agtggggtga tccagtaacg agggtgttgg | |
11207 1561 atgatgggga gctgcttgtt caacaaacca agaacagtga ccgtactccg ctggttagcg | |
11208 1621 ttcttctaga aggtccccca cacagtggga agactgcatt agcagcaaag atagctgagg | |
11209 1681 aatccaactt ccctttcatc aagatctgtt ctcctgataa gatgattgga ttttcagaaa | |
11210 1741 cagccaaatg ccaggctatg aagaagatct ttgatgatgc atacaagtcc cagctcagct | |
11211 1801 gcgtcgttgt ggatgacatt gagagacttc tagattatgt tccaattggg ccacgttttt | |
11212 1861 ctaatctggt gttgcaagcc cttcttgtgc tgctgaagaa ggccccccct cagggtcgca | |
11213 1921 agctcctgat cattggaacc accagtcgca aagatgtcct gcaggaaatg gaaatgctga | |
11214 1981 atgctttcag caccacgatc catgtaccca acattgcaac aggggaacag ctgatggaag | |
11215 2041 ctttggagct cctgggtaac tttaaagata aggaacgcag caccattgca cagaacgtca | |
11216 2101 aagggaaatc tgtttggatc ggtatcaaga agctgctgat gctgatagag atgtcactac | |
11217 2161 aaatggatcc tgagtatcgg gtgaaaaaat tcttggctct tctgagagaa gaaggaacag | |
11218 2221 ttccctagac tgaagatgga ccaagtgcaa gatcagcagc tggaaaagtg accaacctgg | |
11219 2281 agaatataca ctgggatctt tactcttctg tgttcaacac actggacaaa gtgaaacact | |
11220 2341 cccctttttc caagaaccca atgtggaatt tgcatgttta gtgcaataca gtatctttat | |
11221 2401 tctttgtctt taatatacag atatcatgtg tcttctagaa cactgtgctt ctgtctctgt | |
11222 2461 gcaggcaagg ctgcgttctc atttgatttt agcatggggg aaatgttcta taagttttga | |
11223 2521 agcaacgctc acttatgtcc agcatccagt tactacagta ggaaagaaaa tgtgagttct | |
11224 2581 agtaaatcct gtggtgaagg cttattaaaa tactcctctg tgttctgatt tgatgaatgc | |
11225 2641 tttcttgttc ggttatgtca tcctatgcct cactgaacac tgagcagggc tgctaaccca | |
11226 2701 gagtcagtga ccacagtaat gaaacttcag aatttccaaa atgtaaatac ccattttctt | |
11227 2761 ttatgcccag gtgttttctg gctaatgata ataaggactg gaagaaggca gggaagtcta | |
11228 2821 ttgatcagaa caaaggaaaa acttcagaat ctggtatttt aaagcattga aacttgttct | |
11229 2881 caattcaaaa accggtttag tggtgctgat tccaacctga aagctctgta tgagtactct | |
11230 2941 gtatatgatg gttttggcat tagttggcct cactacatcc cagttttctg ccacattacc | |
11231 3001 aaaggatgaa gttcctcctt ggagatgaag ccaagctcta tggatgcacg agatgtgcat | |
11232 3061 tgccatgctt ttgcacttaa actaaggaat gtatcaaact ttgctatgtg gtctttcccc | |
11233 3121 aatagtcttt ttgcatcaat gaggtgctgt tatgatgact gcacgaggat actcccctgt | |
11234 3181 ggttccttgg ctccacatgt ttaataaggt tcatggaaca tacctcaatt tggtggggca | |
11235 3241 cgcaatcaaa gccatttatg aggtgttagt cagtgtagct tccttgactt gacaggacat | |
11236 3301 gctgttaagg gctagcagct tgtatccagc gaggtgttcc cagggaagga gggtgctttg | |
11237 3361 cgttttttca ggcccaaagg taaaggtact gcagtcctta ttgcatactt agggcaatca | |
11238 3421 gagtgtttca gtcactccac tctggtttct tttcctttgg cagtgctgtt gtattgtgat | |
11239 3481 gacattgcga gtcccagtgg ttattattcc ctctcattct gtgtatgatc ttgtgacttt | |
11240 3541 gtttgttcct ttctttcctc tgctagtccc tgtgacagca gcactcgtta acttatttca | |
11241 3601 gagtaaatga tgtaaacctt attgtgtcta tgtccagagc tatattgatg aataaatatc | |
11242 3661 ttgttcagtt gcacattatt ggattcaata aaaaaaagca caactgtg | |
11243 // | |
11244 | |
11245 LOCUS NM_001242604 6232 bp mRNA linear VRT 04-JAN-2017 | |
11246 DEFINITION Gallus gallus neural cell adhesion molecule 1 (NCAM1), transcript | |
11247 variant 2, mRNA. | |
11248 ACCESSION NM_001242604 XM_001234121 XM_015298042 | |
11249 VERSION NM_001242604.1 | |
11250 KEYWORDS RefSeq. | |
11251 SOURCE Gallus gallus (chicken) | |
11252 ORGANISM Gallus gallus | |
11253 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
11254 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
11255 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
11256 Phasianidae; Phasianinae; Gallus. | |
11257 REFERENCE 1 (bases 1 to 6232) | |
11258 AUTHORS Nakata D and Troy FA 2nd. | |
11259 TITLE Degree of polymerization (DP) of polysialic acid (polySia) on | |
11260 neural cell adhesion molecules (N-CAMS): development and | |
11261 application of a new strategy to accurately determine the DP of | |
11262 polySia chains on N-CAMS | |
11263 JOURNAL J. Biol. Chem. 280 (46), 38305-38316 (2005) | |
11264 PUBMED 16172115 | |
11265 REMARK GeneRIF: analysis of polymerization of polysialic acid on neural | |
11266 cell adhesion molecules | |
11267 REFERENCE 2 (bases 1 to 6232) | |
11268 AUTHORS Milev P, Maurel P, Haring M, Margolis RK and Margolis RU. | |
11269 TITLE TAG-1/axonin-1 is a high-affinity ligand of neurocan, | |
11270 phosphacan/protein-tyrosine phosphatase-zeta/beta, and N-CAM | |
11271 JOURNAL J. Biol. Chem. 271 (26), 15716-15723 (1996) | |
11272 PUBMED 8663515 | |
11273 REFERENCE 3 (bases 1 to 6232) | |
11274 AUTHORS Colwell G, Li B, Forrest D and Brackenbury R. | |
11275 TITLE Conserved regulatory elements in the promoter region of the N-CAM | |
11276 gene | |
11277 JOURNAL Genomics 14 (4), 875-882 (1992) | |
11278 PUBMED 1478668 | |
11279 REFERENCE 4 (bases 1 to 6232) | |
11280 AUTHORS Rao Y, Wu XF, Gariepy J, Rutishauser U and Siu CH. | |
11281 TITLE Identification of a peptide sequence involved in homophilic binding | |
11282 in the neural cell adhesion molecule NCAM | |
11283 JOURNAL J. Cell Biol. 118 (4), 937-949 (1992) | |
11284 PUBMED 1380002 | |
11285 REFERENCE 5 (bases 1 to 6232) | |
11286 AUTHORS Cunningham,B.A., Hemperly,J.J., Murray,B.A., Prediger,E.A., | |
11287 Brackenbury,R. and Edelman,G.M. | |
11288 TITLE Neural cell adhesion molecule: structure, immunoglobulin-like | |
11289 domains, cell surface modulation, and alternative RNA splicing | |
11290 JOURNAL Science 236 (4803), 799-806 (1987) | |
11291 PUBMED 3576199 | |
11292 REFERENCE 6 (bases 1 to 6232) | |
11293 AUTHORS Hemperly,J.J., Edelman,G.M. and Cunningham,B.A. | |
11294 TITLE cDNA clones of the neural cell adhesion molecule (N-CAM) lacking a | |
11295 membrane-spanning region consistent with evidence for membrane | |
11296 attachment via a phosphatidylinositol intermediate | |
11297 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 83 (24), 9822-9826 (1986) | |
11298 PUBMED 3467341 | |
11299 REMARK Erratum:[Proc Natl Acad Sci U S A 1987 May;84(9):3069] | |
11300 REFERENCE 7 (bases 1 to 6232) | |
11301 AUTHORS Cole,G.J., Loewy,A., Cross,N.V., Akeson,R. and Glaser,L. | |
11302 TITLE Topographic localization of the heparin-binding domain of the | |
11303 neural cell adhesion molecule N-CAM | |
11304 JOURNAL J. Cell Biol. 103 (5), 1739-1744 (1986) | |
11305 PUBMED 2430978 | |
11306 REFERENCE 8 (bases 1 to 6232) | |
11307 AUTHORS Murray,B.A., Owens,G.C., Prediger,E.A., Crossin,K.L., | |
11308 Cunningham,B.A. and Edelman,G.M. | |
11309 TITLE Cell surface modulation of the neural cell adhesion molecule | |
11310 resulting from alternative mRNA splicing in a tissue-specific | |
11311 developmental sequence | |
11312 JOURNAL J. Cell Biol. 103 (4), 1431-1439 (1986) | |
11313 PUBMED 3771645 | |
11314 REFERENCE 9 (bases 1 to 6232) | |
11315 AUTHORS Hemperly,J.J., Murray,B.A., Edelman,G.M. and Cunningham,B.A. | |
11316 TITLE Sequence of a cDNA clone encoding the polysialic acid-rich and | |
11317 cytoplasmic domains of the neural cell adhesion molecule N-CAM | |
11318 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 83 (9), 3037-3041 (1986) | |
11319 PUBMED 3458261 | |
11320 REMARK Erratum:[Proc Natl Acad Sci U S A 1988 Mar;85(6):2008] | |
11321 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
11322 preliminary review. The reference sequence was derived from | |
11323 AADN04000117.1. | |
11324 On or before Feb 10, 2016 this sequence version replaced | |
11325 gi:971431482, gi:118102015. | |
11326 | |
11327 Transcript Variant: This variant (2) lacks several alternate | |
11328 in-frame exons compared to variant 1. The resulting protein | |
11329 (isoform 2) is shorter compared to isoform 1. | |
11330 | |
11331 Sequence Note: The RefSeq transcript and protein were derived from | |
11332 genomic sequence to make the sequence consistent with the reference | |
11333 genome assembly. The genomic coordinates used for the transcript | |
11334 record were based on alignments. | |
11335 | |
11336 ##Evidence-Data-START## | |
11337 RNAseq introns :: mixed/partial sample support SAMEA2201357, | |
11338 SAMEA2201358 [ECO:0000350] | |
11339 ##Evidence-Data-END## | |
11340 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
11341 1-242 AADN04000117.1 1215672-1215913 c | |
11342 243-317 AADN04000117.1 1179523-1179597 c | |
11343 318-536 AADN04000117.1 1177762-1177980 c | |
11344 537-680 AADN04000117.1 1177055-1177198 c | |
11345 681-818 AADN04000117.1 1176052-1176189 c | |
11346 819-936 AADN04000117.1 1175462-1175579 c | |
11347 937-1106 AADN04000117.1 1174938-1175107 c | |
11348 1107-1249 AADN04000117.1 1174679-1174821 c | |
11349 1250-1279 AADN04000117.1 1170826-1170855 c | |
11350 1280-1430 AADN04000117.1 1167323-1167473 c | |
11351 1431-1615 AADN04000117.1 1166565-1166749 c | |
11352 1616-1712 AADN04000117.1 1166116-1166212 c | |
11353 1713-1883 AADN04000117.1 1165618-1165788 c | |
11354 1884-2015 AADN04000117.1 1165055-1165186 c | |
11355 2016-2018 AADN04000117.1 1159682-1159684 c | |
11356 2019-2143 AADN04000117.1 1153742-1153866 c | |
11357 2144-2324 AADN04000117.1 1152847-1153027 c | |
11358 2325-2532 AADN04000117.1 1143238-1143445 c | |
11359 2533-2649 AADN04000117.1 1142932-1143048 c | |
11360 2650-6232 AADN04000117.1 1135018-1138600 c | |
11361 FEATURES Location/Qualifiers | |
11362 source 1..6232 | |
11363 /organism="Gallus gallus" | |
11364 /mol_type="mRNA" | |
11365 /db_xref="taxon:9031" | |
11366 /chromosome="24" | |
11367 /map="24" | |
11368 gene 1..6232 | |
11369 /gene="NCAM1" | |
11370 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1" | |
11371 /note="neural cell adhesion molecule 1" | |
11372 /db_xref="CGNC:5910" | |
11373 /db_xref="GeneID:428253" | |
11374 CDS 191..2770 | |
11375 /gene="NCAM1" | |
11376 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1" | |
11377 /EC_number="2.7.11.1" | |
11378 /note="isoform 2 precursor is encoded by transcript | |
11379 variant 2" | |
11380 /codon_start=1 | |
11381 /product="neural cell adhesion molecule 1 isoform 2 | |
11382 precursor" | |
11383 /protein_id="NP_001229533.1" | |
11384 /db_xref="CGNC:5910" | |
11385 /db_xref="GeneID:428253" | |
11386 /translation="MLPAAALPWTLFFLGAAASLQVDIVPSQGEISVGESKFFLCQVA | |
11387 GEAKYKDISWFSPNGEKLTPNQQRISVVRNDDFSSTLTIYNANIDDAGIYKCVVSSVE | |
11388 EGDSEATVNVKIFQKLMFKNAPTPQEFKEGDDAVIVCDVVSSLPPTIIWKHKGRDVIL | |
11389 KKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPSVRARQ | |
11390 STMNATANLSQSVTLACDADGFPEPTMTWTKDGEPIEQEDNEEKYSFNYDGSELIIKK | |
11391 VDKSDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENKTAMELEDQITLTCEASGD | |
11392 PIPSITWKTSTRNISNEEKASWTRPEKQETLDGRIVVRSHARVSSLTLKEIQYTDAGE | |
11393 YVCTASNTIGQDSQAMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSAVISWFR | |
11394 DGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESSEFILVQAD | |
11395 TPSSPSIDRVEPYSSTARVEFDEPEATGGVPILKYKAEWRALGEGEWHSRLYDAKEAN | |
11396 VEGTITISGLKPETTYSVRLSAVNGKGVGEISLPSDFKTQPVQGEPSAPKLEGQMGED | |
11397 GNSIKVNVIKQDDGGSPIRHYLIKYKAKHSSEWKPEIRLPSGSDHVMLKSLDWNAEYE | |
11398 VYVIAENQQGKSKPAHYAFRTSAQPTVIPASTSPTSGLGTAAIVGILIVIFVLLLVAV | |
11399 DVTCYFLNKCGLLMCIAVNLCGKSGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEER | |
11400 TPNHDGGKHTEPNETTPLTEPEKTPVEDKSEVQATETKTPPAEVKTVPNEATQTNENE | |
11401 SKA" | |
11402 sig_peptide 191..247 | |
11403 /gene="NCAM1" | |
11404 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1" | |
11405 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
11406 misc_feature 644..658 | |
11407 /gene="NCAM1" | |
11408 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1" | |
11409 /experiment="experimental evidence, no additional details | |
11410 recorded" | |
11411 /note="propagated from UniProtKB/Swiss-Prot (P13590.3); | |
11412 Region: Heparin-binding. {ECO:0000255}" | |
11413 misc_feature 671..685 | |
11414 /gene="NCAM1" | |
11415 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1" | |
11416 /experiment="experimental evidence, no additional details | |
11417 recorded" | |
11418 /note="propagated from UniProtKB/Swiss-Prot (P13590.3); | |
11419 Region: Heparin-binding. {ECO:0000255}" | |
11420 misc_feature 2357..2410 | |
11421 /gene="NCAM1" | |
11422 /gene_synonym="N-CAM; N-CAM-1; NACM; NCAM-1" | |
11423 /experiment="experimental evidence, no additional details | |
11424 recorded" | |
11425 /note="propagated from UniProtKB/Swiss-Prot (P13590.3); | |
11426 transmembrane region" | |
11427 ORIGIN | |
11428 1 gtcacggcgg cggcgccggg aggcggccgg ggcgcagcgg gcggagcggg gacacgcgcg | |
11429 61 gagcggagcg gagcggcgcg aaggggacgc ggggcaaaaa cgggaagatc catccggagg | |
11430 121 gccgcgtggt gctccgcccg cacggaacgg ctatttcgga gcggcccctc tcgccccccc | |
11431 181 gccggctgcg atgctgcccg ccgccgcgct gccctggacg ttgttttttc tcggagccgc | |
11432 241 agcctctcta caagtggata ttgttccaag tcagggagag atcagcgttg gagaatccaa | |
11433 301 gttcttctta tgtcaagtgg caggggaagc caaatacaaa gacatttcct ggttttcccc | |
11434 361 taacggtgag aagctgacgc ccaaccaaca gcgcatctca gtggtgcgaa atgatgactt | |
11435 421 ctcctccacc ctcaccatct acaacgccaa cattgatgat gctggcatct ataaatgtgt | |
11436 481 tgtcagcagc gtggaggagg gagactctga agccaccgtc aatgtgaaaa ttttccaaaa | |
11437 541 gctcatgttc aagaatgccc ccactcctca ggaattcaag gaaggggatg atgctgtgat | |
11438 601 tgtgtgtgat gtggtcagct cgctgcctcc taccatcatc tggaaacaca aaggcaggga | |
11439 661 tgtcatccta aaaaaagatg ttcggtttat agtgctgtcc aacaactacc tgcagatccg | |
11440 721 gggaatcaag aaaacagatg aagggacgta ccgctgtgag ggccgcatcc tggctcgtgg | |
11441 781 ggagatcaac ttcaaagata ttcaggtcat tgtaaatgta cctccttctg tgcgtgccag | |
11442 841 gcagagcact atgaacgcca ctgccaacct cagccagtct gtcaccttag catgtgatgc | |
11443 901 tgatggcttt cctgagccaa ccatgacgtg gacaaaggat ggagagccaa tagagcagga | |
11444 961 ggataacgaa gagaaataca gttttaacta tgatgggtcc gagctgatca tcaagaaggt | |
11445 1021 ggataagagt gacgaagcag agtacatctg catcgctgag aacaaggctg gcgagcagga | |
11446 1081 tgccaccatt catctcaaag tctttgcaaa acccaaaatc acatatgtgg agaataaaac | |
11447 1141 agctatggag ctggaggatc agatcacact gacctgtgag gcctctgggg acccaatccc | |
11448 1201 ttccatcacg tggaaaactt ccacccggaa catcagcaat gaagagaagg cttcgtggac | |
11449 1261 ccggcccgag aaacaagaga ccctggatgg gcgcatcgtg gtgcgcagcc acgcgcgggt | |
11450 1321 atcgtccctg actctcaaag aaatccagta cacagacgcc ggagagtacg tgtgcacggc | |
11451 1381 cagcaacacc atcgggcagg actcacaggc catgtacctc gaagtgcagt atgctcccaa | |
11452 1441 gcttcagggc cctgtggctg tctatacctg ggaagggaat caagtgaaca tcacctgtga | |
11453 1501 ggtatttgct tatcccagtg ctgtcatctc ctggttccga gatggacagc tgcttcccag | |
11454 1561 ctcaaactac agcaacatca agatctacaa cactccatca gcaagctacc tggaggtgac | |
11455 1621 accagactct gaaaatgact ttggcaacta caactgcact gctgtgaacc gcattggcca | |
11456 1681 ggaatcctca gagttcattc ttgtgcaggc ggatactccg tcctctcctt ctattgacag | |
11457 1741 agtggagccc tactctagta ctgcccgtgt ggagttcgat gagcctgaag ctactggtgg | |
11458 1801 ggtgcccatc ctcaaataca aagcagagtg gagagcactg ggtgaaggag aatggcactc | |
11459 1861 aagattgtat gatgcaaaag aggcaaatgt ggagggcacg atcactatca gtggcctgaa | |
11460 1921 acctgagaca acctactcag tgagactgtc tgcagtcaat ggcaagggtg tgggtgagat | |
11461 1981 tagcctgcca tccgacttca agacacagcc agttcaaggg gaacccagtg cacccaaact | |
11462 2041 ggaagggcag atgggagaag acggaaactc catcaaagtg aacgttatca agcaggatga | |
11463 2101 tggtggctcc ccaatcaggc attacctgat caaatacaaa gctaaacatt cctcagaatg | |
11464 2161 gaaaccagag atcagactgc cttctggcag tgaccacgtc atgctcaagt ctctggactg | |
11465 2221 gaatgcagag tatgaggttt atgtgatagc tgaaaaccag caggggaagt ccaaacccgc | |
11466 2281 tcactacgct ttccggacat ctgctcagcc tactgtcatc ccagccagca ctagccctac | |
11467 2341 gtcaggcctg gggactgctg ccatcgtagg cattctcatt gttatctttg tgctgctcct | |
11468 2401 ggtggctgtg gacgtcacct gctacttcct gaacaaatgt ggcctgctca tgtgcattgc | |
11469 2461 tgtcaactta tgtggcaagt ctggaccagg agccaagggc aaagacatgg aggagggcaa | |
11470 2521 agctgccttc tcgaaagatg agtccaagga gcctattgtg gaagtgcgga ctgaagagga | |
11471 2581 gcggaccccc aaccatgatg ggggaaaaca cacagagccc aacgagacca ccccactaac | |
11472 2641 agaaccagag aaaaccccag tagaagacaa atctgaagtg caagcaacgg aaactaagac | |
11473 2701 acctccagca gaagtgaaga cggtccccaa cgaagccaca caaacaaatg agaatgagag | |
