Mercurial > repos > bioinformatics_lab_ufsc > epibuilder
changeset 0:ef26009cd70a draft
Uploaded version 1.1
line wrap: on
line diff
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/epibuilder-1.1.xml Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,586 @@ +<tool id="epibuilder_1.1" name="EpiBuilder" version="1.1"> + <description>Predict B cell epitopes</description> + <requirements> + <requirement type="package" version=">=1.8">Java</requirement> + <requirement type="package" version=">=2.11.0+">Blastp</requirement> + <requirement type="package" version=">=2.11.0+">Makeblastdb</requirement> + </requirements> + <stdio> + <regex match="command not found" + source="both" + level="log" + description="WARNING: some methods could not be applied -> check inputs and outputs files" /> + <regex match="makeblastdb " + source="both" + level="log" + description="makeblastdb and blastp must be in $PATH on your Galaxy server" /> + <regex match="blastp " + source="both" + level="log" + description="makeblastdb and blastp must be in $PATH on your Galaxy server" /> + </stdio> + <command><![CDATA[ + #*<!-- + Methods used will be saved in $param with each threshold + Threshold is separated from method by ":" + Each method is separated by ";" + example: emini:0.8;parker:d; + + >> d means defalt threshold + -->*# + + #*<!-- Set variables that concatenate methods -->*# + #set param = '' + #set nomethod = '' + #set proteomes = '' + + #*<!-- Add Bepipred2.0 method -->*# + #if $bepi_type.bepipred_origin == 'y': + #set bepipred_origin = '-o' + #*<!-- jobid -->*# + #elif $bepi_type.bepipred_origin == 'id': + #set bepipred_origin = '-jobid ' + str($bepi_type.job_id) + #else: + #set bepipred_origin = '' + #end if + + #*<!-- Add Emini method -->*# + #if $emini_method.emini_choice == 'eminiyes': + #if $emini_method.emini_t.t_emini == 't_emini_choice' + #set param += 'emini:' + str($emini_method.emini_t.thresh_em_value) + ';' + #else: + #set param += 'emini:d;' + #end if + #end if + + #*<!-- Add Parker method -->*# + #if $parker_method.parker_choice == 'parkeryes': + #if $parker_method.parker_t.t_parker == 't_parker_choice' + #set param += 'parker:' + str($parker_method.parker_t.thresh_park_value) + ';' + #else: + #set param += 'parker:d;' + #end if + #end if + + #*<!-- Add Chou method -->*# + #if $chou_method.chou_choice == 'chouyes': + #if $chou_method.chou_t.t_chou == 't_chou_choice' + #set param += 'chou_fosman:' + str($chou_method.chou_t.thresh_chou_value) + ';' + #else: + #set param += 'chou_fosman:d;' + #end if + #end if + + #*<!-- Add Karplus method -->*# + #if $karplus_method.karplus_choice == 'karplusyes': + #if $karplus_method.karplus_t.t_karplus == 't_karplus_choice' + #set param += 'karplus_schulz:' + str($karplus_method.karplus_t.thresh_karplus_value) + ';' + #else: + #set param += 'karplus_schulz:d;' + #end if + #end if + + #*<!-- Add Kolaskar method -->*# + #if $kolaskar_method.kolaskar_choice == 'kolaskaryes': + #if $kolaskar_method.kolaskar_t.t_kolaskar == 't_kolaskar_choice' + #set param += 'kolaskar:' + str($kolaskar_method.kolaskar_t.thresh_kolaskar_value) + ';' + #else: + #set param += 'kolaskar:d;' + #end if + #end if + + + + #*<!-- Clean $proteome if there's no protome -->*# + #if proteomes == '-proteomes ': + #set proteomes = '' + #end if + + + #*<!-- Parse blast command -->*# + + #if $use_search.search_use_bool == "use": + #*<!-- Add proteomes, as many as given -->*# + #if $use_search.prot_input: + #for $file in $use_search.prot_input: + #set proteomes += str($file.prot_name) + '=' + str($file.prot_file) + ';' + #end for + #end if + #if $use_search.prot_input: + #if $use_search.blast.blast_search == 'blastyes': + #set blast_command = 'task=' + str($use_search.blast.blast_task) + #set blast_command += ';identity=' + str($use_search.blast.blast_id) + ';cover=' + str($use_search.blast.blast_cover) + ';word-size=' + str($use_search.blast.blast_wordsize) + #set blast_command += ';makeblastdb_path=makeblastdb;blastp_path=blastp' + #end if + #end if + #end if + + #*<!-- Paste Command-line and run -->*# + + java -jar $__tool_directory__/epibuilder-1.1.jar + + #*<!-- bepipred_origin give -o if online, nothing if command and -jobid if jobID -->*# + #*<!-- if origin is not jobid, there is a file, and -b must be passed -->*# + #if $bepi_type.bepipred_origin != 'id': + -b ${bepi_type.bepi_out} + #end if + -t ${tresh_bepi2} + ${bepipred_origin} + #if $param: + -p "${param}" + #end if + -f "${basename}" + -min_len ${min_length} + -max_len ${max_length} + #if $proteomes: + -proteomes + "${proteomes}" + #if $use_search.blast.blast_search == 'blastyes': + -blast "${blast_command}" + #end if + #end if + + #if $use_search.check_use_hit == 'nousehit': + -nohitacc + #end if + #*<!-- DONT REMOVE THIS ; -->*# + >log.log 2>log.log; + + mv $basename-epibuilder.xlsx EpiBuilder_report.xlsx; + + #*<!-- Rename output files -->*# + mv ${basename}-epibuilder.txt EpiBuilder; + + + ]]> + </command> + <inputs> + <!-- Bepipred 2.0 --> + <conditional name="bepi_type"> + <param name="bepipred_origin" type="select" display="radio" label="Input files" help="Online prediction returns a csv file, command-line based returns a tsv file" > + <option value="y" selected="true">csv file from Bepipred 2.0</option> + <option value="n" >text file from IEDB Bcell Software standalone</option> + <option value="id">JobID from Bepipred 2.0 Server</option> + </param> + <when value="y" > + <param name="bepi_out" multiple="false" format="data" type="data" label="File" help="Epitopes predicted by Bepipred 2.0" /> + </when> + <when value="n" > + <param name="bepi_out" multiple="false" format="data" type="data" label="File" help="Epitopes predicted by Bepipred 2.0" /> + </when> + <when value="id" > + <param name="job_id" type="text" value="" label="JobID" help="Prediction must be complete - check it in: http://www.cbs.dtu.dk/cgi-bin/webface2.fcgi?jobid=YOUR_JOB_ID" > + <!-- Check if its an empty value--> + <validator type="empty_field" message="ID required"/> + </param> + </when> + </conditional> + <param name="tresh_bepi2" min="0.0" value="0.6" type="float" label="Threshold for Bepipred 2.0" help="Default = 0.6" /> + <!-- Epitope Length --> + <param name="min_length" value="10" min="1" type="integer" label="Min epitope length" help="[1-X] Minimal length must be smaller than maximal length" /> + <param name="max_length" value="30" min="2" type="integer" label="Max epitope length" help="[2-X] Maximal length must be greather than minimal length" /> + <!-- EMINI --> + <conditional name="emini_method"> + <param name="emini_choice" type="boolean" checked="true" truevalue="eminiyes" falsevalue="eminino" label="Use Emini Surface Accessibility Prediction method?" /> + <when value="eminino"> + </when> + <when value="eminiyes"> + <conditional name="emini_t"> + <param name="t_emini" display="radio" type="select" label="Threshold" help="Define threshold for Emini" > + <option value="d_emini_choice" selected="true">Default (calculated by method)</option> + <option value="t_emini_choice">Set Threshold</option> + </param> + <when value="t_emini_choice"> + <param name="thresh_em_value" value="0" type="float" label="Value" /> + </when> + <when value="d_emini_choice"> + </when> + </conditional> + </when> + </conditional> + <!-- PARKER --> + <conditional name="parker_method"> + <param name="parker_choice" type="boolean" checked="true" truevalue="parkeryes" falsevalue="parkerno" label="Use Parker Hydrophilicity Prediction method?" /> + <when value="parkerno"> + </when> + <when value="parkeryes"> + <conditional name="parker_t"> + <param name="t_parker" display="radio" type="select" label="Threshold" help="Define threshold for Parker" > + <option value="d_parker_choice" selected="true">Default (calculated by method)</option> + <option value="t_parker_choice">Set Threshold</option> + </param> + <when value="t_parker_choice"> + <param name="thresh_park_value" value="0" type="float" label="Value" /> + </when> + <when value="d_parker_choice"> + </when> + </conditional> + </when> + </conditional> + <!-- Chou --> + <conditional name="chou_method"> + <param name="chou_choice" type="boolean" checked="true" truevalue="chouyes" falsevalue="chouno" label="Use Chou & Fasman Beta-Turn Prediction method?" /> + <when value="chouno"> + </when> + <when value="chouyes"> + <conditional name="chou_t"> + <param name="t_chou" display="radio" type="select" label="Threshold" help="Define threshold for Chou & Fasman" > + <option value="d_chou_choice" selected="true">Default (calculated by method)</option> + <option value="t_chou_choice">Set Threshold</option> + </param> + <when value="t_chou_choice"> + <param name="thresh_chou_value" value="0" type="float" label="Value" /> + </when> + <when value="d_chou_choice"> + </when> + </conditional> + </when> + </conditional> + <!-- Karplus --> + <conditional name="karplus_method"> + <param name="karplus_choice" type="boolean" checked="true" truevalue="karplusyes" falsevalue="karplusno" label="Use Karplus & Schulz Flexibility Prediction method?" /> + <when value="karplusno"> + </when> + <when value="karplusyes"> + <conditional name="karplus_t"> + <param name="t_karplus" display="radio" type="select" label="Threshold" help="Define threshold for Karplus & Schulz" > + <option value="d_karplus_choice" selected="true">Default (calculated by method)</option> + <option value="t_karplus_choice">Set Threshold</option> + </param> + <when value="t_karplus_choice"> + <param name="thresh_karplus_value" type="float" value="0" label="Value" /> + </when> + <when value="d_karplus_choice"> + </when> + </conditional> + </when> + </conditional> + <!-- Kolaskar --> + <conditional name="kolaskar_method"> + <param name="kolaskar_choice" type="boolean" checked="true" truevalue="kolaskaryes" falsevalue="kolaskarno" label="Use Kolaskar & Tongaonkar Antigenicity method?" /> + <when value="kolaskarno"> + </when> + <when value="kolaskaryes"> + <conditional name="kolaskar_t"> + <param name="t_kolaskar" display="radio" type="select" label="Threshold" help="Define threshold for Kolaskar & Tongaonkar" > + <option value="d_kolaskar_choice" selected="true">Default (calculated by method)</option> + <option value="t_kolaskar_choice">Set Threshold</option> + </param> + <when value="t_kolaskar_choice"> + <param name="thresh_kolaskar_value" type="float" value="0" label="Value" /> + </when> + <when value="d_kolaskar_choice"> + </when> + </conditional> + </when> + </conditional> + <!-- Insert Proteome --> + <conditional name="use_search"> + <param name="search_use_bool" type="boolean" checked="false" truevalue="use" falsevalue="dont" label="Do you want to search the predicted epitopes in a proteome file?" /> + <when value="dont"> + </when> + <when value="use"> + <repeat name="prot_input" title="Proteome" min="1"> + <param type="data" name="prot_file" format="fasta" label="Proteome file" help="Protein sequences in fasta format" /> + <param type="text" name="prot_name" label="Proteome name" help="Give a name to this dataset" > + <!-- Change spaces for '_' --> + <sanitizer> + <valid initial="string.printable"> + <remove value=" "/> + </valid> + <mapping initial="none"> + <add source=" " target="_"/> + </mapping> + </sanitizer> + <!-- Check if its an empty value--> + <validator type="empty_field" message="Basename required"/> + </param> + </repeat> + <param name="check_use_hit" type="boolean" checked="true" truevalue="usehit" falsevalue="nousehit" label="Show accession ID on result files?" help="Choose this option if you want to add accession ID numbers" /> + <conditional name="blast"> + <param name="blast_search" type="boolean" checked="false" truevalue="blastyes" falsevalue="blastno" label="Blastp" help="Choose this option if you want to add a blast search for epitopes in proteomes" /> + <when value="blastno"> + </when> + <when value="blastyes"> + <param name="blast_id" value="90" min="1" type="integer" label="Identity" help="[0-100] Minimal identity accepted to parse blast results" /> + <param name="blast_cover" value="90" min="2" type="integer" label="Coverage" help="[0-100] Minimal coverage accepted to parse blast results" /> + <param name="blast_wordsize" value="4" min="1" type="integer" label="Word-Size" help="Blast argument word-size" /> + <param name="blast_task" type="select" label="Task" help="How blastp should run"> + <option value="blastp-short" selected="True">Blastp-short</option> + <option value="blastp-fast">Blastp-fast</option> + <option value="blastp">Blastp</option> + </param> + </when> + </conditional> + </when> + </conditional> + <param name="basename" type="text" value="" label="Basename" help="Provide a name for this run (string text without special characters)" > + <!-- Change spaces for '_' --> + <sanitizer> + <valid initial="string.printable"> + <remove value=" "/> + </valid> + <mapping initial="none"> + <add source=" " target="_"/> + </mapping> + </sanitizer> + <!-- Check if its an empty value--> + <validator type="empty_field" message="Basename required"/> + </param> + </inputs> + <outputs> + <data name="epif_out" format="txt" from_work_dir="EpiBuilder" label="EpiBuilder Output Summary - ${basename}" /> + <data name="ep_xls" format="xlsx" from_work_dir="EpiBuilder_report.xlsx" label="EpiBuilder Report - ${basename}" /> + <collection type="list" label="EpiBuilder Files - ${basename}" name="epif_collection" > + <discover_datasets format="fasta" pattern="(?P<designation>.*)\.fasta" visible="false" /> + <discover_datasets format="txt" pattern="(?P<designation>.*)\.tsv" visible="false" /> + <discover_datasets format="txt" pattern="(?P<designation>.*)\.txt" visible="false" /> + </collection> + <collection type="list" label="EpiBuilder Blast Run - ${basename}" name="blast_collection" > + <filter>use_search['search_use_bool'] is True and use_search['blast']['blast_search'] is True</filter> + <discover_datasets pattern="(?P<designation>.*)blast\.csv" visible="false" /> + </collection> + </outputs> + <tests> + <test> + <!-- Test all methods threshold selected, command line version of input with proteome--> + <conditional name="bepi_type"> + <param name="bepipred_origin" value="y"/> + <param name="bepi_out" value="input_bepi_online.csv"/> + </conditional> + <param name="tresh_bepi2" value="0.6"/> + + <param name="min_length" value="10" /> + <param name="max_length" value="30" /> + + <conditional name="emini_method"> + <param name="emini_choice" value="eminiyes"/> + <conditional name="emini_t"> + <param name="t_emini" value="t_emini_choice"/> + <param name="thresh_em_value" value="0.8" /> + </conditional> + </conditional> + + <conditional name="parker_method"> + <param name="parker_choice" value="parkeryes"/> + <conditional name="parker_t"> + <param name="t_parker" value="t_parker_choice"/> + <param name="thresh_park_value" value="0.8" /> + </conditional> + </conditional> + + <conditional name="chou_method"> + <param name="chou_choice" value="chouyes"/> + <conditional name="chou_t"> + <param name="t_chou" value="t_chou_choice"/> + <param name="thresh_chou_value" value="0.8" /> + </conditional> + </conditional> + + <conditional name="karplus_method"> + <param name="karplus_choice" value="karplusyes"/> + <conditional name="karplus_t"> + <param name="t_karplus" value="t_karplus_choice"/> + <param name="thresh_karplus_value" value="0.8" /> + </conditional> + </conditional> + + + <conditional name="kolaskar_method"> + <param name="kolaskar_choice" value="kolaskaryes"/> + <conditional name="kolaskar_t"> + <param name="t_kolaskar" value="t_kolaskar_choice"/> + <param name="thresh_kolaskar_value" value="0.8" /> + </conditional> + </conditional> + <!-- This first part test all methods--> + + <conditional name="use_search"> + <param name="search_use_bool" value="use" /> + <repeat name="prot_input"> + <param name="prot_name" value="test_proteom" /> + <param name="prot_file" value="proteom.fasta" /> + </repeat> + <conditional name="check_use_hit" value="usehit"/> + <conditional name="blast"> + <param name="blast_search" value="blastyes" /> + <param name="blast_id" value="90" /> + <param name="blast_cover" value="90" /> + <param name="blast_wordsize" value="4" /> + <param name="blast_task" value="blastp-short" /> + </conditional> + </conditional> + + <param name="basename" value="online" /> + + <output name="epif_out" file="online-EpiBuilder.txt" /> + <output name="ep_xls" file="online-EpiBuilder.xlsx" /> + <output_collection name= "epif_collection"> + <element name="ep_prot_sum" file="online-EpiBuilder-protein-summary.tsv" /> + <element name="ep_top" file="online-EpiBuilder-topology.tsv" /> + <element name="ep_score" file="online-EpiBuilder-socre.tsv" /> + <element name="ep_detail" file="online-EpiBuilder-epitope-detail.tsv" /> + <element name="ep_parameters" file="online-EpiBuilder-parameters.tsv" /> + <element name="ep_fasta" file="online-EpiBuilder-fasta.fasta" /> + </output_collection> + <output_collection name="blast_collection" > + <element name="test_proteom" file="online-test_proteom_blast.csv" ftype="csv" /> + </output_collection > + </test> + + <test> + <!-- Test all methods threshold selected, online version of input with proteome--> + <conditional name="bepi_type"> + <param name="bepipred_origin" value="y"/> + <param name="bepi_out" value="input_bcell_command_line.txt"/> + </conditional> + + <param name="bepipred_origin" value="n"/> + <param name="tresh_bepi2" value="0.6"/> + + <param name="min_length" value="10" /> + <param name="max_length" value="30" /> + + <conditional name="emini_method"> + <param name="emini_choice" value="eminiyes"/> + <conditional name="emini_t"> + <param name="t_emini" value="t_emini_choice"/> + <param name="thresh_em_value" value="0.8" /> + </conditional> + </conditional> + + <conditional name="parker_method"> + <param name="parker_choice" value="parkeryes"/> + <conditional name="parker_t"> + <param name="t_parker" value="t_parker_choice"/> + <param name="thresh_park_value" value="0.8" /> + </conditional> + </conditional> + + <conditional name="chou_method"> + <param name="chou_choice" value="chouyes"/> + <conditional name="chou_t"> + <param name="t_chou" value="t_chou_choice"/> + <param name="thresh_chou_value" value="0.8" /> + </conditional> + </conditional> + + <conditional name="karplus_method"> + <param name="karplus_choice" value="karplusyes"/> + <conditional name="karplus_t"> + <param name="t_karplus" value="t_karplus_choice"/> + <param name="thresh_karplus_value" value="0.8" /> + </conditional> + </conditional> + + + <conditional name="kolaskar_method"> + <param name="kolaskar_choice" value="kolaskaryes"/> + <conditional name="kolaskar_t"> + <param name="t_kolaskar" value="t_kolaskar_choice"/> + <param name="thresh_kolaskar_value" value="0.8" /> + </conditional> + </conditional> + <!