11474 2761 caaagcatga tcagcgacag atgaaaaacc atggcagaac gacttcaccc aagcatttac | |
11475 2821 aacacgaaac acaacacaca tctcattcct ctagtgtctg ttgccttttt tttaaaaaac | |
11476 2881 aaacaaacaa acaaaacaga aaatgcataa atggggaggg gggggttctc tctttttttc | |
11477 2941 tttttctttt tcttaagatt tttaggaagg ttctatttgt tgtgtacttg cttttaaaaa | |
11478 3001 gtaacacgtt ttaaaaacag ggttaaaccc atcaccagat cgggggctca gctgtcccct | |
11479 3061 ggtatgttca aacaagcaga attgcagaat accacttaga gcatcgctga ggagctcaga | |
11480 3121 gtcacccagt cgtagacgaa aggaaaaaaa gagaaaagaa aaaagaagac cctgttcttt | |
11481 3181 ccttggttag aatagtagat ttaaccactg tactgcttgc ctgcttggta caggcggtac | |
11482 3241 ttagtgaaca aagtccacaa tttattttta tacttttcag tcgagtttga aatatgtaaa | |
11483 3301 gcctcataaa taagttataa tttctgttca ccttgtgttc agtatgcaaa gtgtcgtgag | |
11484 3361 cattttgtgg ctgaattctg ttctcctcgt tagacattga ttttggggtt tattattttt | |
11485 3421 gttaggaaga atgccaaaat tgcagcttcg ggggatgtat ttcaatttgc agtattcaga | |
11486 3481 ctctacattt ctttaaattt tatgttaatt tttgccaact tttgttctct ccagtgttta | |
11487 3541 caattgacat ttttttaact tttgttgtgt ttaaatgtat ttgtaaaata gctgcctttt | |
11488 3601 ttttaaagta aatccagact ctagctacta ggttagcagc atgcttgctt tgcaaaggga | |
11489 3661 gacattttga aatatcgatg tttacagtag tttccccctt tatctttttt aattattatt | |
11490 3721 attattataa ttattattat tatttcttac tggagtaaga aaaaagagta atgctggtct | |
11491 3781 ttggtttgtt ttaggggggt ggggcgtggg gaatattcca accacttgtc accaatcgag | |
11492 3841 gtctgtatcc agcaatccac ataaacacac ttcactttga acgagagagt tgctggagag | |
11493 3901 agtttcctta tatacttaaa tttattaaga gtgtaagtcc cttgctggac ctgggcctga | |
11494 3961 atgcataaga aaaatatcat ctctgctttt ttaggacatt cttctctttc cttcatggaa | |
11495 4021 ccctcccaga gctttgagaa gcagaagagg gattgtacag ttagggctgg gctggtcttg | |
11496 4081 tctccactgt ttgactacat ccatttctct gtagaatgtt gataactgcc atttcctttg | |
11497 4141 accccagaaa ctgatttaaa agcaatgcct ttccgcactt aaataaagtt tccttttgag | |
11498 4201 gagtggtaac actaaaaaca gaacatcctg ctctcatgtg ggtgatgttc atgagcagag | |
11499 4261 ggtgcttggc agcatgcagg tgtccttact cattgcaggg aagttggact agatgaccct | |
11500 4321 taagggtccc ttccaaccca aacgattcta tgactctcca taagacccct tctgcaaagt | |
11501 4381 cagctccagc acattgtgtc tgataagtca tccgtgtatg ctttgcatca tccaggccat | |
11502 4441 gtatccatgg ctgagtgctt gggcatcagt gccaacgctc ccattgatgt ccctgctctt | |
11503 4501 ctcatcatgc ttttagcagt cagagaaagg ggctgatgtc acacatgcgt tgttgtggtc | |
11504 4561 gtcactggga gtcatggagt aacactgaga cttcagggtg ggaagaagag aaggttgagc | |
11505 4621 agcaggaagg cagaggaaga ccagcccatt gtatagaggt gctccttctc tgggggtttt | |
11506 4681 gctttgtttg tttttctttt attttccatt cttttttttt ttttttttct actttagatc | |
11507 4741 tgcaagcttg tgcactgtgg gtgcgtgact tttagtgtga aacgtgtttt ttgtcatagt | |
11508 4801 attgaaataa ttgaaaaaaa aaaaaagctt caacatagtt tggatgtgga aggtgtagcg | |
11509 4861 gataggtcag atttaaaata tatatattca ggaaaaaaaa aaagagaaca acttctagga | |
11510 4921 ggaacacaag cctttaaatg acaaacccga gctgatgatg gcatcattgc atcgcgccat | |
11511 4981 ggggacgagc agaagggtga tggggttggg gagatcatgc ttggctcggg tgaactgagc | |
11512 5041 cactatcgtt ggtgtgtcct tctgagtatg cagtctttta cagtggcatc acatgatttc | |
11513 5101 aaacagtgta aaacagtggt tttgtcattt gctaagtgtg gggtttttgc attttttcct | |
11514 5161 cagctcctgg ggatggaagt ggaggatggc tggctatgca ggcacagaca ctcaggcaat | |
11515 5221 accatcccag gcagaacagc agggcaggac aggttcccac ttgagagcct tgtgtcagat | |
11516 5281 tcagcccatg cttgacccat gacagcagcg ttgatgtaag taaggcgaaa tttggtccgt | |
11517 5341 ggtccctagg accttatata tcatgcctcc ccgagcagca acaggagcaa acgctgctca | |
11518 5401 gcgcagtgac ccggagtatg tccagtgcca ctgatcagca cccattgggt ggcactgtgg | |
11519 5461 tggctgtcac ccagactggt gtttctgcca tgtaaggcca ccagcccagg gccccatcca | |
11520 5521 gcacccggcc gtgtcacagt gcccggtacc tgctgggttg tgtcctgtgg atggagcctc | |
11521 5581 tgtgctgctc ccttagtgcc cctgtgacct ccccatcccc agaaccctta gattaatttt | |
11522 5641 ggagagtgtt tttatacttg cccttaatgg agaataattt gttttaactt ataaatatcc | |
11523 5701 cattcccaag gtagcttagg cttcattgct tttatttaaa cctttgaaga gggaccaacc | |
11524 5761 tgatgccgtt tgcgctgtat atgtttatat atgtatccat gccatacata tatatatcta | |
11525 5821 tatggcaact cagactgatc agcttctagt tgtggagtga catttcatgc tgcaccatac | |
11526 5881 gtaacgatga tgaggtaata gtgcatccag ttgttcagct tttagagtgg aattttattt | |
11527 5941 tcacactttt ctatggagcc ttcaaacccc aggttttcac actaggctgt tttgatagtt | |
11528 6001 gttctcagac ctccactgac atccttaccc agcattccct acttttgggg gccttctatc | |
11529 6061 ttgttaaaaa aacaaaaaaa caaaaaatct ttttaccgag tgaaacatca gttccacctt | |
11530 6121 tattcccatt ctcactggtg taaatactga tactaactga ggattttgac tttgcattct | |
11531 6181 gtcagaatac tgtgttcaaa taaaaattac aaaaaaaaaa taccaacaaa aa | |
11532 // | |
11533 | |
11534 LOCUS NM_001004378 1139 bp mRNA linear VRT 04-JAN-2017 | |
11535 DEFINITION Gallus gallus receptor for activated C kinase 1 (RACK1), mRNA. | |
11536 ACCESSION NM_001004378 XM_415332 | |
11537 VERSION NM_001004378.2 | |
11538 KEYWORDS RefSeq. | |
11539 SOURCE Gallus gallus (chicken) | |
11540 ORGANISM Gallus gallus | |
11541 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
11542 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
11543 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
11544 Phasianidae; Phasianinae; Gallus. | |
11545 REFERENCE 1 (bases 1 to 1139) | |
11546 AUTHORS Shiina T, Briles WE, Goto RM, Hosomichi K, Yanagiya K, Shimizu S, | |
11547 Inoko H and Miller MM. | |
11548 TITLE Extended gene map reveals tripartite motif, C-type lectin, and Ig | |
11549 superfamily type genes within a subregion of the chicken MHC-B | |
11550 affecting infectious disease | |
11551 JOURNAL J. Immunol. 178 (11), 7162-7172 (2007) | |
11552 PUBMED 17513765 | |
11553 REFERENCE 2 (bases 1 to 1139) | |
11554 AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R, | |
11555 Burnside J, Aggrey SE, Simon J and Cogburn LA. | |
11556 TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs | |
11557 from single and multiple tissue cDNA libraries and CAP3 assembly of | |
11558 a chicken gene index | |
11559 JOURNAL Physiol. Genomics 25 (3), 514-524 (2006) | |
11560 PUBMED 16554550 | |
11561 REFERENCE 3 (bases 1 to 1139) | |
11562 AUTHORS Ruby T, Bed'Hom B, Wittzell H, Morin V, Oudin A and Zoorob R. | |
11563 TITLE Characterisation of a cluster of TRIM-B30.2 genes in the chicken | |
11564 MHC B locus | |
11565 JOURNAL Immunogenetics 57 (1-2), 116-128 (2005) | |
11566 PUBMED 15744538 | |
11567 REFERENCE 4 (bases 1 to 1139) | |
11568 AUTHORS Takezaki N, Figueroa F, Zaleska-Rutczynska Z, Takahata N and Klein | |
11569 J. | |
11570 TITLE The phylogenetic relationship of tetrapod, coelacanth, and lungfish | |
11571 revealed by the sequences of forty-four nuclear genes | |
11572 JOURNAL Mol. Biol. Evol. 21 (8), 1512-1524 (2004) | |
11573 PUBMED 15128875 | |
11574 REFERENCE 5 (bases 1 to 1139) | |
11575 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
11576 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
11577 TITLE A comprehensive collection of chicken cDNAs | |
11578 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
11579 PUBMED 12445392 | |
11580 REFERENCE 6 (bases 1 to 1139) | |
11581 AUTHORS Abdrakhmanov I, Lodygin D, Geroth P, Arakawa H, Law A, Plachy J, | |
11582 Korn B and Buerstedde JM. | |
11583 TITLE A large database of chicken bursal ESTs as a resource for the | |
11584 analysis of vertebrate gene function | |
11585 JOURNAL Genome Res. 10 (12), 2062-2069 (2000) | |
11586 PUBMED 11116100 | |
11587 REFERENCE 7 (bases 1 to 1139) | |
11588 AUTHORS Guillemot F, Billault A and Auffray C. | |
11589 TITLE Physical linkage of a guanine nucleotide-binding protein-related | |
11590 gene to the chicken major histocompatibility complex | |
11591 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 86 (12), 4594-4598 (1989) | |
11592 PUBMED 2499885 | |
11593 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
11594 preliminary review. The reference sequence was derived from | |
11595 AJ392770.1, CB017418.1, BU137661.1, M24193.1, CK608329.1 and | |
11596 AADN04000554.1. | |
11597 On Apr 29, 2011 this sequence version replaced gi:52138658. | |
11598 | |
11599 Sequence Note: This RefSeq record was created from transcripts of | |
11600 different strains and genomic sequence data because no single | |
11601 transcript from the same strain was available for the full length | |
11602 of the gene. The extent of this transcript is supported by | |
11603 transcript alignments and orthologous data. | |
11604 | |
11605 ##Evidence-Data-START## | |
11606 Transcript exon combination :: CN210840.1, CN210893.1 [ECO:0000332] | |
11607 RNAseq introns :: single sample supports all introns | |
11608 SAMEA2201357, SAMEA2201358 | |
11609 [ECO:0000348] | |
11610 ##Evidence-Data-END## | |
11611 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
11612 1-360 AJ392770.1 1-360 | |
11613 361-635 CB017418.1 2-276 | |
11614 636-863 BU137661.1 379-606 | |
11615 864-959 M24193.1 844-939 | |
11616 960-1128 CK608329.1 15-183 c | |
11617 1129-1139 AADN04000554.1 50867-50877 c | |
11618 FEATURES Location/Qualifiers | |
11619 source 1..1139 | |
11620 /organism="Gallus gallus" | |
11621 /mol_type="mRNA" | |
11622 /db_xref="taxon:9031" | |
11623 /chromosome="16" | |
11624 /map="16" | |
11625 /breed="Leghorn" | |
11626 gene 1..1139 | |
11627 /gene="RACK1" | |
11628 /gene_synonym="C12-3; c12.3; GNB2L1" | |
11629 /note="receptor for activated C kinase 1" | |
11630 /db_xref="CGNC:61" | |
11631 /db_xref="GeneID:417044" | |
11632 misc_feature 40..42 | |
11633 /gene="RACK1" | |
11634 /gene_synonym="C12-3; c12.3; GNB2L1" | |
11635 /note="upstream in-frame stop codon" | |
11636 CDS 103..1056 | |
11637 /gene="RACK1" | |
11638 /gene_synonym="C12-3; c12.3; GNB2L1" | |
11639 /note="guanine nucleotide-binding protein subunit | |
11640 beta-2-like 1; guanine nucleotide-binding protein beta | |
11641 subunit 2-like 1; guanine nucleotide binding 12.3; Guanine | |
11642 nucleotide-binding protein beta subunit2-like 1; guanine | |
11643 nucleotide binding protein (G protein), beta polypeptide | |
11644 2-like 1; receptor of activated protein kinase C 1; | |
11645 guanine nucleotide-binding protein subunit beta-like | |
11646 protein 12.3; MHC B complex protein 12.3" | |
11647 /codon_start=1 | |
11648 /product="receptor of activated protein C kinase 1" | |
11649 /protein_id="NP_001004378.1" | |
11650 /db_xref="CGNC:61" | |
11651 /db_xref="GeneID:417044" | |
11652 /translation="MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWK | |
11653 LTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFV | |
11654 GHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSPNS | |
11655 SNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAML | |
11656 WDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVIS | |
11657 TSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTIGTR" | |
11658 misc_feature 106..108 | |
11659 /gene="RACK1" | |
11660 /gene_synonym="C12-3; c12.3; GNB2L1" | |
11661 /experiment="experimental evidence, no additional details | |
11662 recorded" | |
11663 /note="N-acetylthreonine. {ECO:0000250}; propagated from | |
11664 UniProtKB/Swiss-Prot (P63247.1); acetylation site" | |
11665 misc_feature 139..234 | |
11666 /gene="RACK1" | |
11667 /gene_synonym="C12-3; c12.3; GNB2L1" | |
11668 /experiment="experimental evidence, no additional details | |
11669 recorded" | |
11670 /note="propagated from UniProtKB/Swiss-Prot (P63247.1); | |
11671 Region: WD 1" | |
11672 misc_feature 283..375 | |
11673 /gene="RACK1" | |
11674 /gene_synonym="C12-3; c12.3; GNB2L1" | |
11675 /experiment="experimental evidence, no additional details | |
11676 recorded" | |
11677 /note="propagated from UniProtKB/Swiss-Prot (P63247.1); | |
11678 Region: WD 2" | |
11679 misc_feature 409..501 | |
11680 /gene="RACK1" | |
11681 /gene_synonym="C12-3; c12.3; GNB2L1" | |
11682 /experiment="experimental evidence, no additional details | |
11683 recorded" | |
11684 /note="propagated from UniProtKB/Swiss-Prot (P63247.1); | |
11685 Region: WD 3" | |
11686 misc_feature 538..636 | |
11687 /gene="RACK1" | |
11688 /gene_synonym="C12-3; c12.3; GNB2L1" | |
11689 /experiment="experimental evidence, no additional details | |
11690 recorded" | |
11691 /note="propagated from UniProtKB/Swiss-Prot (P63247.1); | |
11692 Region: WD 4" | |
11693 misc_feature 670..762 | |
11694 /gene="RACK1" | |
11695 /gene_synonym="C12-3; c12.3; GNB2L1" | |
11696 /experiment="experimental evidence, no additional details | |
11697 recorded" | |
11698 /note="propagated from UniProtKB/Swiss-Prot (P63247.1); | |
11699 Region: WD 5" | |
11700 misc_feature 784..786 | |
11701 /gene="RACK1" | |
11702 /gene_synonym="C12-3; c12.3; GNB2L1" | |
11703 /experiment="experimental evidence, no additional details | |
11704 recorded" | |
11705 /note="Phosphotyrosine. {ECO:0000250}; propagated from | |
11706 UniProtKB/Swiss-Prot (P63247.1); phosphorylation site" | |
11707 misc_feature 793..882 | |
11708 /gene="RACK1" | |
11709 /gene_synonym="C12-3; c12.3; GNB2L1" | |
11710 /experiment="experimental evidence, no additional details | |
11711 recorded" | |
11712 /note="propagated from UniProtKB/Swiss-Prot (P63247.1); | |
11713 Region: WD 6" | |
11714 misc_feature 943..1035 | |
11715 /gene="RACK1" | |
11716 /gene_synonym="C12-3; c12.3; GNB2L1" | |
11717 /experiment="experimental evidence, no additional details | |
11718 recorded" | |
11719 /note="propagated from UniProtKB/Swiss-Prot (P63247.1); | |
11720 Region: WD 7" | |
11721 ORIGIN | |
11722 1 ccctctttct ctttccgcgc tggcggccat cgcgggcggt aggaccggac cgggccgggc | |
11723 61 cctttattga atccgccgcc atccctccgc cccgccgccg ccatgacgga gcagatgacc | |
11724 121 ctccgcggta ccctgaaggg ccacaatggg tgggtgacgc agatcgccac caccccgcag | |
11725 181 ttcccggaca tgattctctc cgcgtcgcgg gacaaaacca tcatcatgtg gaagctgacc | |
11726 241 cgagatgaga ccaactacgg gatcccgcag cgcgccctgc gcggccactc gcactttgtc | |
11727 301 agcgatgtgg tcatctcctc cgatgggcag tttgcgctgt cgggctcctg ggatggcacc | |
11728 361 ctgaggctgt gggacctcac cacaggaacc accacccgcc gctttgttgg ccacaccaag | |
11729 421 gatgtgctga gcgtcgcctt ctcctccgac aaccgccaga tcgtttcggg ctccagggac | |
11730 481 aaaaccatca aactctggaa cactttgggt gtctgcaaat acacggtgca ggacgagagc | |
11731 541 cactctgagt gggtttcctg tgtgcgcttc tcccccaaca gcagcaaccc catcattgtc | |
11732 601 tcctgtggct gggacaagct ggtgaaggtt tggaacttgg ctaactgcaa actgaagaca | |
11733 661 aaccacatcg gccacacggg atatctgaac acagtgactg tctcccctga tggctccctc | |
11734 721 tgtgcttctg gaggcaagga cggccaggcc atgctgtggg acctgaatga aggcaagcac | |
11735 781 ctgtacacgc tggatggagg ggacatcatc aatgcgctgt gcttcagccc caaccgctac | |
11736 841 tggctctgcg ctgccaccgg ccccagcatc aagatctggg acctggaagg caaaatcatt | |
11737 901 gtggatgagc tgaagcagga ggtgatcagc accagcagca aagctgagcc tccccagtgc | |
11738 961 acctctctgg cgtggtctgc agatgggcag acgctgtttg ctggctacac agataacctc | |
11739 1021 gtccgggtgt ggcaagtcac cattggaacc agatgaggat gtggtaaaaa cacacagatt | |
11740 1081 ttatgcacaa aactcaataa aagagcgctc tgttgagctc atggctgcat tatatccca | |
11741 // | |
11742 | |
11743 LOCUS NM_001201399 548 bp mRNA linear VRT 04-JAN-2017 | |
11744 DEFINITION Gallus gallus defensin beta 4A (DEFB4A), transcript variant 2, | |
11745 mRNA. | |
11746 ACCESSION NM_001201399 | |
11747 VERSION NM_001201399.1 | |
11748 KEYWORDS RefSeq. | |
11749 SOURCE Gallus gallus (chicken) | |
11750 ORGANISM Gallus gallus | |
11751 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
11752 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
11753 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
11754 Phasianidae; Phasianinae; Gallus. | |
11755 REFERENCE 1 (bases 1 to 548) | |
11756 AUTHORS Cuperus T, Coorens M, van Dijk A and Haagsman HP. | |
11757 TITLE Avian host defense peptides | |
11758 JOURNAL Dev. Comp. Immunol. 41 (3), 352-369 (2013) | |
11759 PUBMED 23644014 | |
11760 REMARK Review article | |
11761 REFERENCE 2 (bases 1 to 548) | |
11762 AUTHORS Derache C, Esnault E, Bonsergent C, Le Vern Y, Quere P and | |
11763 Lalmanach AC. | |
11764 TITLE Differential modulation of beta-defensin gene expression by | |
11765 Salmonella Enteritidis in intestinal epithelial cells from | |
11766 resistant and susceptible chicken inbred lines | |
11767 JOURNAL Dev. Comp. Immunol. 33 (9), 959-966 (2009) | |
11768 PUBMED 19539093 | |
11769 REMARK GeneRIF: intestinal epithelium express beta-defensin antimicrobial | |
11770 peptides that may play a role in immunoprotection against | |
11771 Salmonella Enteritidis. | |
11772 REFERENCE 3 (bases 1 to 548) | |
11773 AUTHORS Kannan L, Rath NC, Liyanage R and Lay JO Jr. | |
11774 TITLE Direct screening identifies mature beta-defensin 2 in avian | |
11775 heterophils | |
11776 JOURNAL Poult. Sci. 88 (2), 372-379 (2009) | |
11777 PUBMED 19151352 | |
11778 REMARK GeneRIF: peptides are 36 amino acids long including a highly | |
11779 conserved region with 6 invariant cysteines forming the 3 disulfide | |
11780 bonds characteristic of defensins | |
11781 REFERENCE 4 (bases 1 to 548) | |
11782 AUTHORS Ahanda ML, Ruby T, Wittzell H, Bed'Hom B, Chausse AM, Morin V, | |
11783 Oudin A, Chevalier C, Young JR and Zoorob R. | |
11784 TITLE Non-coding RNAs revealed during identification of genes involved in | |
11785 chicken immune responses | |
11786 JOURNAL Immunogenetics 61 (1), 55-70 (2009) | |
11787 PUBMED 19009289 | |
11788 REFERENCE 5 (bases 1 to 548) | |
11789 AUTHORS Lynn,D.J., Higgs,R., Lloyd,A.T., O'Farrelly,C., Herve-Grepinet,V., | |
11790 Nys,Y., Brinkman,F.S., Yu,P.L., Soulier,A., Kaiser,P., Zhang,G. and | |
11791 Lehrer,R.I. | |
11792 TITLE Avian beta-defensin nomenclature: a community proposed update | |
11793 JOURNAL Immunol. Lett. 110 (1), 86-89 (2007) | |
11794 PUBMED 17467809 | |
11795 REFERENCE 6 (bases 1 to 548) | |
11796 AUTHORS Yoshimura Y, Ohashi H, Subedi K, Nishibori M and Isobe N. | |
11797 TITLE Effects of age, egg-laying activity, and Salmonella-inoculation on | |
11798 the expressions of gallinacin mRNA in the vagina of the hen oviduct | |
11799 JOURNAL J. Reprod. Dev. 52 (2), 211-218 (2006) | |
11800 PUBMED 16394622 | |
11801 REMARK GeneRIF: mRNA expression of Gal-1, -2 and -3 in the vagina of | |
11802 laying hens increases with age but decreases in the regressed | |
11803 oviduct during the non-laying phase, and may increase in response | |
11804 to Salmonella enteritidis (SE) and lipopolysaccharide | |
11805 REFERENCE 7 (bases 1 to 548) | |
11806 AUTHORS Bar-Shira E and Friedman A. | |
11807 TITLE Development and adaptations of innate immunity in the | |
11808 gastrointestinal tract of the newly hatched chick | |
11809 JOURNAL Dev. Comp. Immunol. 30 (10), 930-941 (2006) | |
11810 PUBMED 16430960 | |
11811 REMARK GeneRIF: Authors use expression of beta-defensins GAL1 and GLA2 to | |
11812 postulate in situ maturation of heterophils in hatchling gut | |
11813 tissue. | |
11814 REFERENCE 8 (bases 1 to 548) | |
11815 AUTHORS Xiao Y, Hughes AL, Ando J, Matsuda Y, Cheng JF, Skinner-Noble D and | |
11816 Zhang G. | |
11817 TITLE A genome-wide screen identifies a single beta-defensin gene cluster | |
11818 in the chicken: implications for the origin and evolution of | |
11819 mammalian defensins | |
11820 JOURNAL BMC Genomics 5 (1), 56 (2004) | |
11821 PUBMED 15310403 | |
11822 REMARK GeneRIF: The chicken genome encodes only beta-defensins. The 13 | |
11823 chicken beta-defensin genes are clustered densely within a 86-Kb | |
11824 distance on the chromosome 3q3.5-q3.7. The deduced peptides share | |
11825 the characteristic defensin motif. | |
11826 Publication Status: Online-Only | |
11827 REFERENCE 9 (bases 1 to 548) | |
11828 AUTHORS Brockus CW, Jackwood MW and Harmon BG. | |
11829 TITLE Characterization of beta-defensin prepropeptide mRNA from chicken | |
11830 and turkey bone marrow | |
11831 JOURNAL Anim. Genet. 29 (4), 283-289 (1998) | |
11832 PUBMED 9745666 | |
11833 REFERENCE 10 (bases 1 to 548) | |
11834 AUTHORS Harwig SS, Swiderek KM, Kokryakov VN, Tan L, Lee TD, Panyutich EA, | |
11835 Aleshina GM, Shamova OV and Lehrer RI. | |
11836 TITLE Gallinacins: cysteine-rich antimicrobial peptides of chicken | |
11837 leukocytes | |
11838 JOURNAL FEBS Lett. 342 (3), 281-285 (1994) | |
11839 PUBMED 8150085 | |
11840 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
11841 preliminary review. The reference sequence was derived from | |
11842 CF250963.1, AADN04000288.1, DQ858325.1 and AF033336.1. | |
11843 | |
11844 Transcript Variant: This variant (2) differs in the 5' UTR compared | |
11845 to variant 1. Both variants 1 and 2 encode the same protein. | |
11846 | |
11847 Sequence Note: This RefSeq record was created from transcripts of | |
11848 different strains and genomic sequence data because no single | |
11849 transcript from the same strain was available for the full length | |
11850 of the gene. The extent of this transcript is supported by | |
11851 transcript alignments and orthologous data. | |
11852 | |
11853 ##Evidence-Data-START## | |
11854 Transcript exon combination :: CF250963.1 [ECO:0000332] | |
11855 RNAseq introns :: single sample supports all introns | |
11856 SAMEA2201383, SAMEA2812691 | |
11857 [ECO:0000348] | |
11858 ##Evidence-Data-END## | |
11859 COMPLETENESS: complete on the 3' end. | |
11860 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
11861 1-157 CF250963.1 3-159 | |
11862 158-158 AADN04000288.1 322558-322558 c | |
11863 159-200 CF250963.1 161-202 | |
11864 201-201 DQ858325.1 50-50 | |
11865 202-411 CF250963.1 204-413 | |
11866 412-548 AF033336.1 287-423 | |
11867 FEATURES Location/Qualifiers | |
11868 source 1..548 | |
11869 /organism="Gallus gallus" | |
11870 /mol_type="mRNA" | |
11871 /db_xref="taxon:9031" | |
11872 /chromosome="3" | |
11873 /map="3" | |
11874 /breed="xinghua" | |
11875 gene 1..548 | |
11876 /gene="DEFB4A" | |
11877 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2" | |
11878 /note="defensin beta 4A" | |
11879 /db_xref="CGNC:49507" | |
11880 /db_xref="GeneID:395840" | |
11881 misc_feature 128..130 | |
11882 /gene="DEFB4A" | |
11883 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2" | |
11884 /note="upstream in-frame stop codon" | |
11885 CDS 152..346 | |
11886 /gene="DEFB4A" | |
11887 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2" | |
11888 /note="gallinacin-2; antimicrobial peptide 2; | |
11889 beta-defensin 2 antimicrobial peptide; avian beta-defensin | |
11890 2" | |
11891 /codon_start=1 | |
11892 /product="gallinacin-2 precursor" | |
11893 /protein_id="NP_001188328.1" | |
11894 /db_xref="CGNC:49507" | |
11895 /db_xref="GeneID:395840" | |
11896 /translation="MRILYLLFSLLFLALQASPGLSSPRRDMLFCKGGSCHFGGCPSH | |
11897 LIKVGSCFGFRSCCKWPWNA" | |
11898 sig_peptide 152..217 | |
11899 /gene="DEFB4A" | |
11900 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2" | |
11901 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
11902 mat_peptide 236..343 | |
11903 /gene="DEFB4A" | |
11904 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2" | |
11905 /product="Gallinacin-2" | |
11906 /experiment="experimental evidence, no additional details | |
11907 recorded" | |
11908 /note="propagated from UniProtKB/Swiss-Prot (P46158.2)" | |
11909 ORIGIN | |
11910 1 aaagccctct ggagggaaga gaccaagagg tgttctggtt tggcttttgg gctcatctaa | |
11911 61 tatccgctca gaagactgta gattccaggg actgcctgcc acatacattt cttcttcctt | |
11912 121 ttccctgtag cagctcagca gatctgcagc catgaggatt ctttacctgc ttttctctct | |
11913 181 cctcttcctg gcactccagg cttctccagg gttgtcttcg ccccggcggg acatgctgtt | |
11914 241 ctgtaaagga gggtcctgcc actttggagg gtgtcccagc catctaatca aagtcggaag | |
11915 301 ctgcttcggg ttccgttcct gctgcaaatg gccttggaat gcataaacac ttcatgagtc | |
11916 361 cattcaagag ctttgaaaat ttcttccagg catgtgcttt aaatgctaca gcaaagcctc | |
11917 421 agcagcaaga agacccctct catgtgttaa tgcaatatgt tttgtgttgt agagtaaata | |
11918 481 caaatatctt ctgcactgcc tttcttcctc ttgaataaat tgtcattgca tagcaaaaaa | |
11919 541 aaaaaaaa | |
11920 // | |
11921 | |
11922 LOCUS NM_204992 484 bp mRNA linear VRT 04-JAN-2017 | |
11923 DEFINITION Gallus gallus defensin beta 4A (DEFB4A), transcript variant 1, | |
11924 mRNA. | |
11925 ACCESSION NM_204992 | |
11926 VERSION NM_204992.2 | |
11927 KEYWORDS RefSeq. | |
11928 SOURCE Gallus gallus (chicken) | |
11929 ORGANISM Gallus gallus | |
11930 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
11931 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
11932 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
11933 Phasianidae; Phasianinae; Gallus. | |
11934 REFERENCE 1 (bases 1 to 484) | |
11935 AUTHORS Cuperus T, Coorens M, van Dijk A and Haagsman HP. | |
11936 TITLE Avian host defense peptides | |
11937 JOURNAL Dev. Comp. Immunol. 41 (3), 352-369 (2013) | |
11938 PUBMED 23644014 | |
11939 REMARK Review article | |
11940 REFERENCE 2 (bases 1 to 484) | |
11941 AUTHORS Derache C, Esnault E, Bonsergent C, Le Vern Y, Quere P and | |
11942 Lalmanach AC. | |
11943 TITLE Differential modulation of beta-defensin gene expression by | |
11944 Salmonella Enteritidis in intestinal epithelial cells from | |
11945 resistant and susceptible chicken inbred lines | |
11946 JOURNAL Dev. Comp. Immunol. 33 (9), 959-966 (2009) | |
11947 PUBMED 19539093 | |
11948 REMARK GeneRIF: intestinal epithelium express beta-defensin antimicrobial | |
11949 peptides that may play a role in immunoprotection against | |
11950 Salmonella Enteritidis. | |
11951 REFERENCE 3 (bases 1 to 484) | |
11952 AUTHORS Kannan L, Rath NC, Liyanage R and Lay JO Jr. | |
11953 TITLE Direct screening identifies mature beta-defensin 2 in avian | |
11954 heterophils | |
11955 JOURNAL Poult. Sci. 88 (2), 372-379 (2009) | |
11956 PUBMED 19151352 | |
11957 REMARK GeneRIF: peptides are 36 amino acids long including a highly | |
11958 conserved region with 6 invariant cysteines forming the 3 disulfide | |
11959 bonds characteristic of defensins | |
11960 REFERENCE 4 (bases 1 to 484) | |
11961 AUTHORS Ahanda ML, Ruby T, Wittzell H, Bed'Hom B, Chausse AM, Morin V, | |
11962 Oudin A, Chevalier C, Young JR and Zoorob R. | |
11963 TITLE Non-coding RNAs revealed during identification of genes involved in | |
11964 chicken immune responses | |
11965 JOURNAL Immunogenetics 61 (1), 55-70 (2009) | |
11966 PUBMED 19009289 | |
11967 REFERENCE 5 (bases 1 to 484) | |
11968 AUTHORS Lynn,D.J., Higgs,R., Lloyd,A.T., O'Farrelly,C., Herve-Grepinet,V., | |
11969 Nys,Y., Brinkman,F.S., Yu,P.L., Soulier,A., Kaiser,P., Zhang,G. and | |
11970 Lehrer,R.I. | |
11971 TITLE Avian beta-defensin nomenclature: a community proposed update | |
11972 JOURNAL Immunol. Lett. 110 (1), 86-89 (2007) | |
11973 PUBMED 17467809 | |
11974 REFERENCE 6 (bases 1 to 484) | |
11975 AUTHORS Yoshimura Y, Ohashi H, Subedi K, Nishibori M and Isobe N. | |
11976 TITLE Effects of age, egg-laying activity, and Salmonella-inoculation on | |
11977 the expressions of gallinacin mRNA in the vagina of the hen oviduct | |
11978 JOURNAL J. Reprod. Dev. 52 (2), 211-218 (2006) | |
11979 PUBMED 16394622 | |
11980 REMARK GeneRIF: mRNA expression of Gal-1, -2 and -3 in the vagina of | |
11981 laying hens increases with age but decreases in the regressed | |
11982 oviduct during the non-laying phase, and may increase in response | |
11983 to Salmonella enteritidis (SE) and lipopolysaccharide | |
11984 REFERENCE 7 (bases 1 to 484) | |
11985 AUTHORS Bar-Shira E and Friedman A. | |
11986 TITLE Development and adaptations of innate immunity in the | |
11987 gastrointestinal tract of the newly hatched chick | |
11988 JOURNAL Dev. Comp. Immunol. 30 (10), 930-941 (2006) | |
11989 PUBMED 16430960 | |
11990 REMARK GeneRIF: Authors use expression of beta-defensins GAL1 and GLA2 to | |
11991 postulate in situ maturation of heterophils in hatchling gut | |
11992 tissue. | |
11993 REFERENCE 8 (bases 1 to 484) | |
11994 AUTHORS Xiao Y, Hughes AL, Ando J, Matsuda Y, Cheng JF, Skinner-Noble D and | |
11995 Zhang G. | |
11996 TITLE A genome-wide screen identifies a single beta-defensin gene cluster | |
11997 in the chicken: implications for the origin and evolution of | |
11998 mammalian defensins | |
11999 JOURNAL BMC Genomics 5 (1), 56 (2004) | |
12000 PUBMED 15310403 | |
12001 REMARK GeneRIF: The chicken genome encodes only beta-defensins. The 13 | |
12002 chicken beta-defensin genes are clustered densely within a 86-Kb | |
12003 distance on the chromosome 3q3.5-q3.7. The deduced peptides share | |
12004 the characteristic defensin motif. | |
12005 Publication Status: Online-Only | |
12006 REFERENCE 9 (bases 1 to 484) | |
12007 AUTHORS Brockus CW, Jackwood MW and Harmon BG. | |
12008 TITLE Characterization of beta-defensin prepropeptide mRNA from chicken | |
12009 and turkey bone marrow | |
12010 JOURNAL Anim. Genet. 29 (4), 283-289 (1998) | |
12011 PUBMED 9745666 | |
12012 REFERENCE 10 (bases 1 to 484) | |
12013 AUTHORS Harwig SS, Swiderek KM, Kokryakov VN, Tan L, Lee TD, Panyutich EA, | |
12014 Aleshina GM, Shamova OV and Lehrer RI. | |
12015 TITLE Gallinacins: cysteine-rich antimicrobial peptides of chicken | |
12016 leukocytes | |
12017 JOURNAL FEBS Lett. 342 (3), 281-285 (1994) | |
12018 PUBMED 8150085 | |
12019 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
12020 preliminary review. The reference sequence was derived from | |
12021 CF250963.1, AF033336.1, DQ858325.1 and BQ484799.1. | |
12022 On Jan 19, 2011 this sequence version replaced gi:45384507. | |
12023 | |
12024 Transcript Variant: This variant (1) represents the shorter | |
12025 transcript. Both variants 1 and 2 encode the same protein. | |
12026 | |
12027 Sequence Note: This RefSeq record was created from transcripts of | |
12028 different strains because no single transcript from the same strain | |
12029 was available for the full length of the gene. The extent of this | |
12030 transcript is supported by transcript alignments and orthologous | |
12031 data. | |
12032 | |
12033 ##Evidence-Data-START## | |
12034 Transcript exon combination :: BQ484799.1, BU449525.1 [ECO:0000332] | |
12035 RNAseq introns :: single sample supports all introns | |
12036 SAMEA2201357, SAMEA2201358 | |
12037 [ECO:0000348] | |
12038 ##Evidence-Data-END## | |
12039 COMPLETENESS: complete on the 3' end. | |
12040 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
12041 1-60 CF250963.1 3-62 | |
12042 61-136 AF033336.1 1-76 | |
12043 137-137 DQ858325.1 50-50 | |
12044 138-299 AF033336.1 78-239 | |
12045 300-300 BQ484799.1 281-281 | |
12046 301-484 AF033336.1 240-423 | |
12047 FEATURES Location/Qualifiers | |
12048 source 1..484 | |
12049 /organism="Gallus gallus" | |
12050 /mol_type="mRNA" | |
12051 /db_xref="taxon:9031" | |
12052 /chromosome="3" | |
12053 /map="3" | |
12054 /breed="xinghua" | |
12055 gene 1..484 | |
12056 /gene="DEFB4A" | |
12057 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2" | |
12058 /note="defensin beta 4A" | |
12059 /db_xref="CGNC:49507" | |
12060 /db_xref="GeneID:395840" | |
12061 misc_feature 58..60 | |
12062 /gene="DEFB4A" | |
12063 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2" | |
12064 /note="upstream in-frame stop codon" | |
12065 CDS 88..282 | |
12066 /gene="DEFB4A" | |
12067 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2" | |
12068 /note="gallinacin-2; antimicrobial peptide 2; | |
12069 beta-defensin 2 antimicrobial peptide; avian beta-defensin | |
12070 2" | |
12071 /codon_start=1 | |
12072 /product="gallinacin-2 precursor" | |
12073 /protein_id="NP_990323.2" | |
12074 /db_xref="CGNC:49507" | |
12075 /db_xref="GeneID:395840" | |
12076 /translation="MRILYLLFSLLFLALQASPGLSSPRRDMLFCKGGSCHFGGCPSH | |
12077 LIKVGSCFGFRSCCKWPWNA" | |
12078 sig_peptide 88..153 | |
12079 /gene="DEFB4A" | |
12080 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2" | |
12081 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
12082 mat_peptide 172..279 | |
12083 /gene="DEFB4A" | |
12084 /gene_synonym="AvBD2; GAL 2; gal-2; GAL2" | |
12085 /product="Gallinacin-2" | |
12086 /experiment="experimental evidence, no additional details | |
12087 recorded" | |