-- This first part test all methods--> + + <conditional name="use_search"> + <param name="search_use_bool" value="use"/> + <repeat name="prot_input"> + <param name="prot_name" value="test_proteom" /> + <param name="prot_file" value="proteom.fasta" /> + </repeat> + <conditional name="check_use_hit" value="usehit"/> + <conditional name="blast"> + <param name="blast_search" value="blastyes" /> + <param name="blast_id" value="90" /> + <param name="blast_cover" value="90"/> + <param name="blast_wordsize" value="4" /> + <param name="blast_task" value="blastp-short" /> + </conditional> + </conditional> + + <param name="basename" value="command" /> + + <output name="epif_out" file="command-EpiBuilder.txt" /> + <output name="ep_xls" file="command-EpiBuilder.xlsx" /> + <output_collection name= "epif_collection"> + <element name="ep_prot_sum" file="command-EpiBuilder-protein-summary.tsv" /> + <element name="ep_top" file="command-EpiBuilder-topology.tsv" /> + <element name="ep_score" file="command-EpiBuilder-socre.tsv" /> + <element name="ep_detail" file="command-EpiBuilder-epitope-detail.tsv" /> + <element name="ep_parameters" file="command-EpiBuilder-parameters.tsv" /> + <element name="ep_fasta" file="command-EpiBuilder-fasta.fasta" /> + </output_collection> + <output_collection name="blast_collection" > + <element name="test_proteom" file="command-test_proteom_blast.csv" ftype="csv" /> + </output_collection > + </test> + </tests> + <help> +**How to Run** + +First, you must have a file with epitopes predicted by Bepipred 2.0 or have one job submmited into bepipred's server. + +.. class:: warningmark + +Input this file (or jobID) and specify if Bepipred 2.0 was ran online or command-line based through bcell standalone suite. + +Select methods that you want to check your epitopes for validation. + +Give a threshold for each method (or use default threshold). + +Optionaly, you can search validated epitopes in proteomes datasets, as many as you wish. + +.. class:: warningmark + +If you want to search using Blastp, this software and Makeblastdb must be avaliable on your server's $PATH. + +----- + +**Outputs** + + +**Summary** : Prediction overview + +**Protein Summary** : Show proteins that have epitopes predicted + +**Fasta** : Epitopes' sequences + +**Topology** : Show epitope match in each method, aminoacid per aminoacid + +**Score** : Detailed score for aminoacids + +**Epitope Detail** : Properties of each predicted epitope + +**Parameters** : Softwares, thresholds and parameters used for prediction + +**Xls Report** : Table with epitope detail, protein summary, topology and scores + +**Collection with blast files** : All blast results for each proteome + + +----- + +.. class:: infomark + +**For more information, checkout our GitHub page**: https://github.com/bioinfo-ufsc/EpiBuilder + +----- + +Please cite methods used in your analysis, available bellow + +| Bioinformatics Lab - UFSC - 2021 + +</help> +<citations> + <citation type="doi">10.1093/nar/gkx346</citation> + <citation type="doi">10.1016/0014-5793(90)80535-q</citation> + <citation type="doi">10.1002/9780470122921.ch2</citation> + <citation type="doi">10.1021/bi00367a013</citation> + <citation type="doi">https://doi.org/10.1007/BF01195768</citation> + <citation type="doi">doi:10.1128/jvi.55.3.836-839.1985</citation> + <citation type="doi">10.1371/journal.pcbi.1006791</citation> + <citation type="doi">https://doi.org/10.1093/nar/gky379</citation> +</citations> +</tool> +
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/command-epifinder-epitope-detail.tsv Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,4 @@ +N Id Epitope Start End N-Glyc N-Glyc-Count N-Glyc-Motifs Length MW(kDa) I.P Hydropathy All Matches Cover Avg Cover BepiPred2 Emini Parker Chou Fosman Karplus Schulz Kolaskar test_proteom_count test_proteom_acc test_proteom_count test_proteom_id +1 4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation PETQSSHSAW 73 83 N 0 - 10 1.13 5.25 -1.40 0.90 0.98 0.65 2.57 4.19 1.13 1.04 0.99 1 4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 1 4WFF_B(100.00,100.00) +2 4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation AIFLKWHVPPELVR 149 163 N 0 - 14 1.71 8.80 0.42 0.07 0.60 0.64 0.82 -1.83 0.83 0.96 1.10 2 4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation,4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 2 4WFF_B(100.00,100.00),4WFF_A(100.00,100.00) +3 4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation LKWHVPPELVRVLSA 150 165 N 0 - 15 1.74 8.75 0.39 0.07 0.59 0.63 0.81 -1.70 0.84 0.96 1.11 2 4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation,4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 2 4WFF_B(100.00,100.00),4WFF_A(100.00,100.00)
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/command-epifinder-epitopes-fasta.fasta Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,6 @@ +>1-PETQSSHSAW +PETQSSHSAW +>2-AIFLKWHVPPELVR +AIFLKWHVPPELVR +>3-LKWHVPPELVRVLSA +LKWHVPPELVRVLSA
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/command-epifinder-parameters.txt Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,28 @@ + +---- Running Parameters ---- +BepiPred-2.0 Threshold : 0.6 +Min epitope length : 10 +Max epitope length : 30 + +---- Softwares Threshold ---- +Emini : 0.8 +Parker : 0.8 +Chou Fosman : 0.8 +Karplus Schulz : 0.8 +Kolaskar : 0.8 + +---- Proteomes ---- +Alias File +test_proteom /usr/local/bioinfo/stingrayGalaxy/tools/stingray/epifinder/test-data/proteom.fasta + +---- Blast ---- +Identity : 90.0 +Cover : 90.0 +Word size : 4 +Task blastp-short: blastp-short + +---- Stats ---- +Processed proteins : 6 +NGlycosylated proteins : 0 +Identified epitopes : 3 +N-glycosylated epitopes: 0
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/command-epifinder-protein-summary.tsv Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,7 @@ +Id Epitopes N-Glyc +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 0 0 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 0 0 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 1 0 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 2 0 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 0 0 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 0 0
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/command-epifinder-scores.tsv Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,1141 @@ +Id Position Residue Bepipred2 Emini Parker Chou Fosman Karplus Schulz Kolaskar MW IP Hydropathy +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 1 V 0.23 0.00 0.00 0.00 0.00 0.00 117.15 5.49 4.20 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 2 R 0.27 0.00 0.00 0.00 0.00 0.00 174.20 9.75 -4.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 3 S 0.31 0.23 0.00 0.00 0.00 0.00 105.09 5.24 -0.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 4 L 0.33 0.45 1.63 1.03 0.98 1.09 131.17 5.52 3.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 5 N 0.39 0.19 0.84 1.04 0.97 1.07 132.12 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 6 C 0.40 0.28 0.84 1.04 0.96 1.07 121.15 5.52 2.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 7 T 0.41 0.56 1.34 1.04 0.96 1.05 119.12 5.19 -0.70 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 8 L 0.42 0.47 3.59 1.16 0.99 1.01 131.17 5.52 3.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 9 R 0.44 1.50 3.44 1.08 1.03 1.05 174.20 9.75 -4.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 10 D 0.45 1.80 4.10 1.05 1.07 0.99 133.10 3.80 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 11 S 0.46 4.37 4.17 1.06 1.11 0.99 105.09 5.24 -0.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 12 Q 0.45 2.99 6.41 1.18 1.12 0.96 146.15 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 13 Q 0.45 1.48 4.50 1.13 1.12 1.01 146.15 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 14 K 0.43 0.82 2.54 0.99 1.08 1.09 146.19 8.75 -3.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 15 S 0.43 0.47 1.01 0.87 1.03 1.06 105.09 5.24 -0.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 16 L 0.43 0.36 1.09 0.93 0.99 1.06 131.17 5.52 3.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 17 V 0.42 0.18 1.04 1.02 0.97 1.04 117.15 5.49 4.20 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 18 M 0.42 0.21 0.53 1.09 0.98 1.06 149.21 5.28 1.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 19 S 0.41 0.39 -0.67 1.05 1.01 1.08 105.09 5.24 -0.