12088 /note="propagated from UniProtKB/Swiss-Prot (P46158.2)" | |
12089 ORIGIN | |
12090 1 aaagccctct ggagggaaga gaccaagagg tgttctggtt tggcttttgg gctcatctaa | |
12091 61 tatccgcagc tcagcagatc tgcagccatg aggattcttt acctgctttt ctctctcctc | |
12092 121 ttcctggcac tccaggcttc tccagggttg tcttcgcccc ggcgggacat gctgttctgt | |
12093 181 aaaggagggt cctgccactt tggagggtgt cccagccatc taatcaaagt cggaagctgc | |
12094 241 ttcgggttcc gttcctgctg caaatggcct tggaatgcat aaacacttca tgagtccatt | |
12095 301 caagagcttt gaaaatttct tccaggcatg tgctttaaat gctacagcaa agcctcagca | |
12096 361 gcaagaagac ccctctcatg tgttaatgca atatgttttg tgttgtagag taaatacaaa | |
12097 421 tatcttctgc actgcctttc ttcctcttga ataaattgtc attgcatagc aaaaaaaaaa | |
12098 481 aaaa | |
12099 // | |
12100 | |
12101 LOCUS NM_001199613 934 bp mRNA linear VRT 04-JAN-2017 | |
12102 DEFINITION Gallus gallus anterior gradient 3, protein disulphide isomerase | |
12103 family member (AGR3), mRNA. | |
12104 ACCESSION NM_001199613 XM_418699 | |
12105 VERSION NM_001199613.1 | |
12106 KEYWORDS RefSeq. | |
12107 SOURCE Gallus gallus (chicken) | |
12108 ORGANISM Gallus gallus | |
12109 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
12110 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
12111 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
12112 Phasianidae; Phasianinae; Gallus. | |
12113 REFERENCE 1 (bases 1 to 934) | |
12114 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
12115 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
12116 TITLE A comprehensive collection of chicken cDNAs | |
12117 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
12118 PUBMED 12445392 | |
12119 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
12120 preliminary review. The reference sequence was derived from | |
12121 AADN04000095.1 and BU228146.1. | |
12122 On Dec 11, 2010 this sequence version replaced gi:118085898. | |
12123 | |
12124 Sequence Note: This RefSeq record was created from transcripts from | |
12125 different strains and genomic sequence data because no single | |
12126 transcript from the same strain was available for the full length | |
12127 of the gene. The extent of this transcript is supported by | |
12128 transcript alignments and orthologous data. | |
12129 | |
12130 ##Evidence-Data-START## | |
12131 RNAseq introns :: single sample supports all introns SAMN03354478, | |
12132 SAMN03354485 [ECO:0000348] | |
12133 ##Evidence-Data-END## | |
12134 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
12135 1-106 AADN04000095.1 235528-235633 | |
12136 107-209 BU228146.1 16-118 | |
12137 210-210 AADN04000095.1 238485-238485 | |
12138 211-593 BU228146.1 120-502 | |
12139 594-934 AADN04000095.1 241999-242339 | |
12140 FEATURES Location/Qualifiers | |
12141 source 1..934 | |
12142 /organism="Gallus gallus" | |
12143 /mol_type="mRNA" | |
12144 /db_xref="taxon:9031" | |
12145 /chromosome="2" | |
12146 /map="2" | |
12147 /breed="Red Jungle Fowl" | |
12148 gene 1..934 | |
12149 /gene="AGR3" | |
12150 /note="anterior gradient 3, protein disulphide isomerase | |
12151 family member" | |
12152 /db_xref="CGNC:13935" | |
12153 /db_xref="GeneID:420597" | |
12154 CDS 1..498 | |
12155 /gene="AGR3" | |
12156 /note="anterior gradient protein 3 homolog; anterior | |
12157 gradient homolog 3" | |
12158 /codon_start=1 | |
12159 /product="anterior gradient protein 3 precursor" | |
12160 /protein_id="NP_001186542.1" | |
12161 /db_xref="CGNC:13935" | |
12162 /db_xref="GeneID:420597" | |
12163 /translation="MLHSTLALSLLLIAVSSNLAMAIKKEKRTPQTLSRGWGDEITWV | |
12164 QTYEEGLYQAKKSNKPLMVIHHLEDCQYCQALKKAFAENEEIQEMAQDNFIMLNLMHE | |
12165 TTDKNLSPDGQYVPRIMFIDPSLTVRADITGRYSNRLYTYEPQDIPFLIENMKKALRL | |
12166 IQTEL" | |
12167 sig_peptide 1..66 | |
12168 /gene="AGR3" | |
12169 /inference="COORDINATES: ab initio prediction:SignalP:4.0" | |
12170 ORIGIN | |
12171 1 atgctccatt caacattggc cttgtctctc ctgctaattg cagtctcatc caacctcgct | |
12172 61 atggcaatca aaaaggaaaa aagaacacct cagacgctat caagaggctg gggagatgaa | |
12173 121 ataacctggg tacaaactta tgaagaaggg ctttatcaag caaaaaaaag taacaagcca | |
12174 181 ctgatggtca ttcatcattt ggaagactgt caatactgcc aagcactgaa gaaagctttt | |
12175 241 gctgaaaatg aagagataca agaaatggcg caagataact tcattatgct gaatctcatg | |
12176 301 catgaaacca cagataaaaa cctgtcacct gatggacaat acgtgcctcg aatcatgttc | |
12177 361 atagacccat ctctcacggt gagagctgat atcacaggaa gatactctaa tcggctgtac | |
12178 421 acttacgaac cacaagacat accattctta atagaaaaca tgaagaaagc acttcgcctc | |
12179 481 attcagacag aactgtaatc aacagtgaaa tgatcatagc ctctagaagg cgaagctgca | |
12180 541 ccaagaattc caacattcta aaatatttta tttagcctct ttctctgcta tctatttgaa | |
12181 601 ctcttaccaa gcaggtaaac cagatttcat gagaaagtta tatgtatgat ttgaagagga | |
12182 661 aatataggag actatcatta ccatttggga aacagagaag aaatctatca aacagtttga | |
12183 721 agcagagtca gctacctgaa taattgaaag tgatggttta aggtgcaagc aactttgagt | |
12184 781 tgtatattat caattgaact gtagctttat tgtcagctac aacttccaat caagagctat | |
12185 841 agccaatact tcatgtctat ttacaataca tgatgtaagt tattagctac atcttacctc | |
12186 901 ctatttttta tttcatgtag cttgtaaatc ttta | |
12187 // | |
12188 | |
12189 LOCUS NM_001199429 2333 bp mRNA linear VRT 04-JAN-2017 | |
12190 DEFINITION Gallus gallus nephrocystin 1 (NPHP1), mRNA. | |
12191 ACCESSION NM_001199429 XM_419298 | |
12192 VERSION NM_001199429.1 | |
12193 KEYWORDS RefSeq. | |
12194 SOURCE Gallus gallus (chicken) | |
12195 ORGANISM Gallus gallus | |
12196 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
12197 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
12198 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
12199 Phasianidae; Phasianinae; Gallus. | |
12200 REFERENCE 1 (bases 1 to 2333) | |
12201 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
12202 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
12203 TITLE A comprehensive collection of chicken cDNAs | |
12204 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
12205 PUBMED 12445392 | |
12206 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
12207 preliminary review. The reference sequence was derived from | |
12208 CN384177.1, AADN04000266.1, BU374887.1, BX935485.2, BX931832.2, | |
12209 BU434903.1 and BX271340.3. | |
12210 On Dec 9, 2010 this sequence version replaced gi:118087540. | |
12211 | |
12212 Sequence Note: This RefSeq record was created from transcript and | |
12213 genomic sequence data because no single transcript from the same | |
12214 strain was available for the full length of the gene. The extent of | |
12215 this transcript is supported by transcript alignments and | |
12216 orthologous data. | |
12217 | |
12218 ##Evidence-Data-START## | |
12219 RNAseq introns :: mixed/partial sample support SAMEA2201357, | |
12220 SAMEA2201358 [ECO:0000350] | |
12221 ##Evidence-Data-END## | |
12222 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
12223 1-30 CN384177.1 1-30 | |
12224 31-133 AADN04000266.1 617897-617999 c | |
12225 134-524 CN384177.1 134-524 | |
12226 525-702 BU374887.1 104-281 | |
12227 703-929 BX935485.2 1-227 | |
12228 930-938 BX931832.2 510-518 | |
12229 939-2132 BX935485.2 237-1430 | |
12230 2133-2308 BU434903.1 498-673 | |
12231 2309-2333 BX271340.3 583-607 | |
12232 FEATURES Location/Qualifiers | |
12233 source 1..2333 | |
12234 /organism="Gallus gallus" | |
12235 /mol_type="mRNA" | |
12236 /db_xref="taxon:9031" | |
12237 /chromosome="3" | |
12238 /map="3" | |
12239 /breed="Leghorn" | |
12240 gene 1..2333 | |
12241 /gene="NPHP1" | |
12242 /gene_synonym="nephrocystin-1" | |
12243 /note="nephrocystin 1" | |
12244 /db_xref="CGNC:6212" | |
12245 /db_xref="GeneID:421223" | |
12246 misc_feature 50..52 | |
12247 /gene="NPHP1" | |
12248 /gene_synonym="nephrocystin-1" | |
12249 /note="upstream in-frame stop codon" | |
12250 CDS 179..2224 | |
12251 /gene="NPHP1" | |
12252 /gene_synonym="nephrocystin-1" | |
12253 /note="nephronophthisis 1 (juvenile)" | |
12254 /codon_start=1 | |
12255 /product="nephrocystin-1" | |
12256 /protein_id="NP_001186358.1" | |
12257 /db_xref="CGNC:6212" | |
12258 /db_xref="GeneID:421223" | |
12259 /translation="MTGRRARSPLQRVQRQSRELRAQVEALRGEGADAAVGRRAALRQ | |
12260 RCFQLQKLVDENINTLHSLKKADEPAPVGNYNQRKEEEEKLLLKLSQQLQKFCHILDQ | |
12261 DNVATNDTVSEGRQKDPQREDKVKEEAESADDNGESSEEGESEETDEEDEDKLLDDPD | |
12262 VKECIAVGNFNAQQDGDLTFTKGEVLLIHDKKADGWWVAENSKGERGLVPRTYLAVHN | |
12263 EDEENQEESDEHIEVVDETADGTEIRKRTDSHWSAVRKAITESDTVEILATMGAVPTG | |
12264 FRLSTLSQLLEEGNQFRASYFLQPKLTPSQLAFKDLVWDSEKNTICPIPTRVSLIVTL | |
12265 CSCKTIPLPAASIQVLSRHVRLCLFDGNRVLSNIHTVRATWQPKNPQMWTFSPRVTGI | |
12266 LPSLLDGDCFVRSNSLSSDIGLLLELGITYIRNSTGERRELSCGWAFQKLFTSDGMPV | |
12267 PSKMYELLLNGGTPYERGVEVDPSLSRRAGSGVFHQLISLKKQPVLVVKLRSLSTQSK | |
12268 DILNLLPETLIGSMCYIHLLIFYRQILGDALLRDRINMQSAELICNPILATFPQLVDQ | |
12269 PDLMDALRSAWADRERTLKRSEKRDREFLKSVFILVYHDSAFPLLRSTLLPSYKWAEE | |
12270 ESEASRWRVIADFLRKSQEKDGALQSLLSAENTHTAFDISELAYDFLGETRKNNPTV" | |
12271 ORIGIN | |
12272 1 accgcgcggg ggtgaccgag cagcgcgctg gcggcacgaa cgggagcatt aaatcagtgc | |
12273 61 ttgtacgttg ggctcgcagc gtgtttctac accccgcccg cacaccgggc tcgggcccag | |
12274 121 agcgcgcggg ctcccggaag tgacgtcatt tccgagcgcc gcccgttgcc tagcgaccat | |
12275 181 gacggggcgg cgggcgcgca gcccgctgca gcgagtgcag cgacagagcc gggagctgcg | |
12276 241 ggcacaggtg gaagcgctgc ggggagaggg cgcggacgca gccgtcgggc ggcgagcggc | |
12277 301 cctgaggcag agatgttttc agctgcagaa actggtggat gagaatataa atactcttca | |
12278 361 tagtttgaaa aaagctgacg agcctgcacc tgtggggaac tataatcaga ggaaagaaga | |
12279 421 agaagaaaag ctattgctaa agttgtccca gcagctgcag aaattttgtc atatcttgga | |
12280 481 tcaggataat gtggctacaa atgacacagt gagcgaggga cgtcagaaag atcctcaaag | |
12281 541 agaagacaaa gttaaagaag aggctgagag tgctgatgac aatggagaaa gcagtgagga | |
12282 601 aggagaaagt gaagaaacag atgaggaaga tgaggataaa ttgttggatg atcctgatgt | |
12283 661 taaagaatgc attgcagtgg gaaactttaa tgcacagcag gacggggatc tcacatttac | |
12284 721 gaaaggtgaa gtcctgctta tacatgataa gaaggcggat ggctggtggg tagccgagaa | |
12285 781 ctcaaaaggg gagagaggcc tcgtgcctag aacctatctt gcggtccata atgaagatga | |
12286 841 agaaaaccaa gaggaaagtg atgaacacat agaagtggtg gatgaaacag cagatggtac | |
12287 901 tgaaattaga aaaagaacag actctcactg gagcgctgta agaaaagcta tcaccgagag | |
12288 961 tgacacagta gagatattgg caaccatggg agctgttcct acaggattcc gtctatccac | |
12289 1021 actttcccag ctcttagaag aaggtaatca gttcagagca agttacttct tgcagcctaa | |
12290 1081 acttactcca tcccagctgg cttttaaaga tttggtgtgg gactctgaaa aaaatactat | |
12291 1141 ctgtcctata ccaactcgag tatccctgat tgtaactcta tgtagctgta aaacgattcc | |
12292 1201 tctcccagca gccagtattc aggttctcag tagacacgtt cgactctgtc tattcgatgg | |
12293 1261 caatcgggta ctgagtaaca ttcatacagt gagagctacg tggcaaccta aaaaccctca | |
12294 1321 aatgtggacc ttttctccaa gggtaacagg cattttaccc agcttactgg atggtgactg | |
12295 1381 ctttgtcagg tccaattcct tatcttcaga cattggttta ctacttgaac ttggcatcac | |
12296 1441 ttacattcgc aactcaacag gtgaacgacg agagctaagc tgtggctggg catttcagaa | |
12297 1501 gctttttact tctgatggaa tgcctgttcc ttccaaaatg tatgagctgc tattaaatgg | |
12298 1561 tggtactcct tatgagagag gtgttgaggt tgacccatca ctatcaagga gagcaggcag | |
12299 1621 tggtgttttt catcagctta tatcactcaa gaagcagcca gtgcttgtag tgaaactgag | |
12300 1681 gtcattaagc acacagtcaa aggacatcct gaatttgtta ccagaaacat taattggcag | |
12301 1741 tatgtgctac atccatctct tgatatttta tcgacaaata cttggtgatg cactcctgag | |
12302 1801 agacagaata aacatgcaaa gtgcagaatt aatctgtaat cctattttag caacttttcc | |
12303 1861 tcaactcgtg gatcagccag acctgatgga tgcactgcgg agtgcttggg cggacagaga | |
12304 1921 aagaactttg aagagatcag aaaagagaga tcgagaattc ctgaagtctg tgttcatcct | |
12305 1981 ggtgtaccat gactcagcct tccctctcct ccggtccact ttgctcccca gctacaagtg | |
12306 2041 ggcagaggag gagtccgaag cgtctcgctg gagagtgatt gctgacttcc tgagaaagag | |
12307 2101 ccaagagaaa gatggtgccc ttcagtctct gctgtccgca gaaaacactc acacagcctt | |
12308 2161 tgacatctca gagctggcct atgatttctt gggagaaacg aggaaaaata atcccacagt | |
12309 2221 atgaatggat tgtaggataa caatatagat aaatttttac caaagagaaa ttatgtgtac | |
12310 2281 tgtctgaatt gcaagaaata ttttcacaca ttaaaaataa cattttgagg gag | |
12311 // | |
12312 | |
12313 LOCUS NM_001195561 781 bp mRNA linear VRT 04-JAN-2017 | |
12314 DEFINITION Gallus gallus prolyl-tRNA synthetase associated domain containing | |
12315 1, pseudogene (PRORSD1P), mRNA. | |
12316 ACCESSION NM_001195561 XM_419287 | |
12317 VERSION NM_001195561.1 | |
12318 KEYWORDS RefSeq. | |
12319 SOURCE Gallus gallus (chicken) | |
12320 ORGANISM Gallus gallus | |
12321 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
12322 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
12323 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
12324 Phasianidae; Phasianinae; Gallus. | |
12325 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
12326 preliminary review. The reference sequence was derived from | |
12327 AADN04000361.1. | |
12328 On Sep 17, 2010 this sequence version replaced gi:118087490. | |
12329 | |
12330 Sequence Note: The RefSeq transcript and protein were derived from | |
12331 genomic sequence to make the sequence consistent with the reference | |
12332 genome assembly. The genomic coordinates used for the transcript | |
12333 record were based on alignments. | |
12334 | |
12335 ##Evidence-Data-START## | |
12336 Transcript exon combination :: BX929534.2, BU227122.1 [ECO:0000332] | |
12337 RNAseq introns :: single sample supports all introns | |
12338 SAMEA2201357, SAMEA2201358 | |
12339 [ECO:0000348] | |
12340 ##Evidence-Data-END## | |
12341 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
12342 1-102 AADN04000361.1 689096-689197 c | |
12343 103-781 AADN04000361.1 688074-688752 c | |
12344 FEATURES Location/Qualifiers | |
12345 source 1..781 | |
12346 /organism="Gallus gallus" | |
12347 /mol_type="mRNA" | |
12348 /db_xref="taxon:9031" | |
12349 /chromosome="3" | |
12350 /map="3" | |
12351 /breed="Red Jungle Fowl" | |
12352 gene 1..781 | |
12353 /gene="PRORSD1P" | |
12354 /gene_synonym="PRORSD1" | |
12355 /note="prolyl-tRNA synthetase associated domain containing | |
12356 1, pseudogene" | |
12357 /db_xref="CGNC:51437" | |
12358 /db_xref="GeneID:421212" | |
12359 CDS 16..540 | |
12360 /gene="PRORSD1P" | |
12361 /gene_synonym="PRORSD1" | |
12362 /codon_start=1 | |
12363 /product="PrdX-deacylase domain 1" | |
12364 /protein_id="NP_001182490.1" | |
12365 /db_xref="CGNC:51437" | |
12366 /db_xref="GeneID:421212" | |
12367 /translation="MAAAPGLREALEQRLRDLGIAATTTEHPEVFTVEEMMAHVQHLK | |
12368 GGHSKNLFLKDKKRKEFWLVTVLHDRQVDLNHLAKKLGVGSGNLRFADENAMLEKLQV | |
12369 GQGCATPLALFCDHGDVRLVLDAGFLEGGHEKVYFHPMTNGATMGLSPEDFLKFVKST | |
12370 GHDPIVVHFDEDIK" | |
12371 ORIGIN | |
12372 1 cgggaaagtg gtggcatggc ggcggcgccg gggctgcggg aggcgctgga gcagcggttg | |
12373 61 cgggatttgg gcatcgctgc caccaccacg gagcacccgg aggtgttcac ggttgaagaa | |
12374 121 atgatggccc acgtccaaca cttgaaagga gggcacagta aaaacctttt ccttaaagac | |
12375 181 aaaaagagga aagagttctg gctggtgact gtcctgcacg acaggcaggt ggatttaaac | |
12376 241 catctggcaa aaaaacttgg cgttggaagt ggaaacctga gatttgctga tgaaaacgcc | |
12377 301 atgctggaga agctccaggt gggccaaggc tgtgccacac cgctggctct gttctgtgac | |
12378 361 cacggagatg tgaggttggt gctggatgcc ggcttcctgg agggcggcca tgaaaaggtg | |
12379 421 tattttcatc caatgacaaa tggtgcgacc atgggcttaa gccctgagga cttcctgaag | |
12380 481 tttgtgaaat cgacaggcca cgatccaatc gtcgtgcatt ttgatgaaga cattaaatag | |
12381 541 ggtcacatgg ctcggtgttg atgttatagc gcaaaactgg tgggagtctc gtgataaata | |
12382 601 cagcttggaa gaacagggct gctcttttgt acagtgtaac atttagtgta agaaaatact | |
12383 661 acacttgggt tactgaaaat tcaacagaat attcttgaga agatgtctgc aatctgccag | |
12384 721 catccagcat gatgaaaagg cattatataa ataataatat gttaataaaa tgcataaagt | |
12385 781 g | |
12386 // | |
12387 | |
12388 LOCUS NM_001195424 3105 bp mRNA linear VRT 04-JAN-2017 | |
12389 DEFINITION Gallus gallus ubiquitin conjugating enzyme E2 E3 (UBE2E3), mRNA. | |
12390 ACCESSION NM_001195424 XM_421975 | |
12391 VERSION NM_001195424.1 | |
12392 KEYWORDS RefSeq. | |
12393 SOURCE Gallus gallus (chicken) | |
12394 ORGANISM Gallus gallus | |
12395 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
12396 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
12397 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
12398 Phasianidae; Phasianinae; Gallus. | |
12399 REFERENCE 1 (bases 1 to 3105) | |
12400 AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R, | |
12401 Burnside J, Aggrey SE, Simon J and Cogburn LA. | |
12402 TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs | |
12403 from single and multiple tissue cDNA libraries and CAP3 assembly of | |
12404 a chicken gene index | |
12405 JOURNAL Physiol. Genomics 25 (3), 514-524 (2006) | |
12406 PUBMED 16554550 | |
12407 REFERENCE 2 (bases 1 to 3105) | |
12408 AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong | |
12409 WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. | |
12410 TITLE A comprehensive collection of chicken cDNAs | |
12411 JOURNAL Curr. Biol. 12 (22), 1965-1969 (2002) | |
12412 PUBMED 12445392 | |
12413 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
12414 preliminary review. The reference sequence was derived from | |
12415 AADN04000048.1, CD217623.1, BU110886.1 and DR431499.1. | |
12416 On Sep 10, 2010 this sequence version replaced gi:118093495. | |
12417 | |
12418 Sequence Note: This RefSeq record was created from transcript and | |
12419 genomic sequence data to make the sequence consistent with the | |
12420 reference genome assembly. The genomic coordinates used for the | |
12421 transcript record were based on transcript alignments. | |
12422 | |
12423 ##Evidence-Data-START## | |
12424 Transcript exon combination :: BU442557.1, BU365019.1 [ECO:0000332] | |
12425 RNAseq introns :: single sample supports all introns | |
12426 SAMEA2201366 [ECO:0000348] | |
12427 ##Evidence-Data-END## | |
12428 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
12429 1-4 AADN04000048.1 6785597-6785600 c | |
12430 5-267 CD217623.1 129-391 | |
12431 268-691 BU110886.1 173-596 | |
12432 692-3088 AADN04000048.1 6730619-6733015 c | |
12433 3089-3105 DR431499.1 3-19 c | |
12434 FEATURES Location/Qualifiers | |
12435 source 1..3105 | |
12436 /organism="Gallus gallus" | |
12437 /mol_type="mRNA" | |
12438 /db_xref="taxon:9031" | |
12439 /chromosome="7" | |
12440 /map="7" | |
12441 /breed="Red Jungle Fowl" | |
12442 gene 1..3105 | |
12443 /gene="UBE2E3" | |
12444 /gene_synonym="yeast)" | |
12445 /note="ubiquitin conjugating enzyme E2 E3" | |
12446 /db_xref="CGNC:14325" | |
12447 /db_xref="GeneID:424122" | |
12448 CDS 13..636 | |
12449 /gene="UBE2E3" | |
12450 /gene_synonym="yeast)" | |
12451 /EC_number="6.3.2.19" | |
12452 /note="ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, | |
12453 yeast)" | |
12454 /codon_start=1 | |
12455 /product="ubiquitin-conjugating enzyme E2 E3" | |
12456 /protein_id="NP_001182353.1" | |
12457 /db_xref="CGNC:14325" | |
12458 /db_xref="GeneID:424122" | |
12459 /translation="MSSDRQRSDDESPSTSSGSSDADQRDPPAPEPEEQEERKPSATQ | |
12460 QKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPG | |
12461 SVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTIS | |
12462 KVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT" | |
12463 STS 839..1133 | |
12464 /gene="UBE2E3" | |
12465 /gene_synonym="yeast)" | |
12466 /standard_name="T03564" | |
12467 /db_xref="UniSTS:72354" | |
12468 ORIGIN | |
12469 1 aagttcccca cgatgtccag tgacaggcag aggtcggacg atgagagccc cagtaccagc | |
12470 61 agcggcagct cagacgccga ccagagggac cccccggcac ctgaacctga ggagcaggag | |
12471 121 gaaaggaaac cctctgccac ccaacagaag aagaacacca aactctccag caaaactact | |
12472 181 gctaagctat ctactagtgc taaaagaatc cagaaggagc tagctgaaat aactcttgat | |
12473 241 cctcctccta actgcagtgc cggccctaaa ggagataaca tttatgaatg gagatcaact | |
12474 301 atacttggac ctccgggttc tgtatatgag gggggcgttt ttttcctgga tatcacattt | |
12475 361 tcatctgact atccattcaa gccaccaaag gttactttcc gcaccagaat ttatcactgc | |
12476 421 aacatcaaca gtcagggagt catctgtctg gatatcctga aggacaactg gagccctgct | |
12477 481 ttgactattt caaaggtcct gctgtctatt tgttctcttt tgacagactg caacccggct | |
12478 541 gatcctctgg ttggaagcat agccactcag tatctgacca acagagcaga acatgacagg | |
12479 601 atagccagac agtggaccaa gagatatgca acataaacaa caaactactt gtgcagtgtg | |
12480 661 aaggtgcaga aggcaacttt acagtgtgca acaaatcttt atagccttta caatacggac | |
12481 721 ttctgtgtat atgttatact gattctactc tgcttttatc cttttgaaga ctgggatact | |
12482 781 gcctcccaaa aaggtaaatg ctatcaagag tagaaatttg tagctgtaga ttagttatgt | |
12483 841 ttaaaatgcc tacttgcaag tcttgcttct ttgggatatc aaaatgtatt ttgtgatgta | |
12484 901 ctaaggatac tgttcctgaa gtcaaccaaa tattatagtg cattttagcc taattcatta | |
12485 961 tctgtatgaa gttattaaag gtagctgtag attactagga attatgtcat ttgtattaaa | |
12486 1021 cccagatcta tttccaatat gtggtacatg ctgttgtgga aactgtttta acttttacct | |
12487 1081 ttgtcagttt gtaatgaaag gatttccttt ttccctttgt agctcagaga gcacccagtg | |
12488 1141 tatcatctca aacacaataa acatgttccc caaggagtag tttctttgtt ttcctatttt | |
12489 1201 aaattaatat ttgaaaaaat ttaattatag taacaaggca gggctaatgt atcacagatc | |
12490 1261 cctgtggata atctttaaat taatatacat aagcaaaggc ttgctattaa atgtttaatg | |
12491 1321 cacacctgtg gattgtgtaa gttttccctg ggttttttgg tttgatttgg ttttattttt | |
12492 1381 acagaacaaa tgccattccc atattttcct taactgctca gctctttttc aagttgcaat | |
12493 1441 gagagcaccg catatgcttc ctccaaaagc taatgtagct ggttgcttca gggccagacc | |
12494 1501 tgttcttgta atagatggcc tggtcttgct acaaactcct ttttgcagga ccagagccca | |
12495 1561 gttacagata gtctggtgct tttgtgtcag agtaaagcaa gtcaggcttg ctaatctgga | |
12496 1621 gaaccacagt tgtccactga aaatggtctt ccaaagcatg gttaaacact agtctgtcca | |
12497 1681 gaagagaaag gagtagaata aacttcatca gatttttatg acagaaaaaa accagttgtg | |
12498 1741 ggggaaatta acctttgtta ctgaaaatgc aagatgtaaa acttttagac tacttttccc | |
12499 1801 cctcacctct tcactttctg gcgtggaaat ttttgtaaca tctgtaagta atgaagatgc | |
12500 1861 agctttatag cacatacagt ggaatcacca atagttttat aattcagctt ttgtaggttg | |
12501 1921 ccagtcacac catcgattat acaaaaagag atttgatccc tttaaatgat ttttaaaatt | |
12502 1981 acacctgatt ttcaagttta ctgtcccctt tactacctgg tgtttttgga gataatgtag | |
12503 2041 cacttccatc agtaggatgc tctgctcact taatatatga aaaatgaatg ttaagtttaa | |
12504 2101 ataataaagc aatagaaaaa atgttaaaga ttaaatctaa agttagccat cactatatag | |
12505 2161 atccctgttt tttgtatcac aacctttgat catgaattgt ccaccctact ttaaatattt | |
12506 2221 ctacagattc ctgaaggtgg cttgaagaac tgcgtatccc aaatatctca acctagaagc | |
12507 2281 cagtctctct tggtagctac aagatagctt tagacttcag gttataaagt gcaaaaggga | |
12508 2341 atgagaaaca ggggatctgg caggtgaata tgcctaagtc gggtaacaga ctaatgccag | |
12509 2401 gaaatgaagt gctggaaatc actgctgatg gtgaccagag tttctcattg tgtcgttgaa | |
12510 2461 catgtgagaa atagcacaga ttggcaaagc aacaaggggc tatcgcatcc gggctggaca | |
12511 2521 tctacggtct gctcactgct gtccagtagt gcactgctgt gctgcgcagt gctcgtacac | |
12512 2581 cactccggtg actttccagt gaagagcaaa ctatgtattt catgtgttaa ttatgttgcc | |
12513 2641 tacagaattt acagatattt atatcatgaa ataatatggt ataaagaaag acaggtttta | |
12514 2701 attctaattt taatgtattt tgtttttgta ttgtactgac aacttcatct actgaggtgt | |
12515 2761 acaaatgtga tgcctcgtca gtgttgcccc atcttgcctt ccttgcaatt ggatccttta | |
12516 2821 cactgaattc tcatcctttt tcttctcttt tttttccttt ctttctttct ttcttttttt | |
12517 2881 ttttttttgt tgttgttggt ttgtcatcat tctgttcttt tttaatgtag tttttttgtg | |
12518 2941 tgtaaatttt atatttactg aagtaaaggt tgtttttgtg taaacattta aactttaaga | |
12519 3001 aagaaaaaag aaaagctaat tttgtttctc aagttctctc tgctaaaaca tgcagtagaa | |
12520 3061 agaaatttgt attgttaaat aaatcaatta gttgttaaat gcgaa | |
12521 // | |
12522 | |
12523 LOCUS NM_001111014 4041 bp mRNA linear VRT 04-JAN-2017 | |
12524 DEFINITION Gallus gallus glutamate ionotropic receptor AMPA type subunit 2 | |
12525 (GRIA2), transcript variant 2, mRNA. | |
12526 ACCESSION NM_001111014 | |
12527 VERSION NM_001111014.2 | |
12528 KEYWORDS RefSeq. | |
12529 SOURCE Gallus gallus (chicken) | |
12530 ORGANISM Gallus gallus | |
12531 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
12532 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
12533 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
12534 Phasianidae; Phasianinae; Gallus. | |
12535 REFERENCE 1 (bases 1 to 4041) | |
12536 AUTHORS Yoon YJ, White SL, Ni X, Gokin AP and Martin-Caraballo M. | |
12537 TITLE Downregulation of GluA2 AMPA receptor subunits reduces the | |
12538 dendritic arborization of developing spinal motoneurons | |
12539 JOURNAL PLoS ONE 7 (11), E49879 (2012) | |
12540 PUBMED 23226228 | |
12541 REMARK GeneRIF: Increased GluA2 expression and changes in the Ca(2+) | |
12542 permeability of AMPA receptors regulate the dendritic arborization | |
12543 of spinal cord motoneurons during embryonic development. | |
12544 REFERENCE 2 (bases 1 to 4041) | |
12545 AUTHORS Ni X, Sullivan GJ and Martin-Caraballo M. | |
12546 TITLE Developmental characteristics of AMPA receptors in chick lumbar | |
12547 motoneurons | |
12548 JOURNAL Dev Neurobiol 67 (11), 1419-1432 (2007) | |
12549 PUBMED 17497695 | |
12550 REMARK GeneRIF: These findings raise the possibility that Ca2+ influx | |
12551 through Ca(2+)-permeable AMPA receptors plays an important role | |
12552 during early embryonic development in chick spinal motoneurons. | |
12553 REFERENCE 3 (bases 1 to 4041) | |
12554 AUTHORS Migues PV, Cammarota M, Kavanagh J, Atkinson R, Powis DA and Rostas | |
12555 JA. | |
12556 TITLE Maturational changes in the subunit composition of AMPA receptors | |
12557 and the functional consequences of their activation in chicken | |
12558 forebrain | |
12559 JOURNAL Dev. Neurosci. 29 (3), 232-240 (2007) | |
12560 PUBMED 17047319 | |
12561 REMARK GeneRIF: Ca(2+) uptake in response to AMPA receptor activation | |
12562 decreases dramatically during maturation in chicken brain | |
12563 microslices without a change in tissue AMPA receptor content | |
12564 REFERENCE 4 (bases 1 to 4041) | |
12565 AUTHORS Shin JH, Kim H, Lim D, Jeon M, Han BK, Park TS, Kim JK, Lillehoj | |
12566 HS, Cho BW and Han JY. | |
12567 TITLE Analysis of chicken embryonic gonad expressed sequenced tags | |
12568 JOURNAL Anim. Genet. 37 (1), 85-86 (2006) | |
12569 PUBMED 16441308 | |
12570 REFERENCE 5 (bases 1 to 4041) | |
12571 AUTHORS Mendieta J, Gago F and Ramirez G. | |
12572 TITLE Binding of 5'-GMP to the GluR2 AMPA receptor: insight from targeted | |
12573 molecular dynamics simulations | |
12574 JOURNAL Biochemistry 44 (44), 14470-14476 (2005) | |
12575 PUBMED 16262247 | |
12576 REMARK GeneRIF: Results show that 5'GMP appears to be a false agonist | |
12577 rather than a competitive antagonist of the GluR2 receptor. | |
12578 REFERENCE 6 (bases 1 to 4041) | |
12579 AUTHORS Aruscavage PJ and Bass BL. | |
12580 TITLE A phylogenetic analysis reveals an unusual sequence conservation | |
12581 within introns involved in RNA editing | |
12582 JOURNAL RNA 6 (2), 257-269 (2000) | |
12583 PUBMED 10688364 | |
12584 REFERENCE 7 (bases 1 to 4041) | |
12585 AUTHORS Ravindranathan A, Parks TN and Rao MS. | |
12586 TITLE Flip and flop isoforms of chick brain AMPA receptor subunits: | |
12587 cloning and analysis of expression patterns | |
12588 JOURNAL Neuroreport 7 (15-17), 2707-2711 (1996) | |
12589 PUBMED 8981452 | |
12590 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
12591 preliminary review. The reference sequence was derived from | |
12592 X89508.1, U59706.1, CV862778.1, CR385667.1, DR431149.1 and | |
12593 CR353879.1. | |
12594 On Jun 4, 2010 this sequence version replaced gi:161377424. | |
12595 | |
12596 Transcript Variant: This variant (2) uses an alternate exon in the | |
12597 3' coding region compared to transcript variant 1, and encodes an | |
12598 isoform (2, also known as flop isoform) that is the same length as | |
12599 isoform 1, but with few amino acid differences. RNA editing | |
12600 (CAG->CGG) changes Gln607Arg. | |
12601 | |
12602 ##Evidence-Data-START## | |
12603 RNAseq introns :: single sample supports all introns SAMEA2201363, | |
12604 SAMEA2201366 [ECO:0000348] | |
12605 ##Evidence-Data-END## | |
12606 | |
12607 ##RefSeq-Attributes-START## | |
12608 undergoes RNA editing :: PMID: 10688364 | |
12609 ##RefSeq-Attributes-END## | |
12610 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
12611 1-2504 X89508.1 1-2504 | |
12612 2505-2793 U59706.1 415-703 | |
12613 2794-2880 X89508.1 2794-2880 | |
12614 2881-3398 CV862778.1 172-689 | |
12615 3399-3744 CR385667.1 444-789 | |
12616 3745-3882 DR431149.1 710-847 | |
12617 3883-4041 CR353879.1 112-270 | |
12618 FEATURES Location/Qualifiers | |
12619 source 1..4041 | |
12620 /organism="Gallus gallus" | |
12621 /mol_type="mRNA" | |
12622 /db_xref="taxon:9031" | |
12623 /chromosome="4" | |
12624 /map="4" | |
12625 /breed="Leghorn" | |
12626 gene 1..4041 | |
12627 /gene="GRIA2" | |
12628 /gene_synonym="GLUR2" | |
12629 /note="glutamate ionotropic receptor AMPA type subunit 2" | |
12630 /db_xref="CGNC:7152" | |
12631 /db_xref="GeneID:414894" | |
12632 CDS 216..2867 | |
12633 /gene="GRIA2" | |
12634 /gene_synonym="GLUR2" | |
12635 /note="isoform 2 precursor is encoded by transcript | |
12636 variant 2; AMPA glutamate receptor 2; AMPA receptor | |
12637 GluR2/B; glutamate receptor B flip isoform; glutamate | |
12638 receptor, ionotropic, AMPA 2" | |
12639 /codon_start=1 | |
12640 /product="glutamate receptor 2 isoform 2 precursor" | |
12641 /protein_id="NP_001104484.1" | |
12642 /db_xref="CGNC:7152" | |
12643 /db_xref="GeneID:414894" | |
12644 /translation="MQKIMHISVCLAPVLWGLIWGAHSNSIQIGGLFPRGADQEYSAF | |
12645 RVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVFAIFGFYDKKSVNTITS | |
12646 FCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWTKFAYLYDSDRGLST | |
12647 LQAVLDSAAEKKWQVTAINVGNINNDRKDETYRSLFQDLEVKKERRVILDCERDKVND | |
12648 IVDQVITIGKHVKGYHYIIANLGFTDGDLSKIQFGGANVSGFQIVDYDDPLVSKFIQR | |
12649 WSTLEEKEYPGAHTSTIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANP | |
12650 AVPWGHGVEIERALKQVQVEGLTGNIKFDQNGKRINFTINVMELKSTGPRKIGYWSEV | |
12651 DKMVVNPLDGPLGNESSGLENKTIIVTTILESPYVMMKKNHEMLEGNDRYEGYCVDLA | |
12652 TEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREE | |
12653 VIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSR | |
12654 FSPYEWHTEEFEDGRETQTNESTNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGG | |
12655 VWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRR | |
12656 SKIAVFDKMWTYMKSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCD | |
12657 TMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGG | |
12658 GDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAKNAQNIN | |
12659 PTSSQNSQNFATYKEGYNVYGIESVKI" | |
12660 sig_peptide 216..278 | |
12661 /gene="GRIA2" | |
12662 /gene_synonym="GLUR2" | |
12663 mat_peptide 279..2864 | |
12664 /gene="GRIA2" | |
12665 /gene_synonym="GLUR2" | |
12666 /product="glutamate receptor 2 isoform 2" | |
12667 misc_feature 2035 | |
12668 /gene="GRIA2" | |
12669 /gene_synonym="GLUR2" | |
12670 /note="RNA editing at nt 2035 (CAG->CGG) changes | |
12671 Gln607Arg; Region: RNA editing site" | |
12672 STS 2869..3118 | |
12673 /gene="GRIA2" | |
12674 /gene_synonym="GLUR2" | |
12675 /standard_name="SHGC-67298" | |
12676 /db_xref="UniSTS:89435" | |
12677 ORIGIN | |
12678 1 agagcggcgg aggcagctcg ggaacggtgt ctcccgctcg cggtgcccgg cctcggcctc | |
12679 61 gcctccctgc ccagggtctg ctcgcagccc ccggccgctc gaccggcgtg cggaggatcg | |
12680 121 aattcggcgg cggcggagga aggaaggaaa gaaagaagga aggaagaaag aagcgccgtt | |
12681 181 tctgtggctt tgtggatgct ctccttttcc tggaaatgca aaagattatg catatttctg | |
12682 241 tctgcctggc tcccgtgttg tggggactga tctggggggc ccattccaac agcatacaga | |
12683 301 tcggggggct gttcccgagg ggcgccgacc aggagtacag cgcgttccgg gtgggcatgg | |
12684 361 tgcagttctc cacctccgag ttcaggctca ctccccacat cgacaacctg gaggttgcca | |
12685 421 acagcttcgc cgtcaccaac gccttctgct cccagttttc cagaggagtc tttgctattt | |
12686 481 ttggattcta tgataagaag tctgtaaaca ccataacatc cttctgtggg actcttcatg | |
12687 541 tctccttcat aactccgagc ttcccgacag atggaacaca cccatttgtc attcagatga | |
12688 601 gacctgacct caagggagct ctccttagtt tgattgaata ctatcagtgg accaagtttg | |