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 20 G 0.39 0.92 1.76 1.07 1.03 1.02 75.07 5.52 -0.40 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 21 P 0.41 0.76 0.97 1.08 1.03 1.01 115.13 5.96 -1.60 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 22 Y 0.42 1.14 2.39 1.14 1.01 1.02 181.19 5.52 -1.30 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 23 E 0.43 1.16 1.76 1.03 0.99 1.03 147.13 4.00 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 24 L 0.43 0.62 -0.37 0.89 0.98 1.08 131.17 5.52 3.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 25 K 0.43 0.54 -0.37 0.81 0.97 1.09 146.19 8.75 -3.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 26 A 0.44 0.26 -1.41 0.73 0.96 1.10 89.09 5.57 1.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 27 L 0.46 0.54 -1.67 0.77 0.95 1.12 131.17 5.52 3.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 28 H 0.48 0.27 0.46 0.91 0.96 1.07 155.16 6.74 -3.20 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 29 L 0.52 0.46 0.50 0.90 0.99 1.08 131.17 5.52 3.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 30 Q 0.54 0.92 1.63 1.02 1.03 1.05 146.15 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 31 G 0.58 0.67 2.34 1.02 1.07 0.99 75.07 5.52 -0.40 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 32 Q 0.59 1.41 3.16 0.99 1.08 0.96 146.15 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 33 D 0.61 1.41 5.33 1.04 1.08 0.92 133.10 3.80 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 34 M 0.60 2.47 5.33 1.04 1.06 0.92 149.21 5.28 1.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 35 E 0.58 1.06 3.99 0.89 1.05 1.00 147.13 4.00 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 36 Q 0.54 0.47 2.60 0.82 1.04 1.05 146.15 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 37 Q 0.51 0.41 -0.14 0.70 1.01 1.08 146.15 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 38 V 0.47 0.32 1.39 0.82 0.98 1.11 117.15 5.49 4.20 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 39 V 0.46 0.18 -0.33 0.80 0.95 1.10 117.15 5.49 4.20 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 40 F 0.44 0.14 -0.26 0.86 0.93 1.10 165.19 5.52 2.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 41 S 0.42 0.16 -2.43 0.81 0.92 1.11 105.09 5.24 -0.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 42 M 0.41 0.16 -2.43 0.81 0.93 1.11 149.21 5.28 1.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 43 S 0.44 0.33 -1.04 0.88 0.93 1.06 105.09 5.24 -0.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 44 F 0.46 0.24 1.09 1.01 0.95 1.03 165.19 5.52 2.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 45 V 0.50 0.43 1.27 0.92 0.98 1.01 117.15 5.49 4.20 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 46 Q 0.53 0.55 2.99 0.94 1.02 1.01 146.15 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 47 G 0.55 0.85 2.99 0.94 1.07 1.01 75.07 5.52 -0.40 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 48 E 0.56 1.84 5.30 1.07 1.10 0.97 147.13 4.00 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 49 E 0.58 1.78 7.26 1.21 1.11 0.89 147.13 4.00 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 50 S 0.58 3.59 7.21 1.21 1.11 0.88 105.09 5.24 -0.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 51 N 0.56 1.45 5.26 1.06 1.10 0.92 132.12 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 52 D 0.52 1.30 4.44 1.17 1.07 0.95 133.10 3.80 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 53 K 0.49 0.72 2.80 1.14 1.04 1.03 146.19 8.75 -3.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 54 I 0.45 0.45 2.17 1.03 1.00 1.03 131.17 5.52 4.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 55 P 0.42 0.22 -0.14 0.89 0.97 1.10 115.13 5.96 -1.60 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 56 V 0.39 0.11 -0.76 0.90 0.94 1.10 117.15 5.49 4.20 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 57 A 0.39 0.13 -2.89 0.84 0.93 1.15 89.09 5.57 1.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 58 L 0.39 0.17 -0.93 0.92 0.94 1.12 131.17 5.52 3.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 59 G 0.39 0.39 -0.11 0.81 0.97 1.09 75.07 5.52 -0.40 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 60 L 0.41 0.78 1.23 0.88 1.00 1.02 131.17 5.52 3.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 61 K 0.43 1.51 1.93 1.01 1.03 0.98 146.19 8.75 -3.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 62 E 0.44 1.26 1.93 1.01 1.05 0.98 147.13 4.00 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 63 K 0.44 2.39 0.84 0.95 1.04 1.02 146.19 8.75 -3.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 64 N 0.44 0.99 0.84 0.95 1.01 1.02 132.12 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 65 L 0.44 0.76 0.96 1.01 0.97 1.03 131.17 5.52 3.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 66 Y 0.43 0.20 0.04 1.07 0.93 1.11 181.19 5.52 -1.30 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 67 L 0.43 0.09 -1.30 1.00 0.92 1.18 131.17 5.52 3.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 68 S 0.43 0.09 -3.61 0.86 0.91 1.25 105.09 5.24 -0.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 69 C 0.43 0.12 -1.49 0.92 0.92 1.20 121.15 5.52 2.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 70 V 0.43 0.24 0.21 0.97 0.95 1.16 117.15 5.49 4.20 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 71 L 0.44 0.30 2.96 1.09 0.98 1.10 131.17 5.52 3.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 72 K 0.45 1.14 2.84 1.03 1.01 1.09 146.19 8.75 -3.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 73 D 0.46 2.37 2.94 1.08 1.03 1.04 133.10 3.80 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 74 D 0.45 4.14 4.21 1.14 1.05 0.97 133.10 3.80 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 75 K 0.45 1.71 4.21 1.14 1.05 0.97 146.19 8.75 -3.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 76 P 0.44 1.77 4.26 1.14 1.04 0.99 115.13 5.96 -1.60 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 77 T 0.45 0.87 1.51 1.02 1.01 1.04 119.12 5.19 -0.70 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 78 L 0.46 0.76 1.20 0.91 0.99 1.04 131.17 5.52 3.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 79 Q 0.48 0.66 1.31 0.97 0.98 1.05 146.15 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 80 L 0.49 0.34 0.49 0.83 0.98 1.10 131.17 5.52 3.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 81 E 0.50 0.68 1.17 0.90 1.00 1.09 147.13 4.00 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 82 S 0.52 0.61 2.79 1.03 1.02 1.06 105.09 5.24 -0.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 83 V 0.55 1.48 2.74 1.04 1.04 1.05 117.15 5.49 4.20 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 84 D 0.56 1.37 5.06 1.17 1.05 0.98 133.10 3.80 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 85 P 0.59 1.61 3.67 1.23 1.05 1.03 115.13 5.96 -1.60 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 86 K 0.59 3.35 3.04 1.24 1.05 1.03 146.19 8.75 -3.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 87 N 0.59 4.01 4.39 1.32 1.04 0.97 132.12 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 88 Y 0.58 5.18 3.77 1.25 1.04 0.98 181.19 5.52 -1.30 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 89 P 0.56 5.18 4.29 1.18 1.05 0.96 115.13 5.96 -1.60 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 90 K 0.55 3.19 2.87 1.12 1.06 0.95 146.19 8.75 -3.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 91 K 0.53 3.52 2.99 1.00 1.06 0.96 146.19 8.75 -3.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 92 K 0.52 4.56 4.07 0.99 1.06 0.92 146.19 8.75 -3.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 93 M 0.51 4.46 4.37 0.90 1.04 0.90 149.21 5.28 1.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 94 E 0.49 1.93 2.24 0.85 1.03 0.92 147.13 4.00 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 95 K 0.48 0.72 0.90 0.77 1.02 0.98 146.19 8.75 -3.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 96 R 0.46 0.63 -1.23 0.71 0.99 1.01 174.20 9.75 -4.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 97 F 0.45 0.58 0.37 0.85 0.97 1.00 165.19 5.52 2.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 98 V 0.46 0.58 0.07 0.89 0.96 1.01 117.15 5.49 4.20 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 99 F 0.47 0.21 -1.89 0.81 0.96 1.04 165.19 5.52 2.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 100 N 0.49 0.42 -1.37 0.78 0.98 1.04 132.12 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 101 K 0.50 0.39 -1.20 0.76 1.00 1.05 146.19 8.75 -3.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 102 I 0.51 0.73 0.33 0.92 1.00 0.96 131.17 5.52 4.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 103 E 0.54 0.73 2.64 1.05 1.00 0.92 147.13 4.00 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 104 I 0.54 0.73 2.46 0.97 1.01 0.94 131.17 5.52 4.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 105 N 0.56 0.86 0.33 0.91 1.02 0.98 132.12 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 106 N 0.54 0.86 2.59 0.95 1.03 0.94 132.12 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 107 K 0.54 1.06 0.16 0.93 1.02 0.98 146.19 8.75 -3.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 108 L 0.51 1.15 2.41 0.97 1.00 0.93 131.17 5.52 3.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 109 E 0.49 0.95 2.34 0.95 0.99 0.97 147.13 4.00 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 110 F 0.48 0.48 1.64 0.82 0.99 1.01 165.19 5.52 2.