12689 661 catatttata tgacagcgac agagggttat caacattgca agctgtgctg gattctgcag | |
12690 721 ctgaaaagaa gtggcaagtg actgctatca atgtaggaaa tattaacaat gacagaaaag | |
12691 781 atgaaaccta ccgttctcta tttcaagatc tagaagtgaa aaaggaaagg agagtgattt | |
12692 841 tggactgtga gcgtgataaa gtcaacgaca ttgttgatca ggtcatcaca attggtaaac | |
12693 901 atgttaaagg ataccattat attattgcaa atctgggatt tactgatgga gatttatcca | |
12694 961 aaattcagtt tggaggagct aatgtctcag gatttcagat agttgactat gatgatcctt | |
12695 1021 tggtgtcaaa atttatacaa cgttggtcaa cactggagga aaaagaatat cctggtgcac | |
12696 1081 acactagtac aataaagtat acatctgctc tgacctatga tgctgtgcaa gtgatgacag | |
12697 1141 aagctttccg taatttgcgt aaacagagga ttgagatctc cagaagagga aatgctggag | |
12698 1201 attgtcttgc aaatccagct gtaccctggg gtcatggtgt agaaatagaa agggcattga | |
12699 1261 aacaggttca ggtggaaggt ctaacaggga atataaagtt tgatcagaat ggaaagagaa | |
12700 1321 tcaattttac gataaatgtc atggaactca aaagtactgg ccctcggaag attggatatt | |
12701 1381 ggagtgaagt ggacaaaatg gttgtgaatc cacttgatgg ccctcttgga aatgaatctt | |
12702 1441 caggactaga aaataagact attattgtca ccactatttt ggagtcccca tatgttatga | |
12703 1501 tgaagaaaaa tcatgaaatg cttgaaggaa atgatcgata tgagggctat tgtgtggacc | |
12704 1561 tagctacaga aattgctaag cactgtggat tcaaatataa gctcacaatt gttggggatg | |
12705 1621 gcaagtatgg ggcaagggat gcagatacga aaatatggaa tgggatggtt ggagaacttg | |
12706 1681 tttatgggaa agctgatatt gcaattgctc cattaactat aacattggtg agagaagagg | |
12707 1741 tgattgactt ctcaaagccc tttatgagcc tggggatatc aataatgatc aagaaacctc | |
12708 1801 agaagtccaa gccaggagtg ttttcatttc ttgatccatt agcatatgaa atctggatgt | |
12709 1861 gcattgtttt tgcctacatt ggggtcagtg tagttttatt cctggtcagc agatttagtc | |
12710 1921 cgtacgagtg gcacacagag gaatttgaag atggaagaga aacacagact aatgaatcaa | |
12711 1981 ctaatgagtt tgggatattt aatagtctct ggttttccct gggtgccttt atgcggcaag | |
12712 2041 gatgcgatat ttcgccaaga tccctgtctg ggcgcattgt tggaggtgtg tggtggttct | |
12713 2101 ttaccctcat cataatctca tcctacacgg ctaacttagc tgccttcctg acggttgaga | |
12714 2161 ggatggtgtc tcccattgaa agtgcagagg atctttccaa gcaaacagaa attgcatatg | |
12715 2221 ggacattaga ttctggctcc actaaagagt tttttaggag atctaaaatt gcagtgtttg | |
12716 2281 ataaaatgtg gacctatatg aaaagtgcag agccatctgt gtttgtgagg actacagcag | |
12717 2341 aaggggtagc tcgagtacgg aagtccaaag gaaaatatgc ctacttgttg gagtcaacca | |
12718 2401 tgaatgagta catcgaacaa aggaaaccct gtgataccat gaaagttggt gggaatttgg | |
12719 2461 attccaaagg ctacggcatc gccacaccta aaggatcctc attaagaaat gcggttaacc | |
12720 2521 tcgcagtact aaaactgaat gaacaaggcc tgttggacaa attgaaaaac aaatggtggt | |
12721 2581 acgacaaagg agagtgcggc agcgggggag gtgattccaa ggagaagacc agtgccctca | |
12722 2641 gtctgagcaa cgtggcagga gtcttctata ttctcgtcgg gggacttggc ttggcaatgc | |
12723 2701 tggtggcttt gattgagttc tgttacaagt cgagagctga ggcgaagaga atgaaggtgg | |
12724 2761 caaagaacgc acagaatatt aacccaactt cctcacagaa ttcacagaat tttgcaactt | |
12725 2821 ataaggaagg ttacaacgta tatggaatcg aaagtgttaa aatttagggg atgaccttga | |
12726 2881 atgatgccat gaggagcaag gcaaggctgt cgatttcagg aagtactgga gaaaatggac | |
12727 2941 atgttatggc tccagaattt ccaaaagcag tgcatgcagt accttatgtg agtcctggca | |
12728 3001 tgagaatgaa tgtcagtgtg actgatctct cgtgattgat aagaaccttt tgagtgcctt | |
12729 3061 acacaatggt tttcttgtgc gtttattgtc aaagtggtga gaggcatcca gtatcttgaa | |
12730 3121 gacttttctt tcagccaaga attcttacat ttgtggagtt catcttggat tataatgaat | |
12731 3181 gattaattca aaacacaaca ccattttcta cacaacttca agatgaagct tgactgacat | |
12732 3241 gcacagctaa catggaagta ctgtattcta actgaagtcg ttgtacaggc aacacaccag | |
12733 3301 tttctgcagc caccgttgtt agttccttgg ttcatattga cttaagcaca cttgacatca | |
12734 3361 attgcatcaa gatgtgacat gttttataag aaaaaaaaga aaaagaaaca tttaaaaatg | |
12735 3421 aaaaaaaata tttttaggta ttttcacaaa caaaaactgg cttttaaata aatttgcttc | |
12736 3481 cataatggtt acatatgaca gataaaaaga aacaaaggaa tctagactgc ggggaagtgg | |
12737 3541 aatattgaaa caaggcttaa ggcatccgtt ccatattttt caaagccaaa tatgtaatgt | |
12738 3601 tgagaagaga agaaataata attaggaggt tcaaatcttg taatttagta ttgttattaa | |
12739 3661 aattttgctg tatatcctat tctttaacat ttggtgttaa tatcaaatta cttggcaatg | |
12740 3721 cttgacattt gaaataaact ttttctatgg ttttatttgc aagtgttcca ttaattttac | |
12741 3781 tagctacagt tagattataa agagtctaaa atgtaaaagg acactgtcaa ggttgggtta | |
12742 3841 atattttaga ttctgacagt gtcgctattc ccagctcatt tgaatcagtt cagctttttt | |
12743 3901 ttctgtggat gaacccaagc tgtgatgctc aaatacgcat tttgaactct gaagaacaag | |
12744 3961 gttgctctgg gttggagtgg tacttcatac cagcacatga ggagtcagac aggtgctgat | |
12745 4021 tcagaatcca gctcctctta a | |
12746 // | |
12747 | |
12748 LOCUS NM_001001775 4041 bp mRNA linear VRT 04-JAN-2017 | |
12749 DEFINITION Gallus gallus glutamate ionotropic receptor AMPA type subunit 2 | |
12750 (GRIA2), transcript variant 1, mRNA. | |
12751 ACCESSION NM_001001775 XM_420381 | |
12752 VERSION NM_001001775.3 | |
12753 KEYWORDS RefSeq. | |
12754 SOURCE Gallus gallus (chicken) | |
12755 ORGANISM Gallus gallus | |
12756 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
12757 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
12758 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
12759 Phasianidae; Phasianinae; Gallus. | |
12760 REFERENCE 1 (bases 1 to 4041) | |
12761 AUTHORS Yoon YJ, White SL, Ni X, Gokin AP and Martin-Caraballo M. | |
12762 TITLE Downregulation of GluA2 AMPA receptor subunits reduces the | |
12763 dendritic arborization of developing spinal motoneurons | |
12764 JOURNAL PLoS ONE 7 (11), E49879 (2012) | |
12765 PUBMED 23226228 | |
12766 REMARK GeneRIF: Increased GluA2 expression and changes in the Ca(2+) | |
12767 permeability of AMPA receptors regulate the dendritic arborization | |
12768 of spinal cord motoneurons during embryonic development. | |
12769 REFERENCE 2 (bases 1 to 4041) | |
12770 AUTHORS Ni X, Sullivan GJ and Martin-Caraballo M. | |
12771 TITLE Developmental characteristics of AMPA receptors in chick lumbar | |
12772 motoneurons | |
12773 JOURNAL Dev Neurobiol 67 (11), 1419-1432 (2007) | |
12774 PUBMED 17497695 | |
12775 REMARK GeneRIF: These findings raise the possibility that Ca2+ influx | |
12776 through Ca(2+)-permeable AMPA receptors plays an important role | |
12777 during early embryonic development in chick spinal motoneurons. | |
12778 REFERENCE 3 (bases 1 to 4041) | |
12779 AUTHORS Migues PV, Cammarota M, Kavanagh J, Atkinson R, Powis DA and Rostas | |
12780 JA. | |
12781 TITLE Maturational changes in the subunit composition of AMPA receptors | |
12782 and the functional consequences of their activation in chicken | |
12783 forebrain | |
12784 JOURNAL Dev. Neurosci. 29 (3), 232-240 (2007) | |
12785 PUBMED 17047319 | |
12786 REMARK GeneRIF: Ca(2+) uptake in response to AMPA receptor activation | |
12787 decreases dramatically during maturation in chicken brain | |
12788 microslices without a change in tissue AMPA receptor content | |
12789 REFERENCE 4 (bases 1 to 4041) | |
12790 AUTHORS Shin JH, Kim H, Lim D, Jeon M, Han BK, Park TS, Kim JK, Lillehoj | |
12791 HS, Cho BW and Han JY. | |
12792 TITLE Analysis of chicken embryonic gonad expressed sequenced tags | |
12793 JOURNAL Anim. Genet. 37 (1), 85-86 (2006) | |
12794 PUBMED 16441308 | |
12795 REFERENCE 5 (bases 1 to 4041) | |
12796 AUTHORS Mendieta J, Gago F and Ramirez G. | |
12797 TITLE Binding of 5'-GMP to the GluR2 AMPA receptor: insight from targeted | |
12798 molecular dynamics simulations | |
12799 JOURNAL Biochemistry 44 (44), 14470-14476 (2005) | |
12800 PUBMED 16262247 | |
12801 REMARK GeneRIF: Results show that 5'GMP appears to be a false agonist | |
12802 rather than a competitive antagonist of the GluR2 receptor. | |
12803 REFERENCE 6 (bases 1 to 4041) | |
12804 AUTHORS Aruscavage PJ and Bass BL. | |
12805 TITLE A phylogenetic analysis reveals an unusual sequence conservation | |
12806 within introns involved in RNA editing | |
12807 JOURNAL RNA 6 (2), 257-269 (2000) | |
12808 PUBMED 10688364 | |
12809 REFERENCE 7 (bases 1 to 4041) | |
12810 AUTHORS Ravindranathan A, Parks TN and Rao MS. | |
12811 TITLE Flip and flop isoforms of chick brain AMPA receptor subunits: | |
12812 cloning and analysis of expression patterns | |
12813 JOURNAL Neuroreport 7 (15-17), 2707-2711 (1996) | |
12814 PUBMED 8981452 | |
12815 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
12816 preliminary review. The reference sequence was derived from | |
12817 X89508.1, U59706.1, CV862778.1, CR385667.1, DR431149.1 and | |
12818 CR353879.1. | |
12819 On Jun 4, 2010 this sequence version replaced gi:161377422. | |
12820 | |
12821 Transcript Variant: This variant (1) encodes isoform 1 (also known | |
12822 as flip isoform). RNA editing (CAG->CGG) changes Gln607Arg. | |
12823 | |
12824 ##Evidence-Data-START## | |
12825 Transcript exon combination :: X89508.1 [ECO:0000332] | |
12826 RNAseq introns :: single sample supports all introns | |
12827 SAMEA2201363, SAMEA2201366 | |
12828 [ECO:0000348] | |
12829 ##Evidence-Data-END## | |
12830 | |
12831 ##RefSeq-Attributes-START## | |
12832 undergoes RNA editing :: PMID: 10688364 | |
12833 ##RefSeq-Attributes-END## | |
12834 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
12835 1-2504 X89508.1 1-2504 | |
12836 2505-2506 U59706.1 415-416 | |
12837 2507-2880 X89508.1 2507-2880 | |
12838 2881-3398 CV862778.1 172-689 | |
12839 3399-3744 CR385667.1 444-789 | |
12840 3745-3882 DR431149.1 710-847 | |
12841 3883-4041 CR353879.1 112-270 | |
12842 FEATURES Location/Qualifiers | |
12843 source 1..4041 | |
12844 /organism="Gallus gallus" | |
12845 /mol_type="mRNA" | |
12846 /db_xref="taxon:9031" | |
12847 /chromosome="4" | |
12848 /map="4" | |
12849 /breed="Leghorn" | |
12850 gene 1..4041 | |
12851 /gene="GRIA2" | |
12852 /gene_synonym="GLUR2" | |
12853 /note="glutamate ionotropic receptor AMPA type subunit 2" | |
12854 /db_xref="CGNC:7152" | |
12855 /db_xref="GeneID:414894" | |
12856 CDS 216..2867 | |
12857 /gene="GRIA2" | |
12858 /gene_synonym="GLUR2" | |
12859 /note="isoform 1 precursor is encoded by transcript | |
12860 variant 1; AMPA glutamate receptor 2; AMPA receptor | |
12861 GluR2/B; glutamate receptor B flip isoform; glutamate | |
12862 receptor, ionotropic, AMPA 2" | |
12863 /codon_start=1 | |
12864 /product="glutamate receptor 2 isoform 1 precursor" | |
12865 /protein_id="NP_001001775.2" | |
12866 /db_xref="CGNC:7152" | |
12867 /db_xref="GeneID:414894" | |
12868 /translation="MQKIMHISVCLAPVLWGLIWGAHSNSIQIGGLFPRGADQEYSAF | |
12869 RVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVFAIFGFYDKKSVNTITS | |
12870 FCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWTKFAYLYDSDRGLST | |
12871 LQAVLDSAAEKKWQVTAINVGNINNDRKDETYRSLFQDLEVKKERRVILDCERDKVND | |
12872 IVDQVITIGKHVKGYHYIIANLGFTDGDLSKIQFGGANVSGFQIVDYDDPLVSKFIQR | |
12873 WSTLEEKEYPGAHTSTIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANP | |
12874 AVPWGHGVEIERALKQVQVEGLTGNIKFDQNGKRINFTINVMELKSTGPRKIGYWSEV | |
12875 DKMVVNPLDGPLGNESSGLENKTIIVTTILESPYVMMKKNHEMLEGNDRYEGYCVDLA | |
12876 TEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREE | |
12877 VIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSR | |
12878 FSPYEWHTEEFEDGRETQTNESTNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGG | |
12879 VWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRR | |
12880 SKIAVFDKMWTYMKSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCD | |
12881 TMKVGGNLDSKGYGIATPKGSSLRTPVNLAVLKLSEQGVLDKLKNKWWYDKGECGAKD | |
12882 SGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAKNAQNIN | |
12883 PTSSQNSQNFATYKEGYNVYGIESVKI" | |
12884 sig_peptide 216..278 | |
12885 /gene="GRIA2" | |
12886 /gene_synonym="GLUR2" | |
12887 mat_peptide 279..2864 | |
12888 /gene="GRIA2" | |
12889 /gene_synonym="GLUR2" | |
12890 /product="glutamate receptor 2 isoform 1" | |
12891 misc_feature 2035 | |
12892 /gene="GRIA2" | |
12893 /gene_synonym="GLUR2" | |
12894 /note="RNA editing at nt 2035 (CAG->CGG) changes | |
12895 Gln607Arg; Region: RNA editing site" | |
12896 STS 2869..3118 | |
12897 /gene="GRIA2" | |
12898 /gene_synonym="GLUR2" | |
12899 /standard_name="SHGC-67298" | |
12900 /db_xref="UniSTS:89435" | |
12901 ORIGIN | |
12902 1 agagcggcgg aggcagctcg ggaacggtgt ctcccgctcg cggtgcccgg cctcggcctc | |
12903 61 gcctccctgc ccagggtctg ctcgcagccc ccggccgctc gaccggcgtg cggaggatcg | |
12904 121 aattcggcgg cggcggagga aggaaggaaa gaaagaagga aggaagaaag aagcgccgtt | |
12905 181 tctgtggctt tgtggatgct ctccttttcc tggaaatgca aaagattatg catatttctg | |
12906 241 tctgcctggc tcccgtgttg tggggactga tctggggggc ccattccaac agcatacaga | |
12907 301 tcggggggct gttcccgagg ggcgccgacc aggagtacag cgcgttccgg gtgggcatgg | |
12908 361 tgcagttctc cacctccgag ttcaggctca ctccccacat cgacaacctg gaggttgcca | |
12909 421 acagcttcgc cgtcaccaac gccttctgct cccagttttc cagaggagtc tttgctattt | |
12910 481 ttggattcta tgataagaag tctgtaaaca ccataacatc cttctgtggg actcttcatg | |
12911 541 tctccttcat aactccgagc ttcccgacag atggaacaca cccatttgtc attcagatga | |
12912 601 gacctgacct caagggagct ctccttagtt tgattgaata ctatcagtgg accaagtttg | |
12913 661 catatttata tgacagcgac agagggttat caacattgca agctgtgctg gattctgcag | |
12914 721 ctgaaaagaa gtggcaagtg actgctatca atgtaggaaa tattaacaat gacagaaaag | |
12915 781 atgaaaccta ccgttctcta tttcaagatc tagaagtgaa aaaggaaagg agagtgattt | |
12916 841 tggactgtga gcgtgataaa gtcaacgaca ttgttgatca ggtcatcaca attggtaaac | |
12917 901 atgttaaagg ataccattat attattgcaa atctgggatt tactgatgga gatttatcca | |
12918 961 aaattcagtt tggaggagct aatgtctcag gatttcagat agttgactat gatgatcctt | |
12919 1021 tggtgtcaaa atttatacaa cgttggtcaa cactggagga aaaagaatat cctggtgcac | |
12920 1081 acactagtac aataaagtat acatctgctc tgacctatga tgctgtgcaa gtgatgacag | |
12921 1141 aagctttccg taatttgcgt aaacagagga ttgagatctc cagaagagga aatgctggag | |
12922 1201 attgtcttgc aaatccagct gtaccctggg gtcatggtgt agaaatagaa agggcattga | |
12923 1261 aacaggttca ggtggaaggt ctaacaggga atataaagtt tgatcagaat ggaaagagaa | |
12924 1321 tcaattttac gataaatgtc atggaactca aaagtactgg ccctcggaag attggatatt | |
12925 1381 ggagtgaagt ggacaaaatg gttgtgaatc cacttgatgg ccctcttgga aatgaatctt | |
12926 1441 caggactaga aaataagact attattgtca ccactatttt ggagtcccca tatgttatga | |
12927 1501 tgaagaaaaa tcatgaaatg cttgaaggaa atgatcgata tgagggctat tgtgtggacc | |
12928 1561 tagctacaga aattgctaag cactgtggat tcaaatataa gctcacaatt gttggggatg | |
12929 1621 gcaagtatgg ggcaagggat gcagatacga aaatatggaa tgggatggtt ggagaacttg | |
12930 1681 tttatgggaa agctgatatt gcaattgctc cattaactat aacattggtg agagaagagg | |
12931 1741 tgattgactt ctcaaagccc tttatgagcc tggggatatc aataatgatc aagaaacctc | |
12932 1801 agaagtccaa gccaggagtg ttttcatttc ttgatccatt agcatatgaa atctggatgt | |
12933 1861 gcattgtttt tgcctacatt ggggtcagtg tagttttatt cctggtcagc agatttagtc | |
12934 1921 cgtacgagtg gcacacagag gaatttgaag atggaagaga aacacagact aatgaatcaa | |
12935 1981 ctaatgagtt tgggatattt aatagtctct ggttttccct gggtgccttt atgcggcaag | |
12936 2041 gatgcgatat ttcgccaaga tccctgtctg ggcgcattgt tggaggtgtg tggtggttct | |
12937 2101 ttaccctcat cataatctca tcctacacgg ctaacttagc tgccttcctg acggttgaga | |
12938 2161 ggatggtgtc tcccattgaa agtgcagagg atctttccaa gcaaacagaa attgcatatg | |
12939 2221 ggacattaga ttctggctcc actaaagagt tttttaggag atctaaaatt gcagtgtttg | |
12940 2281 ataaaatgtg gacctatatg aaaagtgcag agccatctgt gtttgtgagg actacagcag | |
12941 2341 aaggggtagc tcgagtacgg aagtccaaag gaaaatatgc ctacttgttg gagtcaacca | |
12942 2401 tgaatgagta catcgaacaa aggaaaccct gtgataccat gaaagttggt gggaatttgg | |
12943 2461 attccaaagg ctacggcatc gccacaccta aaggatcctc attaagaacc ccagtaaatc | |
12944 2521 ttgcagtatt gaaactcagt gagcaaggcg tcttagacaa gctgaaaaac aaatggtggt | |
12945 2581 acgataaagg tgaatgtgga gccaaggact ctggaagtaa ggagaagacc agtgccctca | |
12946 2641 gtctgagcaa cgtggcagga gtcttctata ttctcgtcgg gggacttggc ttggcaatgc | |
12947 2701 tggtggcttt gattgagttc tgttacaagt cgagagctga ggcgaagaga atgaaggtgg | |
12948 2761 caaagaacgc acagaatatt aacccaactt cctcacagaa ttcacagaat tttgcaactt | |
12949 2821 ataaggaagg ttacaacgta tatggaatcg aaagtgttaa aatttagggg atgaccttga | |
12950 2881 atgatgccat gaggagcaag gcaaggctgt cgatttcagg aagtactgga gaaaatggac | |