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 111 E 0.47 1.01 1.69 0.82 0.99 1.02 147.13 4.00 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 112 S 0.45 0.51 1.69 0.82 0.99 1.00 105.09 5.24 -0.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 113 A 0.45 0.90 0.87 0.93 0.99 1.03 89.09 5.57 1.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 114 Q 0.42 0.84 3.19 1.07 0.99 0.98 146.15 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 115 F 0.42 0.66 0.64 1.10 0.98 0.99 165.19 5.52 2.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 116 P 0.39 1.02 -0.56 1.06 0.98 1.01 115.13 5.96 -1.60 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 117 N 0.39 0.41 -2.00 1.03 0.96 1.02 132.12 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 118 W 0.38 0.64 -1.93 1.10 0.95 1.02 204.23 5.52 -0.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 119 Y 0.37 0.60 0.13 1.15 0.94 1.00 181.19 5.52 -1.30 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 120 I 0.38 0.50 0.76 1.14 0.96 0.99 131.17 5.52 4.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 121 S 0.39 0.82 0.61 1.05 1.00 1.02 105.09 5.24 -0.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 122 T 0.41 0.53 2.34 1.01 1.04 1.05 119.12 5.19 -0.70 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 123 S 0.43 1.31 3.73 0.95 1.07 1.00 105.09 5.24 -0.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 124 Q 0.45 1.57 5.87 1.11 1.06 0.95 146.15 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 125 A 0.47 1.07 4.34 0.99 1.05 0.92 89.09 5.57 1.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 126 E 0.48 1.24 3.90 1.07 1.02 0.94 147.13 4.00 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 127 N 0.49 0.53 2.44 0.94 0.99 1.00 132.12 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 128 M 0.48 0.46 0.27 0.88 0.97 1.01 149.21 5.28 1.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 129 P 0.45 0.22 -1.34 0.87 0.95 1.03 115.13 5.96 -1.60 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 130 V 0.45 0.13 -1.64 0.99 0.94 1.04 117.15 5.49 4.20 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 131 F 0.45 0.13 -1.83 0.99 0.96 1.05 165.19 5.52 2.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 132 L 0.46 0.09 -0.41 1.13 1.00 1.06 131.17 5.52 3.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 133 G 0.47 0.11 0.10 1.13 1.04 1.03 75.07 5.52 -0.40 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 134 G 0.49 0.23 1.49 1.20 1.09 0.98 75.07 5.52 -0.40 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 135 G 0.51 0.46 4.23 1.32 1.12 0.95 75.07 5.52 -0.40 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 136 G 0.52 0.33 4.40 1.31 1.12 0.93 75.07 5.52 -0.40 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 137 Q 0.54 0.48 4.33 1.22 1.11 0.94 146.15 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 138 D 0.54 0.80 4.94 1.21 1.09 0.94 133.10 3.80 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 139 I 0.52 0.70 2.81 1.07 1.06 0.97 131.17 5.52 4.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 140 T 0.49 0.59 2.74 0.98 1.04 0.97 119.12 5.19 -0.70 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 141 D 0.49 0.35 1.29 0.93 1.01 0.95 133.10 3.80 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 142 F 0.48 0.86 0.71 0.86 0.98 0.97 165.19 5.52 2.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 143 T 0.47 0.52 0.54 0.88 0.95 0.96 119.12 5.19 -0.70 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 144 M 0.47 0.23 -0.73 0.81 0.93 1.03 149.21 5.28 1.90 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 145 Q 0.47 0.35 -1.23 0.81 0.93 1.05 146.15 5.52 -3.50 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 146 F 0.41 0.33 1.01 0.93 0.00 1.04 165.19 5.52 2.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 147 V 0.38 0.00 0.00 0.00 0.00 0.00 117.15 5.49 4.20 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 148 S 0.33 0.00 0.00 0.00 0.00 0.00 105.09 5.24 -0.80 +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 149 S 0.29 0.00 0.00 0.00 0.00 0.00 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 1 V 0.27 0.00 0.00 0.00 0.00 0.00 117.15 5.49 4.20 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 2 E 0.33 0.00 0.00 0.00 0.00 0.00 147.13 4.00 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 3 C 0.39 0.34 0.00 0.00 0.00 0.00 121.15 5.52 2.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 4 D 0.45 0.71 2.13 1.06 0.96 1.10 133.10 3.80 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 5 F 0.52 0.34 1.34 1.08 0.98 1.08 165.19 5.52 2.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 6 S 0.53 0.52 -1.09 1.05 1.00 1.13 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 7 P 0.54 0.42 -0.36 1.09 1.01 1.08 115.13 5.96 -1.60 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 8 L 0.54 0.48 -0.97 1.10 1.02 1.08 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 9 L 0.53 0.52 1.09 1.15 1.03 1.05 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 10 S 0.53 0.52 0.46 1.17 1.04 1.06 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 11 G 0.53 0.97 0.46 1.17 1.06 1.06 75.07 5.52 -0.40 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 12 T 0.52 2.03 2.63 1.22 1.07 1.03 119.12 5.19 -0.70 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 13 P 0.52 1.12 3.41 1.21 1.06 1.05 115.13 5.96 -1.60 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 14 P 0.51 1.78 2.21 1.17 1.03 1.07 115.13 5.96 -1.60 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 15 Q 0.50 1.98 2.40 1.17 1.00 1.05 146.15 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 16 V 0.50 1.11 0.34 1.12 0.97 1.08 117.15 5.49 4.20 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 17 Y 0.50 1.44 0.86 1.04 0.96 1.06 181.19 5.52 -1.30 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 18 N 0.51 1.62 1.16 0.96 0.96 1.03 132.12 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 19 F 0.51 1.80 -1.01 0.91 0.97 1.07 165.19 5.52 2.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 20 K 0.49 0.85 -1.01 0.91 0.99 1.07 146.19 8.75 -3.90 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 21 R 0.49 0.46 -2.06 0.83 0.99 1.06 174.20 9.75 -4.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 22 L 0.50 0.77 -2.31 0.74 0.98 1.08 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 23 V 0.50 0.62 0.00 0.88 0.97 1.03 117.15 5.49 4.20 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 24 F 0.52 0.17 -0.61 0.91 0.97 1.10 165.19 5.52 2.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 25 T 0.53 0.33 -0.21 0.99 0.97 1.09 119.12 5.19 -0.70 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 26 N 0.54 0.69 0.83 1.07 0.98 1.07 132.12 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 27 C 0.54 1.29 2.36 1.22 0.97 0.99 121.15 5.52 2.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 28 N 0.55 0.74 2.36 1.22 0.96 1.01 132.12 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 29 Y 0.57 0.66 2.36 1.22 0.96 1.01 181.19 5.52 -1.30 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 30 N 0.56 2.47 2.17 1.14 0.97 1.03 132.12 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 31 L 0.56 1.27 0.66 1.06 0.99 1.01 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 32 T 0.56 0.67 -1.66 0.92 1.00 1.08 119.12 5.19 -0.70 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 33 K 0.55 0.56 -0.46 0.96 1.00 1.05 146.19 8.75 -3.90 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 34 L 0.55 0.56 -2.77 0.82 0.99 1.12 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 35 L 0.55 0.33 -2.77 0.82 0.97 1.10 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 36 S 0.56 0.22 -2.59 0.89 0.95 1.11 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 37 L 0.57 0.20 -3.93 0.82 0.94 1.18 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 38 F 0.57 0.39 -1.61 0.96 0.94 1.11 165.19 5.52 2.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 39 S 0.58 0.49 1.13 1.08 0.96 1.06 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 40 V 0.58 0.51 -1.11 0.96 0.98 1.07 117.15 5.49 4.20 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 41 N 0.57 0.85 0.94 1.02 0.99 1.02 132.12 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 42 D 0.58 0.34 2.46 1.10 0.99 1.06 133.10 3.80 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 43 F 0.57 0.62 2.46 1.10 0.98 1.06 165.19 5.52 2.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 44 T 0.56 0.66 3.84 1.17 0.98 1.01 119.12 5.19 -0.70 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 45 C 0.57 0.28 1.70 1.01 0.99 1.07 121.15 5.52 2.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 46 S 0.55 0.43 1.20 1.01 1.00 1.09 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 47 Q 0.54 0.46 2.81 1.14 1.02 1.08 146.15 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 48 I 0.54 0.87 2.37 1.10 1.03 1.10 131.17 5.52 4.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 49 S 0.52 0.66 2.47 1.02 1.02 1.05 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 50 P 0.51 0.27 0.40 0.88 1.00 1.07 115.13 5.96 -1.60 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 51 A 0.51 0.38 -0.16 0.84 0.97 1.08 89.09 5.57 1.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 52 A 0.51 0.38 1.91 0.98 0.95 1.06 89.09 5.57 1.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 53 I 0.52 0.40 1.99 0.99 0.94 1.03 131.17 5.52 4.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 54 A 0.53 0.21 1.89 0.95 0.95 1.08 89.09 5.57 1.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 55 S 0.55 0.33 1.31 1.02 0.96 1.09 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 56 N 0.55 0.63 1.94 1.13 0.97 1.08 132.12 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 57 C 0.56 0.83 4.01 1.26 0.97 1.06 121.15 5.52 2.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 58 Y 0.57 0.51 2.40 1.25 0.98 1.09 181.19 5.52 -1.30 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 59 S 0.58 0.22 0.33 1.12 0.98 1.11 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 60 S 0.57 0.34 -1.99 0.98 0.98 1.18 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 61 L 0.56 0.37 -0.76 1.02 0.97 1.10 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 62 I 0.55 0.43 -0.76 1.02 0.95 1.10 131.17 5.52 4.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 63 L 0.54 0.28 -3.00 0.90 0.94 1.11 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 64 D 0.53 0.45 -3.00 0.90 0.93 1.11 133.10 3.80 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 65 Y 0.52 1.00 -1.96 0.98 0.93 1.10 181.19 5.52 -1.30 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 66 F 0.52 1.88 -0.51 1.13 0.93 1.09 165.19 5.52 2.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 67 S 0.53 0.93 -0.51 1.13 0.93 1.09 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 68 Y 0.54 0.80 -1.01 1.12 0.94 1.11 181.19 5.52 -1.30 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 69 P 0.55 0.91 -1.34 1.04 0.94 1.06 115.13 5.96 -1.60 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 70 L 0.56 1.36 0.79 1.10 0.95 1.04 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 71 S 0.57 1.16 0.79 1.10 0.97 1.04 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 72 M 0.58 1.25 2.49 1.15 1.01 0.99 149.21 5.28 1.90 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 73 K 0.59 1.25 0.87 1.02 1.04 1.02 146.19 8.75 -3.90 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 74 S 0.61 1.25 3.11 1.14 1.05 0.99 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 75 D 0.63 0.94 1.66 1.00 1.04 1.04 133.10 3.80 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 76 L 0.63 0.63 3.19 1.12 1.02 1.07 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 77 S 0.62 0.63 3.30 1.18 1.00 1.08 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 78 V 0.61 0.38 2.67 1.07 1.00 1.09 117.15 5.49 4.20 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 79 S 0.59 0.46 2.06 1.09 1.01 1.09 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 80 S 0.58 0.53 3.67 1.22 1.03 1.06 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 81 A 0.58 0.50 1.60 1.08 1.04 1.08 89.09 5.57 1.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 82 G 0.57 0.50 3.06 1.21 1.05 1.03 75.07 5.52 -0.40 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 83 P 0.56 0.64 2.99 1.15 1.05 1.03 115.13 5.96 -1.60 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 84 I 0.55 0.55 0.74 1.03 1.03 1.04 131.17 5.52 4.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 85 S 0.55 0.90 1.44 1.16 1.02 1.00 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 86 Q 0.56 0.91 0.36 1.10 1.00 1.04 146.15 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 87 F 0.57 2.59 0.87 1.03 0.98 1.02 165.19 5.52 2.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 88 N 0.58 3.35 2.87 1.10 0.99 1.00 132.12 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 89 Y 0.58 2.59 2.87 1.10 1.01 1.00 181.19 5.52 -1.30 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 90 K 0.58 2.59 0.70 1.05 1.03 1.01 146.19 8.75 -3.90 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 91 Q 0.58 2.16 2.94 1.16 1.05 1.00 146.15 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 92 S 0.57 2.22 2.94 1.16 1.05 1.00 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 93 F 0.57 1.71 3.51 1.22 1.04 0.99 165.19 5.52 2.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 94 S 0.57 1.43 3.44 1.21 1.05 0.98 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 95 N 0.56 0.57 2.79 1.24 1.04 1.04 132.12 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 96 P 0.54 0.54 0.54 1.12 1.03 1.07 115.13 5.96 -1.60 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 97 T 0.53 0.28 0.71 1.10 1.00 1.08 119.12 5.19 -0.70 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 98 C 0.52 0.15 -1.53 0.98 0.96 1.12 121.15 5.52 2.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 99 L 0.51 0.10 -2.23 0.85 0.93 1.16 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 100 I 0.50 0.10 -1.79 0.77 0.92 1.14 131.17 5.52 4.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 101 L 0.51 0.13 -3.06 0.71 0.92 1.20 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 102 A 0.51 0.25 -2.96 0.76 0.93 1.15 89.09 5.57 1.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 103 T 0.52 0.48 -1.34 0.81 0.94 1.13 119.12 5.19 -0.70 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 104 V 0.51 0.94 0.80 0.96 0.95 1.08 117.15 5.49 4.20 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 105 P 0.52 0.76 0.80 0.96 0.95 1.08 115.13 5.96 -1.60 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 106 H 0.53 0.76 1.24 1.01 0.96 1.06 155.16 6.74 -3.20 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 107 N 0.54 1.49 1.24 1.01 0.97 1.06 132.12 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 108 L 0.53 0.67 0.63 1.00 0.99 1.02 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 109 T 0.54 0.72 1.07 0.92 1.01 1.00 119.12 5.19 -0.70 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 110 T 0.53 0.89 1.59 0.93 1.03 0.98 119.12 5.19 -0.70 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 111 I 0.52 1.67 0.89 0.92 1.04 1.02 131.17 5.52 4.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 112 T 0.50 0.95 0.89 0.92 1.05 1.02 119.12 5.19 -0.70 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 113 K 0.51 1.32 0.96 0.93 1.05 1.02 146.19 8.75 -3.90 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 114 P 0.50 2.95 -0.06 0.96 1.04 1.06 115.13 5.96 -1.60 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 115 L 0.50 2.74 2.01 1.09 1.02 1.04 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 116 K 0.51 2.15 1.00 1.12 1.00 1.07 146.19 8.75 -3.90 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 117 Y 0.52 0.97 -0.96 1.04 0.97 1.10 181.19 5.52 -1.30 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 118 S 0.53 1.90 -0.26 1.05 0.95 1.06 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 119 Y 0.53 1.90 1.87 1.11 0.95 1.02 181.19 5.52 -1.30 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 120 I 0.53 0.65 1.26 1.13 0.96 1.09 131.17 5.52 4.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 121 N 0.55 0.65 2.46 1.18 0.98 1.06 132.12 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 122 K 0.55 0.81 2.13 1.11 1.00 1.05 146.19 8.75 -3.90 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 123 C 0.56 1.00 1.09 1.03 1.01 1.04 121.15 5.52 2.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 124 S 0.56 0.51 0.91 1.05 1.01 1.05 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 125 R 0.56 0.34 0.84 1.03 1.00 1.08 174.20 9.75 -4.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 126 F 0.56 1.07 1.46 1.09 0.99 1.07 165.19 5.52 2.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 127 L 0.56 1.34 2.69 1.13 1.00 1.00 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 128 S 0.56 1.34 2.36 1.06 1.01 0.98 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 129 D 0.56 2.23 2.50 1.06 1.02 0.98 133.10 3.80 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 130 D 0.54 4.68 4.93 1.08 1.04 0.95 133.10 3.80 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 131 R 0.53 2.59 5.71 1.07 1.04 0.97 174.20 9.75 -4.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 132 T 0.53 2.40 5.09 1.08 1.04 0.97 119.12 5.19 -0.70 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 133 E 0.53 2.49 4.51 1.02 1.04 0.99 147.13 4.00 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 134 V 0.53 1.05 1.77 0.89 1.03 1.05 117.15 5.49 4.20 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 135 P 0.53 0.54 0.64 0.83 1.02 1.12 115.13 5.96 -1.60 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 136 Q 0.53 0.50 0.90 0.91 1.00 1.10 146.15 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 137 L 0.55 0.68 0.09 0.90 0.99 1.13 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 138 V 0.57 0.71 1.61 1.05 0.98 1.05 117.15 5.49 4.20 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 139 N 0.59 0.71 2.17 0.98 0.98 1.04 132.12 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 140 A 0.61 1.35 1.04 1.00 0.99 1.06 89.09 5.57 1.