12951 2941 atgttatggc tccagaattt ccaaaagcag tgcatgcagt accttatgtg agtcctggca | |
12952 3001 tgagaatgaa tgtcagtgtg actgatctct cgtgattgat aagaaccttt tgagtgcctt | |
12953 3061 acacaatggt tttcttgtgc gtttattgtc aaagtggtga gaggcatcca gtatcttgaa | |
12954 3121 gacttttctt tcagccaaga attcttacat ttgtggagtt catcttggat tataatgaat | |
12955 3181 gattaattca aaacacaaca ccattttcta cacaacttca agatgaagct tgactgacat | |
12956 3241 gcacagctaa catggaagta ctgtattcta actgaagtcg ttgtacaggc aacacaccag | |
12957 3301 tttctgcagc caccgttgtt agttccttgg ttcatattga cttaagcaca cttgacatca | |
12958 3361 attgcatcaa gatgtgacat gttttataag aaaaaaaaga aaaagaaaca tttaaaaatg | |
12959 3421 aaaaaaaata tttttaggta ttttcacaaa caaaaactgg cttttaaata aatttgcttc | |
12960 3481 cataatggtt acatatgaca gataaaaaga aacaaaggaa tctagactgc ggggaagtgg | |
12961 3541 aatattgaaa caaggcttaa ggcatccgtt ccatattttt caaagccaaa tatgtaatgt | |
12962 3601 tgagaagaga agaaataata attaggaggt tcaaatcttg taatttagta ttgttattaa | |
12963 3661 aattttgctg tatatcctat tctttaacat ttggtgttaa tatcaaatta cttggcaatg | |
12964 3721 cttgacattt gaaataaact ttttctatgg ttttatttgc aagtgttcca ttaattttac | |
12965 3781 tagctacagt tagattataa agagtctaaa atgtaaaagg acactgtcaa ggttgggtta | |
12966 3841 atattttaga ttctgacagt gtcgctattc ccagctcatt tgaatcagtt cagctttttt | |
12967 3901 ttctgtggat gaacccaagc tgtgatgctc aaatacgcat tttgaactct gaagaacaag | |
12968 3961 gttgctctgg gttggagtgg tacttcatac cagcacatga ggagtcagac aggtgctgat | |
12969 4021 tcagaatcca gctcctctta a | |
12970 // | |
12971 | |
12972 LOCUS NM_001167726 3766 bp mRNA linear VRT 04-JAN-2017 | |
12973 DEFINITION Gallus gallus REL proto-oncogene, NF-kB subunit (REL), mRNA. | |
12974 ACCESSION NM_001167726 XM_419277 | |
12975 VERSION NM_001167726.1 | |
12976 KEYWORDS RefSeq. | |
12977 SOURCE Gallus gallus (chicken) | |
12978 ORGANISM Gallus gallus | |
12979 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
12980 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
12981 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
12982 Phasianidae; Phasianinae; Gallus. | |
12983 REFERENCE 1 (bases 1 to 3766) | |
12984 AUTHORS Gupta N, Delrow J, Drawid A, Sengupta AM, Fan G and Gelinas C. | |
12985 TITLE Repression of B-cell linker (BLNK) and B-cell adaptor for | |
12986 phosphoinositide 3-kinase (BCAP) is important for lymphocyte | |
12987 transformation by rel proteins | |
12988 JOURNAL Cancer Res. 68 (3), 808-814 (2008) | |
12989 PUBMED 18245482 | |
12990 REFERENCE 2 (bases 1 to 3766) | |
12991 AUTHORS Agudo D, Gomez-Esquer F, Diaz-Gil G, Martinez-Arribas F, Delcan J, | |
12992 Schneider J, Palomar MA and Linares R. | |
12993 TITLE Proteomic analysis of the Gallus gallus embryo at stage-29 of | |
12994 development | |
12995 JOURNAL Proteomics 5 (18), 4946-4957 (2005) | |
12996 PUBMED 16287166 | |
12997 REMARK Erratum:[Proteomics. 2006 Apr;6(7):2326. Agudo Garcillan, David | |
12998 [corrected to Agudo, David]] | |
12999 REFERENCE 3 (bases 1 to 3766) | |
13000 AUTHORS Phelps CB and Ghosh G. | |
13001 TITLE Discreet mutations from c-Rel to v-Rel alter kappaB DNA | |
13002 recognition, IkappaBalpha binding, and dimerization: implications | |
13003 for v-Rel oncogenicity | |
13004 JOURNAL Oncogene 23 (6), 1229-1238 (2004) | |
13005 PUBMED 14961076 | |
13006 REMARK GeneRIF: Alterations between v-Rel and c-Rel locate within the Rel | |
13007 homology region (RHR) of the family that might confer functional | |
13008 differences. | |
13009 REFERENCE 4 (bases 1 to 3766) | |
13010 AUTHORS Huang DB, Chen YQ, Ruetsche M, Phelps CB and Ghosh G. | |
13011 TITLE X-ray crystal structure of proto-oncogene product c-Rel bound to | |
13012 the CD28 response element of IL-2 | |
13013 JOURNAL Structure 9 (8), 669-678 (2001) | |
13014 PUBMED 11587641 | |
13015 REFERENCE 5 (bases 1 to 3766) | |
13016 AUTHORS You M, Ku PT, Hrdlickova R and Bose HR Jr. | |
13017 TITLE ch-IAP1, a member of the inhibitor-of-apoptosis protein family, is | |
13018 a mediator of the antiapoptotic activity of the v-Rel oncoprotein | |
13019 JOURNAL Mol. Cell. Biol. 17 (12), 7328-7341 (1997) | |
13020 PUBMED 9372964 | |
13021 REFERENCE 6 (bases 1 to 3766) | |
13022 AUTHORS Kabrun N, Bumstead N, Hayman MJ and Enrietto PJ. | |
13023 TITLE Characterization of a novel promoter insertion in the c-rel locus | |
13024 JOURNAL Mol. Cell. Biol. 10 (9), 4788-4794 (1990) | |
13025 PUBMED 2167440 | |
13026 REFERENCE 7 (bases 1 to 3766) | |
13027 AUTHORS Capobianco AJ, Simmons DL and Gilmore TD. | |
13028 TITLE Cloning and expression of a chicken c-rel cDNA: unlike p59v-rel, | |
13029 p68c-rel is a cytoplasmic protein in chicken embryo fibroblasts | |
13030 JOURNAL Oncogene 5 (3), 257-265 (1990) | |
13031 PUBMED 2179815 | |
13032 REFERENCE 8 (bases 1 to 3766) | |
13033 AUTHORS Hannink M and Temin HM. | |
13034 TITLE Transactivation of gene expression by nuclear and cytoplasmic rel | |
13035 proteins | |
13036 JOURNAL Mol. Cell. Biol. 9 (10), 4323-4336 (1989) | |
13037 PUBMED 2555689 | |
13038 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
13039 preliminary review. The reference sequence was derived from | |
13040 AJ445799.1, M26381.1 and AADN04000360.1. | |
13041 On Nov 18, 2009 this sequence version replaced gi:118087506. | |
13042 | |
13043 Sequence Note: This RefSeq record was created from transcript and | |
13044 genomic sequence data to make the sequence consistent with the | |
13045 reference genome assembly. The genomic coordinates used for the | |
13046 transcript record were based on transcript alignments. | |
13047 | |
13048 ##Evidence-Data-START## | |
13049 RNAseq introns :: single sample supports all introns SAMEA2201357, | |
13050 SAMEA2201361 [ECO:0000348] | |
13051 ##Evidence-Data-END## | |
13052 COMPLETENESS: complete on the 3' end. | |
13053 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
13054 1-687 AJ445799.1 2-688 | |
13055 688-1059 M26381.1 567-938 | |
13056 1060-1062 AADN04000360.1 406936-406938 c | |
13057 1063-1340 M26381.1 942-1219 | |
13058 1341-3766 AADN04000360.1 403578-406003 c | |
13059 FEATURES Location/Qualifiers | |
13060 source 1..3766 | |
13061 /organism="Gallus gallus" | |
13062 /mol_type="mRNA" | |
13063 /db_xref="taxon:9031" | |
13064 /chromosome="3" | |
13065 /map="3" | |
13066 gene 1..3766 | |
13067 /gene="REL" | |
13068 /gene_synonym="p68-c-rel" | |
13069 /note="REL proto-oncogene, NF-kB subunit" | |
13070 /db_xref="CGNC:5934" | |
13071 /db_xref="GeneID:396500" | |
13072 CDS 113..1909 | |
13073 /gene="REL" | |
13074 /gene_synonym="p68-c-rel" | |
13075 /note="C-Rel proto-oncogene protein; C-Rel protein; p68; | |
13076 v-rel avian reticuloendotheliosis viral oncogene homolog" | |
13077 /codon_start=1 | |
13078 /product="proto-oncogene c-Rel" | |
13079 /protein_id="NP_001161198.1" | |
13080 /db_xref="CGNC:5934" | |
13081 /db_xref="GeneID:396500" | |
13082 /translation="MAGISEPYIEIFEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNK | |
13083 TFPSIQILNYFGKVKIRTTLVTKNEPYKPHPHDLVGKDCRDGYYEAEFGPERRVLSFQ | |
13084 NLGIQCVKKKDLKESISLRISKKINPFNVPEEQLHNIDEYDLNVVRLCFQAFLPDEHG | |
13085 NYTLALPPLISNPIYDNRAPNTAELRICRVNKNCGSVKGGDEIFLLCDKVQKDDIEVR | |
13086 FVLDNWEAKGSFSQADVHRQVAIVFRTPPFLRDITEPITVKMQLRRPSDQEVSEPMDF | |
13087 RYLPDEKDPYGNKAKRQRSTLAWQKLIQDCGSAVTERPKAVPIPTVNPEGKLIKKEPN | |
13088 MFSPTLMLPGLGTLTSSSQMYPPCSQMPHQPAQLGPGKQDTLPSCWQQLFSSSPSASS | |
13089 LLSMHPHNSFTAEVPQPSAQGSSSLPAFHDNPLNWPDEKDSSFYRNFGSTNGMGAAMV | |
13090 SAADMQSASSNSIVHATHQASATAASIVNMETNDMNCTSLNFEKYTQVLNVSNHRQQL | |
13091 HQAPAACPPVAAPGSTPFSSQPNLADTAVYNSFLDQEVISDSRLSTNPLQNHQNSLTL | |
13092 TDNQFYDTDGVHTDELYQSFQLDTNILQSYNH" | |
13093 misc_feature 908..910 | |
13094 /gene="REL" | |
13095 /gene_synonym="p68-c-rel" | |
13096 /experiment="experimental evidence, no additional details | |
13097 recorded" | |
13098 /note="Phosphoserine, by PKA. {ECO:0000255}; propagated | |
13099 from UniProtKB/Swiss-Prot (P16236.2); phosphorylation | |
13100 site" | |
13101 misc_feature 977..994 | |
13102 /gene="REL" | |
13103 /gene_synonym="p68-c-rel" | |
13104 /experiment="experimental evidence, no additional details | |
13105 recorded" | |
13106 /note="propagated from UniProtKB/Swiss-Prot (P16236.2); | |
13107 Region: Nuclear localization signal. {ECO:0000255}" | |
13108 ORIGIN | |
13109 1 gagtagggtg gtgagcgggt ggagaggcag ggttgagccc gtttgtgcga ggtgcgggcc | |
13110 61 cggagggcag tccgcggcgg cagggcccga gcagcgacgc ggagctgtca gcatggcggg | |
13111 121 tatctcagag ccctacattg aaatatttga acaacccagg caaaggggca tgcgtttcag | |
13112 181 atacaaatgt gaaggaagat cagcaggtag cattccagga gaacacagta ctgacaacaa | |
13113 241 caagacattc ccatctatac agattctgaa ctattttgga aaagtcaaaa taagaactac | |
13114 301 attggtaaca aagaatgaac cctacaagcc acaccctcat gatctagttg gaaaagactg | |
13115 361 cagagatggc tactatgaag cagagtttgg gcctgaacgt cgagtcctgt cttttcagaa | |
13116 421 tttgggaatt caatgtgtga agaagaaaga cctgaaagaa tcaatttctt tgcgaatctc | |
13117 481 aaagaagatc aaccccttta atgtgcctga agaacagctg cacaacatcg atgaatatga | |
13118 541 tctcaacgtt gtccgcctct gtttccaagc tttcctccct gatgaacatg gcaactacac | |
13119 601 attagctctt cctcctttga tttccaaccc aatctatgac aacagagctc ccaacacagc | |
13120 661 agaactgaga atttgccgtg tgaataagaa ctgtggaagt gtaaagggag gagatgaaat | |
13121 721 ttttcttctg tgtgataaag ttcaaaaaga tgacatagaa gtcagatttg tcttggacaa | |
13122 781 ctgggaggca aaaggctcct tctcccaagc tgatgttcat cgccaggttg caattgtgtt | |
13123 841 cagaacaccg ccattcctca gagacatcac agaacccatc acggtgaaga tgcagttacg | |
13124 901 aagaccttca gaccaggaag tcagtgaacc aatggatttc agatacctac cagatgaaaa | |
13125 961 ggatccatat ggtaacaaag caaaaaggca aagatcaacg ctggcctggc aaaagctcat | |
13126 1021 acaggactgt ggatcagctg tgacagagag gccaaaagca gttccaatcc ccactgtcaa | |
13127 1081 ccctgaagga aagctgatta agaaagaacc aaatatgttt tcacctacac tgatgctgcc | |
13128 1141 tgggctagga acgctgacga gctccagcca gatgtaccct ccatgcagcc agatgcccca | |
13129 1201 ccagcctgcg cagcttggcc ctggaaagca ggacacactc ccttcctgct ggcagcagct | |
13130 1261 gttcagctcc tccccttcag ccagcagcct gctcagcatg cacccgcaca acagcttcac | |
13131 1321 agcagaagtg cctcagccca gtgctcaggg cagtagctct ctcccagctt tccacgataa | |
13132 1381 cccactgaac tggcctgatg agaaggattc cagtttttac aggaattttg gcagcacaaa | |
13133 1441 tgggatggga gcagcgatgg tgtcagctgc ggatatgcag agtgcttcca gtaacagcat | |
13134 1501 cgtccatgcc actcatcagg ccagtgccac tgctgcgagc atcgtgaaca tggagaccaa | |
13135 1561 tgacatgaac tgcactagtc tcaactttga aaagtatact caggtgttaa atgtaagcaa | |
13136 1621 ccacaggcag cagctccatc aggcacctgc agcatgtcca cctgtggcag cccctggcag | |
13137 1681 cactcccttc agttcacaac caaatttagc tgatacagca gtttacaaca gctttctaga | |
13138 1741 ccaagaagtt ataagtgatt caagactatc aaccaaccct ctccagaacc atcagaacag | |
13139 1801 ccttaccctt acagataacc agttctatga caccgatggt gtccacactg atgagctcta | |
13140 1861 tcagtctttc cagttagata caaacatatt acaaagctat aaccattgag ccggcactag | |
13141 1921 gctgaggtag gcacacagag ctttacgaag gagtaactca cccttctgct ttctctttca | |
13142 1981 gaatgctact gtgtaaatct cacggtgtaa cttaaagttt tttatatata tatatatatc | |
13143 2041 cgtcagcccc caaactgttg cccttgaaga agcatttgag gtgttgtacc ttcaaagctc | |
13144 2101 ttaaacattt ttatggtgtt ggaaaaagga attacttaaa gcattgggaa gaaaagctgg | |
13145 2161 tatcttcaga agggtcaaat tttcaataat tcacagggtt aatactgttt ggaaataaaa | |
13146 2221 cattttgcta tggaaattaa attaacattt caaaaggaca aactaggaaa aaactgcatg | |
13147 2281 tgggcactct agttcagact cacctaacat ttatgtttta ttcaacttgc ttgaaagatt | |
13148 2341 taggtttctt accctctttc gcataaaata tttttctcct aaaacaaaat catgcattga | |
13149 2401 tttttttttt ctatatttca ccgcattcca tttgctttca aggcaaattt actctaaaga | |
13150 2461 aatttaatga ctatgtcatt gttagatatg ttttaaagac cggaaggttt gagtttttaa | |
13151 2521 atagtccagc tctcttgtaa atgcatcact gcacaaaaga atgagcagaa agtaaggact | |
13152 2581 tctctgcact tcatcccaag tgcactattt taaatgataa aaccctgttg ctttaggaat | |
13153 2641 ggagcatgct gttatttctc tggaatttgt tttttttctt tgtgtgtgtg tgtgtgtgtg | |
13154 2701 tgtgtagcca tgatgtgcat tttattttga actgcagaaa tgtattgagc cgaagcacct | |
13155 2761 acctggtcct tcctcagatg gcccagcagt ttcctgctat gcaagtgact gctgaagggc | |
13156 2821 tcaggtctgg ctccctagca cccctcacag gaggaggtga aatgcagccc actcccagtg | |
13157 2881 cgttgtatga acagtgtgag gctgttccaa tcagtgtcaa ttaaaaacag cctccagtcc | |
13158 2941 gcggtatcaa gaaccagaac ttcctctctt ctgctagctt cccagtctcc actctgaggc | |
13159 3001 ctgaggtgtg agatgtccag tgacacctcg cataggtatc tggctaggta aggcactcaa | |
13160 3061 gtctgcatta tagggctttg ctattttatt actaatgtac gaagcaacac agcaagaaac | |
13161 3121 atactggtgt atttatttat acagctggtt attgtggcag ataaggctta agaaccttat | |
13162 3181 ttttactgtc tggctatcta aaaatgcacc ctggaaaaaa gcaataaata gcacacttgg | |
13163 3241 atacataggg aacagaaacc gcaaccacaa gacaaaaagc cacttgagat gtacagtcat | |
13164 3301 ataccagata gaaaggaact ccaaaaacct ccgtggttta agggaaagca gtaattactc | |
13165 3361 aaatgcagta attcactgca tgcagagcaa tgaggtgctg cagctgtaat gcattatatc | |
13166 3421 aattacacgg gtctgacaga atgggctctt ccacactgta caaatgaagt caggaaaact | |
13167 3481 gttccctgta accccatgta cccaactcca cacagcagtt tttcctcact tctgcagcac | |
13168 3541 acctttccag aagcatgaaa gagatacaga gaacgcttgc aatgtgtcgt ttattcagtt | |
13169 3601 cttcctttta agttctcaat gtttaagttt attgaatgta aacattttct ttatagaagg | |
13170 3661 ctctttatag cacaatttgt ttttacagta taattaaata ttttcaaaat tctgtttttc | |
13171 3721 tttgtaaaca agttggtttg gtaattaaag aactggttat actgaa | |
13172 // | |
13173 | |
13174 LOCUS NM_001167759 2041 bp mRNA linear VRT 04-JAN-2017 | |
13175 DEFINITION Gallus gallus RAD52 homolog, DNA repair protein (RAD52), transcript | |
13176 variant 1, mRNA. | |
13177 ACCESSION NM_001167759 XM_416383 | |
13178 VERSION NM_001167759.1 | |
13179 KEYWORDS RefSeq. | |
13180 SOURCE Gallus gallus (chicken) | |
13181 ORGANISM Gallus gallus | |
13182 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
13183 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
13184 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
13185 Phasianidae; Phasianinae; Gallus. | |
13186 REFERENCE 1 (bases 1 to 2041) | |
13187 AUTHORS Froman DP, Kirby JD and Rhoads DD. | |
13188 TITLE An expressed sequence tag analysis of the chicken reproductive | |
13189 tract transcriptome | |
13190 JOURNAL Poult. Sci. 85 (8), 1438-1441 (2006) | |
13191 PUBMED 16903475 | |
13192 REFERENCE 2 (bases 1 to 2041) | |
13193 AUTHORS Adachi N, Iiizumi S and Koyama H. | |
13194 TITLE Evidence for a role of vertebrate Rad52 in the repair of | |
13195 topoisomerase II-mediated DNA damage | |
13196 JOURNAL DNA Cell Biol. 24 (6), 388-393 (2005) | |
13197 PUBMED 15941391 | |
13198 REMARK GeneRIF: Chicken cells lacking Rad52 do exhibit increased | |
13199 sensitivity to the topoisomerase II inhibitor VP-16, demonstrating | |
13200 a major DNA repair defect associated with loss of Rad52 in | |
13201 vertebrate cells. | |
13202 REFERENCE 3 (bases 1 to 2041) | |
13203 AUTHORS Bezzubova OY, Schmidt H, Ostermann K, Heyer WD and Buerstedde JM. | |
13204 TITLE Identification of a chicken RAD52 homologue suggests conservation | |
13205 of the RAD52 recombination pathway throughout the evolution of | |
13206 higher eukaryotes | |
13207 JOURNAL Nucleic Acids Res. 21 (25), 5945-5949 (1993) | |
13208 PUBMED 8290357 | |
13209 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
13210 preliminary review. The reference sequence was derived from | |
13211 DT655931.1, AADN04000024.1, BX929422.1 and U01047.1. | |
13212 On Nov 18, 2009 this sequence version replaced gi:118082976. | |
13213 | |
13214 Transcript Variant: This variant (1) represents the longer | |
13215 transcript and encodes the longer isoform (1). | |
13216 | |
13217 Sequence Note: This RefSeq record was created from transcript and | |
13218 genomic sequence data to make the sequence consistent with the | |
13219 reference genome assembly. The genomic coordinates used for the | |
13220 transcript record were based on transcript alignments. | |
13221 | |
13222 ##Evidence-Data-START## | |
13223 CDS exon combination :: U01047.1 [ECO:0000331] | |
13224 RNAseq introns :: mixed/partial sample support SAMEA2201357, | |