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 141 N 0.60 2.43 3.29 1.12 1.00 1.03 132.12 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 142 Q 0.60 2.34 4.11 1.26 1.01 0.98 146.15 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 143 Y 0.60 1.24 3.31 1.21 1.01 1.07 181.19 5.52 -1.30 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 144 S 0.59 0.57 2.49 1.19 1.00 1.12 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 145 P 0.58 0.44 2.41 1.17 0.99 1.15 115.13 5.96 -1.60 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 146 C 0.55 0.20 0.41 1.10 0.96 1.17 121.15 5.52 2.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 147 V 0.52 0.11 0.16 1.01 0.94 1.20 117.15 5.49 4.20 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 148 S 0.51 0.11 -0.47 1.02 0.93 1.21 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 149 I 0.51 0.27 0.16 1.01 0.95 1.20 131.17 5.52 4.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 150 V 0.51 0.53 0.70 0.97 0.99 1.13 117.15 5.49 4.20 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 151 P 0.51 0.30 0.70 0.97 1.02 1.13 115.13 5.96 -1.60 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 152 S 0.51 0.44 -1.66 0.91 1.04 1.11 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 153 T 0.51 1.03 0.60 0.94 1.03 1.07 119.12 5.19 -0.70 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 154 V 0.51 1.12 2.56 1.08 1.01 1.00 117.15 5.49 4.20 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 155 W 0.52 0.83 3.07 1.09 1.00 0.97 204.23 5.52 -0.90 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 156 E 0.52 0.95 3.57 1.09 1.02 0.95 147.13 4.00 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 157 D 0.52 2.02 2.56 1.12 1.03 0.98 133.10 3.80 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 158 G 0.51 3.00 2.81 1.21 1.04 0.95 75.07 5.52 -0.40 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 159 D 0.52 3.40 4.84 1.21 1.04 0.95 133.10 3.80 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 160 Y 0.52 4.07 4.54 1.25 1.02 0.96 181.19 5.52 -1.30 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 161 Y 0.52 7.12 3.97 1.18 1.01 0.98 181.19 5.52 -1.30 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 162 R 0.53 3.52 1.84 1.04 1.01 1.04 174.20 9.75 -4.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 163 K 0.53 3.01 1.34 1.03 1.02 1.06 146.19 8.75 -3.90 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 164 Q 0.53 2.97 1.91 1.09 1.03 1.04 146.15 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 165 L 0.55 1.25 0.87 1.01 1.03 1.06 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 166 S 0.55 1.08 1.39 0.98 1.03 1.05 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 167 P 0.56 0.62 1.39 1.06 1.04 1.05 115.13 5.96 -1.60 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 168 L 0.55 0.74 1.34 1.14 1.04 1.02 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 169 E 0.54 0.55 3.47 1.28 1.06 0.97 147.13 4.00 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 170 G 0.54 0.37 1.11 1.21 1.07 0.95 75.07 5.52 -0.40 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 171 G 0.54 0.37 -0.50 1.08 1.06 0.98 75.07 5.52 -0.40 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 172 G 0.54 0.16 0.29 1.07 1.03 1.00 75.07 5.52 -0.40 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 173 W 0.56 0.16 -0.53 1.06 0.98 1.03 204.23 5.52 -0.90 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 174 L 0.56 0.22 -0.41 1.04 0.96 1.05 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 175 V 0.58 0.22 -0.41 1.04 0.96 1.05 117.15 5.49 4.20 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 176 A 0.58 0.28 -0.30 1.02 0.99 1.07 89.09 5.57 1.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 177 S 0.59 0.49 1.87 1.02 1.04 1.07 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 178 G 0.60 0.49 2.66 1.01 1.07 1.09 75.07 5.52 -0.40 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 179 S 0.61 0.49 3.49 1.03 1.07 1.05 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 180 T 0.62 0.36 2.59 1.02 1.03 1.01 119.12 5.19 -0.70 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 181 V 0.63 0.53 2.40 0.95 0.99 1.00 117.15 5.49 4.20 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 182 A 0.63 0.69 2.70 0.84 0.96 0.99 89.09 5.57 1.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 183 M 0.63 0.82 2.63 0.77 0.96 0.99 149.21 5.28 1.90 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 184 T 0.62 0.91 0.57 0.72 0.99 1.04 119.12 5.19 -0.70 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 185 E 0.63 1.57 1.96 0.79 1.00 0.99 147.13 4.00 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 186 Q 0.62 1.57 1.06 0.78 1.00 0.96 146.15 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 187 L 0.61 1.07 2.47 0.92 0.98 0.96 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 188 Q 0.59 0.54 0.41 0.86 0.95 0.99 146.15 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 189 M 0.57 0.31 0.11 0.98 0.93 0.99 149.21 5.28 1.90 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 190 G 0.56 0.26 -1.89 0.91 0.93 1.01 75.07 5.52 -0.40 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 191 F 0.55 0.22 0.17 0.96 0.94 0.96 165.19 5.52 2.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 192 G 0.55 0.16 -1.21 0.89 0.95 1.02 75.07 5.52 -0.40 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 193 I 0.55 0.29 0.24 0.95 0.95 1.04 131.17 5.52 4.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 194 T 0.54 0.52 -0.84 0.89 0.95 1.08 119.12 5.19 -0.70 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 195 V 0.55 0.52 1.29 1.02 0.95 1.05 117.15 5.49 4.20 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 196 Q 0.56 1.06 1.21 0.94 0.96 1.06 146.15 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 197 Y 0.57 1.06 3.10 1.01 0.98 1.02 181.19 5.52 -1.30 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 198 G 0.59 2.30 3.36 1.09 1.02 1.00 75.07 5.52 -0.40 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 199 T 0.59 1.78 4.81 1.23 1.05 0.95 119.12 5.19 -0.70 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 200 T 0.58 0.84 3.43 1.16 1.06 1.00 119.12 5.19 -0.70 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 201 N 0.57 0.46 3.90 1.17 1.05 1.04 132.12 5.52 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 202 S 0.57 0.49 3.39 1.16 1.02 1.07 105.09 5.24 -0.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 203 V 0.56 0.68 3.46 1.17 1.00 1.07 117.15 5.49 4.20 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 204 C 0.57 0.35 1.40 1.11 0.99 1.12 121.15 5.52 2.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 205 P 0.56 0.45 1.51 1.00 1.00 1.13 115.13 5.96 -1.60 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 206 K 0.56 0.52 -0.73 0.88 1.00 1.14 146.19 8.75 -3.90 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 207 L 0.50 0.99 0.10 0.90 0.00 1.09 131.17 5.52 3.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 208 E 0.44 0.00 0.00 0.00 0.00 0.00 147.13 4.00 -3.50 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 209 F 0.38 0.00 0.00 0.00 0.00 0.00 165.19 5.52 2.80 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 210 A 0.32 0.00 0.00 0.00 0.00 0.00 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 1 R 0.18 0.00 0.00 0.00 0.00 0.00 174.20 9.75 -4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 2 S 0.22 0.00 0.00 0.00 0.00 0.00 105.09 5.24 -0.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 3 T 0.27 1.31 0.00 0.00 0.00 0.00 119.12 5.19 -0.70 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 4 T 0.29 0.67 0.69 0.88 1.03 1.04 119.12 5.19 -0.70 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 5 L 0.32 0.42 -1.23 0.83 0.99 1.09 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 6 L 0.31 0.24 -3.47 0.71 0.95 1.13 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 7 A 0.31 0.17 -3.91 0.66 0.93 1.15 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 8 L 0.30 0.17 -5.97 0.61 0.91 1.20 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 9 L 0.29 0.15 -5.19 0.60 0.91 1.22 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 10 A 0.28 0.12 -5.19 0.60 0.91 1.22 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 11 L 0.27 0.12 -6.80 0.59 0.91 1.24 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 12 V 0.25 0.23 -5.76 0.67 0.91 1.23 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 13 L 0.25 0.19 -5.76 0.67 0.91 1.23 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 14 L 0.27 0.17 -6.59 0.64 0.90 1.28 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 15 Y 0.28 0.31 -4.34 0.76 0.91 1.24 181.19 5.52 -1.30 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 16 L 0.29 0.37 -3.00 0.91 0.93 1.17 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 17 V 0.31 0.45 -1.39 0.92 0.95 1.14 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 18 S 0.32 0.24 -1.39 0.92 0.97 1.14 105.09 5.24 -0.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 19 G 0.31 0.21 -1.64 0.83 0.98 1.17 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 20 A 0.33 0.25 -1.64 0.83 0.96 1.15 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 21 L 0.35 0.37 -0.51 0.90 0.94 1.08 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 22 V 0.36 0.37 -1.14 0.79 0.93 1.09 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 23 F 0.37 0.30 -3.27 0.65 0.92 1.14 165.19 5.52 2.