13225 SAMEA2201358 [ECO:0000350] | |
13226 ##Evidence-Data-END## | |
13227 COMPLETENESS: complete on the 3' end. | |
13228 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
13229 1-101 DT655931.1 17-117 | |
13230 102-102 AADN04000024.1 1801317-1801317 | |
13231 103-423 DT655931.1 119-439 | |
13232 424-632 BX929422.1 460-668 | |
13233 633-727 AADN04000024.1 1806972-1807066 | |
13234 728-1610 U01047.1 738-1620 | |
13235 1611-2041 AADN04000024.1 1809810-1810240 | |
13236 FEATURES Location/Qualifiers | |
13237 source 1..2041 | |
13238 /organism="Gallus gallus" | |
13239 /mol_type="mRNA" | |
13240 /db_xref="taxon:9031" | |
13241 /chromosome="1" | |
13242 /map="1" | |
13243 /breed="Leghorn" | |
13244 gene 1..2041 | |
13245 /gene="RAD52" | |
13246 /note="RAD52 homolog, DNA repair protein" | |
13247 /db_xref="CGNC:9834" | |
13248 /db_xref="GeneID:418152" | |
13249 CDS 22..1290 | |
13250 /gene="RAD52" | |
13251 /note="isoform 1 is encoded by transcript variant 1; DNA | |
13252 repair protein RAD52 homolog" | |
13253 /codon_start=1 | |
13254 /product="DNA repair protein RAD52 homolog isoform 1" | |
13255 /protein_id="NP_001161231.1" | |
13256 /db_xref="CGNC:9834" | |
13257 /db_xref="GeneID:418152" | |
13258 /translation="MPERQGKDSESHVSSSCTSTSNSVACFGQYQYTANEYQAIQHAL | |
13259 RQKLGPEYISSRQAGGGQKVCYIEGHKVISLANEMFGFNGWAHSVTQQNVDFVDLNNG | |
13260 RFYVGVCAFVKVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALKCFG | |
13261 NALGNCILDKDYLQAVNKLPRQMPPELDLVKTKRQDYEPEIEKARYDGCLERQNPGWR | |
13262 QQCETAPTCKPTHTEASGVTEDQKQPSSSGNTDSPAVECDATYQRKLRQKQLQQQFWE | |
13263 QMEKRRQVKEVTPSSKQATANPPVKHSTPAAVQQELAIEEEFFADDLELWDISLETTD | |
13264 LNKLMCHKAAGSPAAQQPPETPHRRHQMTTRNRTPQRMHYHKPPVRFAQLQPSAALTS | |
13265 NSHGANQRTPAEHSPYRRSQSWKKRRLEPT" | |
13266 ORIGIN | |
13267 1 cggcccggcc tgacccaggg gatgcctgaa aggcaaggga aggacagtga aagccatgtc | |
13268 61 agcagcagct gtaccagcac cagcaactca gttgcttgct ttggacagta tcaatataca | |
13269 121 gcaaatgaat atcaagccat ccagcatgct cttcgtcaga aactgggtcc agagtatatc | |
13270 181 agcagtcggc aagctggggg aggacaaaag gtctgttaca ttgagggtca caaggtaatc | |
13271 241 agtctggcca atgagatgtt tggcttcaat ggctgggctc attcagtcac tcaacagaat | |
13272 301 gttgactttg ttgatctcaa caacggcagg ttctatgtgg gggtctgtgc attcgtgaaa | |
13273 361 gtgcagctta aggacggctc ataccatgaa gatgtgggct atggagtcag tgaaggcttg | |
13274 421 aagtccaagg ccttgtcctt agaaaaggca agaaaggagg cagtaacaga tggactgaag | |
13275 481 agggcgctca agtgctttgg gaatgctctt gggaactgca tcctagacaa agactaccta | |
13276 541 caagcagtta ataagcttcc acgtcagatg ccccctgagt tagatctggt gaaaactaaa | |
13277 601 agacaggact atgagcctga aatagagaaa gcaaggtacg acggctgttt ggaaaggcag | |
13278 661 aacccaggat ggagacaaca gtgtgaaacg gcaccaactt gtaagcccac tcacacagag | |
13279 721 gcttccggag tgacagaaga tcagaagcag ccaagcagtt ctggaaatac agattcccca | |
13280 781 gctgttgagt gtgatgccac gtatcagcgg aaactgcgac aaaagcagct gcagcaacag | |
13281 841 ttctgggaac agatggaaaa gagacgtcag gttaaggaag ttactcccag cagcaaacag | |
13282 901 gcaacagcca atcctcctgt aaaacacagc actccggcag cagtacagca ggaactggca | |
13283 961 atagaagaag agttctttgc agatgatctt gaactctggg acatttcctt ggagaccacc | |
13284 1021 gaccttaaca agttgatgtg tcacaaagca gcaggctcac cagcagcaca gcagcccccc | |
13285 1081 gagacgcccc acagacgtca ccagatgaca actcgtaaca ggacgcctca gagaatgcat | |
13286 1141 tatcacaaac cgcctgtgag gtttgcacag ttgcagccat ctgctgctct cacaagcaac | |
13287 1201 agccacggtg ccaaccaacg cacaccagca gagcacagcc cttacaggag aagtcaaagc | |
13288 1261 tggaagaagc ggaggctaga acccacatag gacacgtggt ggcatcatta cctacatgct | |
13289 1321 ggattacatc ataagactgc agttggctgc tcaaagtacg tgaggaagct tcatctatta | |
13290 1381 atagattgtc ctaaagcaac acagaatagc cagagagaca cagccagcaa gaacttcatg | |
13291 1441 tgctttgggt ttattacata gtccagattt ttttttctat aaacacacaa tcatttgtgc | |
13292 1501 tcctgcacaa ctcgtggctg ttttacaaat aatttgcctg agaattgtag cataagtaaa | |
13293 1561 ccttcaaatg agatgccata gcttcttccc tgctcagtgt tgcatttagg cgtacagaaa | |
13294 1621 agtttttttc caataaaacg aggacagggt gggctgtggc cccaggaaag cacactgacc | |
13295 1681 gcagtctccc attccctcgg gccgtttgca gctgtggcag cctctgcctc acatgcagca | |
13296 1741 cggctgcctg cccagaggct gcacaagcag gggcagagca ttgccctgac acggctctgc | |
13297 1801 ctcacctcaa ccctcaagca cgcggcattc ccagcagcag cagcagcaca tccacctgtg | |
13298 1861 cccacgcagc acggggtcag gaacacgcgg ggactgctat tgaggggtac atacagcatc | |
13299 1921 taagtgctgg tttggacctt ttgtgaaatg aatgagagct gcaatcttat acttttagtg | |
13300 1981 ttttaaatca gcttttactc ctttttaaca caagaataaa cactaaatgt ggacagacaa | |
13301 2041 a | |
13302 // | |
13303 | |
13304 LOCUS NM_001167758 2038 bp mRNA linear VRT 04-JAN-2017 | |
13305 DEFINITION Gallus gallus RAD52 homolog, DNA repair protein (RAD52), transcript | |
13306 variant 2, mRNA. | |
13307 ACCESSION NM_001167758 | |
13308 VERSION NM_001167758.1 | |
13309 KEYWORDS RefSeq. | |
13310 SOURCE Gallus gallus (chicken) | |
13311 ORGANISM Gallus gallus | |
13312 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
13313 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
13314 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
13315 Phasianidae; Phasianinae; Gallus. | |
13316 REFERENCE 1 (bases 1 to 2038) | |
13317 AUTHORS Froman DP, Kirby JD and Rhoads DD. | |
13318 TITLE An expressed sequence tag analysis of the chicken reproductive | |
13319 tract transcriptome | |
13320 JOURNAL Poult. Sci. 85 (8), 1438-1441 (2006) | |
13321 PUBMED 16903475 | |
13322 REFERENCE 2 (bases 1 to 2038) | |
13323 AUTHORS Adachi N, Iiizumi S and Koyama H. | |
13324 TITLE Evidence for a role of vertebrate Rad52 in the repair of | |
13325 topoisomerase II-mediated DNA damage | |
13326 JOURNAL DNA Cell Biol. 24 (6), 388-393 (2005) | |
13327 PUBMED 15941391 | |
13328 REMARK GeneRIF: Chicken cells lacking Rad52 do exhibit increased | |
13329 sensitivity to the topoisomerase II inhibitor VP-16, demonstrating | |
13330 a major DNA repair defect associated with loss of Rad52 in | |
13331 vertebrate cells. | |
13332 REFERENCE 3 (bases 1 to 2038) | |
13333 AUTHORS Bezzubova OY, Schmidt H, Ostermann K, Heyer WD and Buerstedde JM. | |
13334 TITLE Identification of a chicken RAD52 homologue suggests conservation | |
13335 of the RAD52 recombination pathway throughout the evolution of | |
13336 higher eukaryotes | |
13337 JOURNAL Nucleic Acids Res. 21 (25), 5945-5949 (1993) | |
13338 PUBMED 8290357 | |
13339 COMMENT VALIDATED REFSEQ: This record has undergone validation or | |
13340 preliminary review. The reference sequence was derived from | |
13341 DT655931.1, AADN04000024.1 and BX929422.1. | |
13342 | |
13343 Transcript Variant: This variant (2) uses an alternate in-frame | |
13344 splice site in the 3' coding region, compared to variant 1. This | |
13345 results in a shorter protein (isoform 2), compared to isoform 1. | |
13346 | |
13347 Sequence Note: This RefSeq record was created from transcript and | |
13348 genomic sequence data to make the sequence consistent with the | |
13349 reference genome assembly. The genomic coordinates used for the | |
13350 transcript record were based on transcript alignments. | |
13351 | |
13352 ##Evidence-Data-START## | |
13353 CDS exon combination :: BX929422.1 [ECO:0000331] | |
13354 RNAseq introns :: mixed/partial sample support SAMEA2201357, | |
13355 SAMEA2201358 [ECO:0000350] | |
13356 ##Evidence-Data-END## | |
13357 COMPLETENESS: complete on the 3' end. | |
13358 PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP | |
13359 1-101 DT655931.1 17-117 | |
13360 102-102 AADN04000024.1 1801317-1801317 | |
13361 103-423 DT655931.1 119-439 | |
13362 424-632 BX929422.1 460-668 | |
13363 633-633 AADN04000024.1 1806972-1806972 | |
13364 634-1607 BX929422.1 670-1643 | |
13365 1608-2038 AADN04000024.1 1809810-1810240 | |
13366 FEATURES Location/Qualifiers | |
13367 source 1..2038 | |
13368 /organism="Gallus gallus" | |
13369 /mol_type="mRNA" | |
13370 /db_xref="taxon:9031" | |
13371 /chromosome="1" | |
13372 /map="1" | |
13373 /breed="Leghorn" | |
13374 gene 1..2038 | |
13375 /gene="RAD52" | |
13376 /note="RAD52 homolog, DNA repair protein" | |
13377 /db_xref="CGNC:9834" | |
13378 /db_xref="GeneID:418152" | |
13379 CDS 22..1287 | |
13380 /gene="RAD52" | |
13381 /note="isoform 2 is encoded by transcript variant 2; DNA | |
13382 repair protein RAD52 homolog" | |
13383 /codon_start=1 | |
13384 /product="DNA repair protein RAD52 homolog isoform 2" | |
13385 /protein_id="NP_001161230.1" | |
13386 /db_xref="CGNC:9834" | |
13387 /db_xref="GeneID:418152" | |
13388 /translation="MPERQGKDSESHVSSSCTSTSNSVACFGQYQYTANEYQAIQHAL | |
13389 RQKLGPEYISSRQAGGGQKVCYIEGHKVISLANEMFGFNGWAHSVTQQNVDFVDLNNG | |
13390 RFYVGVCAFVKVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALKCFG | |
13391 NALGNCILDKDYLQAVNKLPRQMPPELDLVKTKRQDYEPEIEKARYDGCLERQNPGWR | |
13392 QQCETAPTCKPTHTEASGVTEDQKQPSSSGNTDSPAVECDATYQRKLRQKQLQQQFWE | |
13393 QMEKRRQVKEVTPSSKQATANPPVKHSTPAAVQQELAIEEEFFADDLELWDISLETTD | |
13394 LNKLMCHKAAGSPAAQQPPETPHRRHQMTTRNRTPQRMHYHKPPVRFAQLQPSAALTS | |
13395 NSHGANQRTPEHSPYRRSQSWKKRRLEPT" | |
13396 ORIGIN | |
13397 1 cggcccggcc tgacccaggg gatgcctgaa aggcaaggga aggacagtga aagccatgtc | |
13398 61 agcagcagct gtaccagcac cagcaactca gttgcttgct ttggacagta tcaatataca | |
13399 121 gcaaatgaat atcaagccat ccagcatgct cttcgtcaga aactgggtcc agagtatatc | |
13400 181 agcagtcggc aagctggggg aggacaaaag gtctgttaca ttgagggtca caaggtaatc | |
13401 241 agtctggcca atgagatgtt tggcttcaat ggctgggctc attcagtcac tcaacagaat | |
13402 301 gttgactttg ttgatctcaa caacggcagg ttctatgtgg gggtctgtgc attcgtgaaa | |
13403 361 gtgcagctta aggacggctc ataccatgaa gatgtgggct atggagtcag tgaaggcttg | |
13404 421 aagtccaagg ccttgtcctt agaaaaggca agaaaggagg cagtaacaga tggactgaag | |
13405 481 agggcgctca agtgctttgg gaatgctctt gggaactgca tcctagacaa agactaccta | |
13406 541 caagcagtta ataagcttcc acgtcagatg ccccctgagt tagatctggt gaaaactaaa | |
13407 601 agacaggact atgagcctga aatagagaaa gcaaggtacg acggctgttt ggaaaggcag | |
13408 661 aacccaggat ggagacaaca gtgtgaaacg gcaccaactt gtaagcccac tcacacagag | |
13409 721 gcttccggag tgacagaaga tcagaagcag ccaagcagtt ctggaaatac agattcccca | |
13410 781 gctgttgagt gtgatgccac gtatcagcgg aaactgcgac aaaagcagct gcagcaacag | |
13411 841 ttctgggaac agatggaaaa gagacgtcag gttaaggaag ttactcccag cagcaaacag | |
13412 901 gcaacagcca atcctcctgt aaaacacagc actccggcag cagtacagca ggaactggca | |
13413 961 atagaagaag agttctttgc agatgatctt gaactctggg acatttcctt ggagaccacc | |
13414 1021 gaccttaaca agttgatgtg tcacaaagca gcaggctcac cagcagcaca gcagcccccc | |
13415 1081 gagacgcccc acagacgtca ccagatgaca actcgtaaca ggacgcctca gagaatgcat | |
13416 1141 tatcacaaac cgcctgtgag gtttgcacag ttgcagccat ctgctgctct cacaagcaac | |
13417 1201 agccacggtg ccaaccaacg cacaccagag cacagccctt acaggagaag tcaaagctgg | |
13418 1261 aagaagcgga ggctagaacc cacataggac acgtggtggc atcattacct acatgctgga | |
13419 1321 ttacatcata agactgcagt tggctgctca aagtacgtga ggaagcttca tctattaata | |
13420 1381 gattgtccta aagcaacaca gaatagccag agagacacag ccagcaagaa cttcatgtgc | |
13421 1441 tttgggttta ttacatagtc cagatttttt tttctataaa cacacaatca tttgtgctcc | |
13422 1501 tgcacaactc gtggctgttt tacaaataat ttgcctgaga attgtagcat aagtaaacct | |
13423 1561 tcaaatgaga tgccatagct tcttccctgc tcagtgttgc atttaggcgt acagaaaagt | |
13424 1621 ttttttccaa taaaacgagg acagggtggg ctgtggcccc aggaaagcac actgaccgca | |
13425 1681 gtctcccatt ccctcgggcc gtttgcagct gtggcagcct ctgcctcaca tgcagcacgg | |
13426 1741 ctgcctgccc agaggctgca caagcagggg cagagcattg ccctgacacg gctctgcctc | |
13427 1801 acctcaaccc tcaagcacgc ggcattccca gcagcagcag cagcacatcc acctgtgccc | |
13428 1861 acgcagcacg gggtcaggaa cacgcgggga ctgctattga ggggtacata cagcatctaa | |
13429 1921 gtgctggttt ggaccttttg tgaaatgaat gagagctgca atcttatact tttagtgttt | |
13430 1981 taaatcagct tttactcctt tttaacacaa gaataaacac taaatgtgga cagacaaa | |
13431 // | |
13432 | |
13433 LOCUS NM_001163651 1280 bp mRNA linear VRT 04-JAN-2017 | |
13434 DEFINITION Gallus gallus progestin and adipoQ receptor family member 7 | |
13435 (PAQR7), mRNA. | |
13436 ACCESSION NM_001163651 XM_423259 | |
13437 VERSION NM_001163651.1 | |
13438 KEYWORDS RefSeq. | |
13439 SOURCE Gallus gallus (chicken) | |
13440 ORGANISM Gallus gallus | |
13441 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; | |
13442 Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; | |
13443 Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; | |
13444 Phasianidae; Phasianinae; Gallus. | |
13445 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final | |
13446 NCBI review. The reference sequence was derived from GQ203624.1. | |
13447 On Jul 28, 2009 this sequence version replaced gi:118101610. | |
13448 | |
13449 ##Evidence-Data-START## | |
13450 Transcript exon combination :: GQ203624.1, BU239975.1 [ECO:0000332] | |
13451 RNAseq introns :: single sample supports all introns | |
13452 SAMEA2201368, SAMEA2201371 | |
13453 [ECO:0000348] | |
13454 ##Evidence-Data-END## | |
13455 FEATURES Location/Qualifiers | |
13456 source 1..1280 | |
13457 /organism="Gallus gallus" | |
13458 /mol_type="mRNA" | |
13459 /db_xref="taxon:9031" | |
13460 /chromosome="23" | |
13461 /map="23" | |
13462 gene 1..1280 | |
13463 /gene="PAQR7" | |
13464 /note="progestin and adipoQ receptor family member 7" | |
13465 /db_xref="CGNC:7361" | |
13466 /db_xref="GeneID:425505" | |
13467 misc_feature 138..140 | |
13468 /gene="PAQR7" | |
13469 /note="upstream in-frame stop codon" | |
13470 CDS 189..1229 | |
13471 /gene="PAQR7" | |
13472 /note="progestin and adipoQ receptor family member VII, | |
13473 membrane progestin receptor alpha variant 2; progestin and | |
13474 adipoQ receptor family member VII, membrane progestin | |
13475 receptor alpha variant 3" | |
13476 /codon_start=1 | |
13477 /product="membrane progestin receptor alpha" | |
13478 /protein_id="NP_001157123.1" | |
13479 /db_xref="CGNC:7361" | |
13480 /db_xref="GeneID:425505" | |
13481 /translation="MAAVVAEKLSRLFISVRQVPQLLAPPVPTTVSSSEVPRVFWKPY | |
13482 IHTGYRPVHQTWRYYFSTLFQQHNEAINVWTHLVATLILLLRFQQLSQRVDFGQDPHA | |
13483 QPLLIIITASITYLTFSTLAHLLQAKSEFWHYSFFFMDYVGVAIYQYGSALVHYYYAI | |
13484 EPSWHEKIQGFFMPTAALLAWLSCAGSCYAKFRYHQSAGLLGRLCQEMPSGLAYLLDI | |
13485 SPVVHRICTASPAERTDPALLYHKCQVLFFLIGAFFFSHPYPEKLLPGKCYFFGQSHQ | |
13486 IFHVFLVLCTLAQIEAVVLDYESRRHIYSSLQGDLAHHFSALCVFTVTCSVLTAAYMA | |
13487 RKVRDKLSFKED" | |
13488 ORIGIN | |
13489 1 gagactccgt cggaatcggt gctccgggga gagctccgca gcttttcctg gctgagctat | |
13490 61 acttgaagcg actgaacttg gcaggagctg gggcttaaag cagcaccgga gctgggctgg | |
13491 121 tttcttccca acttgtctga gcaagagcag gtgctttgga gcaacgagag ctgcggtgcg | |
13492 181 gctgtgccat ggcagcggtg gtggcagaga agctcagccg cctcttcatc agcgtgcgcc | |
13493 241 aggtccccca gctgctggcc cccccggtgc ccaccaccgt cagcagctcc gaggtgccga | |
13494 301 gggttttctg gaagccttac atccacaccg gctaccgccc ggtgcaccaa acctggcgct | |
13495 361 attacttctc gacgctcttc cagcaacaca acgaagccat caacgtgtgg acccacctgg | |
13496 421 tggccacgct gatcctgctg ctgcgcttcc agcagctctc ccagagggtg gattttgggc | |
13497 481 aggacccgca cgcccagccg ctcctcatca tcatcacggc atccatcacc tacctgacgt | |
13498 541 tcagcacgct cgctcacctc ctgcaggcta agtccgagtt ctggcactac agcttcttct | |
13499 601 tcatggacta cgtgggggtg gccatctacc agtatggcag tgctctggtg cactactact | |
13500 661 atgccatcga gcccagctgg cacgagaaga tccagggctt cttcatgccc acagctgcgc | |
13501 721 tgctggcctg gctgtcgtgt gcaggctcat gctacgccaa gttccgctac catcagtcag | |
13502 781 cagggctgct gggccggctg tgccaggaga tgccctcagg cctggcctac ctgctggata | |
13503 841 tcagccctgt tgtgcaccgc atctgcaccg catcacctgc ggagcgcaca gatccggccc | |
13504 901 tgctgtacca caagtgccag gtgctgttct tcctcatcgg tgcctttttt ttctcccatc | |
13505 961 cttacccaga gaagttgctt cccgggaaat gctacttctt tgggcaaagc catcagatct | |
13506 1021 tccatgtctt cctggtgctt tgcactctgg cacagatcga ggccgtggtg ctggactatg | |
13507 1081 agtccaggcg gcacatctac tcctcgctgc agggtgacct ggcgcaccac ttctctgccc | |
13508 1141 tgtgtgtctt cactgtgacc tgctccgtgc tcacggctgc atacatggca cggaaggtga | |
13509 1201 gggacaaact gagcttcaaa gaagattgag atttggggca gagtggggga taccatggcc | |
13510 1261 aaagctgcat gctccaagga | |
13511 // | |
13512 |