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 24 R 0.40 0.64 -2.46 0.66 0.93 1.11 174.20 9.75 -4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 25 A 0.43 1.49 -0.29 0.72 0.96 1.08 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 26 L 0.44 2.66 0.54 0.86 0.99 1.03 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 27 E 0.46 1.85 2.16 0.91 1.03 1.03 147.13 4.00 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 28 Q 0.51 3.17 2.67 0.88 1.06 1.03 146.15 5.52 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 29 P 0.52 6.66 3.23 0.93 1.07 1.02 115.13 5.96 -1.60 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 30 H 0.53 6.66 5.40 0.98 1.06 0.99 155.16 6.74 -3.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 31 E 0.57 3.88 4.59 0.97 1.06 1.02 147.13 4.00 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 32 Q 0.59 4.35 4.59 0.97 1.06 1.02 146.15 5.52 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 33 Q 0.59 6.26 4.89 0.89 1.05 0.99 146.15 5.52 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 34 A 0.57 6.26 5.70 0.86 1.05 0.95 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 35 Q 0.57 2.98 3.27 0.84 1.04 1.01 146.15 5.52 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 36 R 0.57 1.70 3.23 0.92 1.03 0.99 174.20 9.75 -4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 37 E 0.57 2.92 3.49 0.89 1.02 0.97 147.13 4.00 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 38 L 0.57 1.25 2.66 0.87 1.02 1.01 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 39 G 0.58 1.25 2.40 0.86 1.02 0.99 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 40 E 0.57 1.25 2.91 0.83 1.02 0.99 147.13 4.00 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 41 V 0.54 3.04 2.61 0.87 1.03 1.00 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 42 R 0.53 2.66 2.61 0.87 1.03 0.98 174.20 9.75 -4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 43 E 0.55 1.27 0.49 0.73 1.03 1.03 147.13 4.00 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 44 K 0.55 3.34 -0.03 0.76 1.01 1.04 146.19 8.75 -3.90 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 45 F 0.55 1.72 0.80 0.79 0.98 0.99 165.19 5.52 2.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 46 L 0.54 1.35 0.50 0.79 0.96 1.02 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 47 R 0.54 1.05 -0.31 0.90 0.94 1.05 174.20 9.75 -4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 48 A 0.54 0.65 -0.93 0.92 0.93 1.12 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 49 H 0.54 0.58 -0.14 0.91 0.93 1.16 155.16 6.74 -3.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 50 P 0.57 0.40 2.10 1.03 0.93 1.13 115.13 5.96 -1.60 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 51 C 0.57 0.66 2.93 1.10 0.94 1.13 121.15 5.52 2.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 52 V 0.58 0.84 3.49 1.15 0.97 1.12 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 53 S 0.58 0.94 4.30 1.12 1.01 1.09 105.09 5.24 -0.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 54 D 0.58 1.45 2.69 0.98 1.03 1.11 133.10 3.80 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 55 Q 0.58 1.93 3.30 1.04 1.05 1.04 146.15 5.52 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 56 E 0.55 1.19 2.51 1.05 1.03 1.02 147.13 4.00 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 57 L 0.53 0.59 0.27 0.93 1.00 1.05 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 58 G 0.53 0.24 -2.30 0.79 0.97 1.09 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 59 L 0.51 0.27 -2.34 0.79 0.95 1.08 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 60 L 0.47 0.57 -2.34 0.79 0.95 1.08 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 61 I 0.44 0.43 -1.56 0.78 0.96 1.10 131.17 5.52 4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 62 K 0.44 0.53 -2.07 0.65 0.98 1.13 146.19 8.75 -3.90 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 63 E 0.43 1.07 0.67 0.78 0.98 1.07 147.13 4.00 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 64 V 0.42 1.54 2.29 0.79 0.97 1.04 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 65 A 0.44 0.64 2.11 0.80 0.96 1.06 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 66 D 0.46 0.36 2.11 0.88 0.95 1.05 133.10 3.80 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 67 A 0.46 0.48 1.81 1.00 0.97 1.05 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 68 L 0.47 0.47 3.16 1.15 1.00 0.98 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 69 G 0.51 0.29 3.16 1.15 1.03 0.98 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 70 G 0.53 0.47 3.16 1.15 1.05 0.98 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 71 G 0.55 0.89 3.16 1.27 1.06 0.98 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 72 A 0.59 1.56 5.59 1.29 1.07 0.92 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 73 D 0.62 2.27 5.51 1.21 1.07 0.93 133.10 3.80 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 74 P 0.63 3.07 5.63 1.19 1.07 0.95 115.13 5.96 -1.60 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 75 E 0.65 4.14 5.11 1.10 1.07 0.98 147.13 4.00 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 76 T 0.65 3.32 5.74 1.21 1.05 0.97 119.12 5.19 -0.70 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 77 S 0.65 2.17 4.61 1.10 1.02 1.00 105.09 5.24 -0.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 78 H 0.65 1.32 2.89 1.02 0.99 0.98 155.16 6.74 -3.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 79 S 0.63 1.53 3.20 1.12 0.96 0.98 105.09 5.24 -0.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 80 A 0.61 0.94 1.14 1.07 0.95 1.03 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 81 W 0.58 0.68 1.03 1.09 0.94 1.01 204.23 5.52 -0.90 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 82 D 0.54 0.68 1.66 1.16 0.96 1.00 133.10 3.80 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 83 L 0.52 0.68 1.03 1.05 0.98 1.00 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 84 G 0.49 0.56 -0.59 1.04 0.99 1.01 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 85 S 0.46 0.29 -0.47 0.99 0.99 1.04 105.09 5.24 -0.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 86 A 0.42 0.31 -3.21 0.86 0.97 1.07 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 87 F 0.40 0.41 -0.97 0.98 0.95 1.03 165.19 5.52 2.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 88 F 0.38 0.31 -0.97 0.98 0.96 1.03 165.19 5.52 2.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 89 F 0.35 0.44 -1.16 0.92 0.98 1.02 165.19 5.52 2.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 90 S 0.34 0.35 -2.60 0.89 1.01 1.03 105.09 5.24 -0.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 91 G 0.34 0.29 -2.43 0.87 1.02 1.04 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 92 T 0.35 0.48 -0.37 0.92 1.01 1.01 119.12 5.19 -0.70 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 93 I 0.37 0.51 1.69 0.97 0.99 0.99 131.17 5.52 4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 94 I 0.39 0.36 -0.39 0.84 0.98 1.01 131.17 5.52 4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 95 T 0.44 0.25 -0.39 0.84 0.99 1.01 119.12 5.19 -0.70 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 96 T 0.48 0.56 -1.40 0.86 0.99 1.04 119.12 5.19 -0.70 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 97 I 0.50 0.79 0.56 1.02 0.99 1.00 131.17 5.52 4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 98 G 0.53 0.88 2.70 1.17 0.99 0.95 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 99 Y 0.56 0.45 1.43 1.11 0.98 1.02 181.19 5.52 -1.30 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 100 G 0.57 0.65 0.99 1.06 0.98 1.04 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 101 N 0.60 0.54 0.81 1.08 0.97 1.05 132.12 5.52 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 102 V 0.58 0.68 0.60 0.99 0.96 1.05 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 103 A 0.58 0.99 1.61 0.97 0.96 1.02 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 104 L 0.57 1.03 2.23 0.95 0.98 1.02 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 105 R 0.55 1.40 1.53 0.83 1.01 1.06 174.20 9.75 -4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 106 T 0.54 1.37 2.87 0.98 1.04 0.99 119.12 5.19 -0.70 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 107 D 0.52 3.25 3.17 1.02 1.05 0.96 133.10 3.80 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 108 A 0.49 1.37 3.17 1.02 1.05 0.96 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 109 G 0.47 0.82 1.26 0.97 1.03 0.99 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 110 R 0.42 0.26 0.71 1.00 1.00 1.06 174.20 9.75 -4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 111 L 0.39 0.18 -1.86 0.86 0.97 1.10 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 112 F 0.36 0.16 -3.47 0.85 0.94 1.11 165.19 5.52 2.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 113 C 0.32 0.13 -4.56 0.79 0.92 1.15 121.15 5.52 2.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 114 I 0.30 0.16 -4.86 0.75 0.90 1.17 131.17 5.52 4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 115 F 0.28 0.15 -4.86 0.75 0.89 1.17 165.19 5.52 2.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 116 Y 0.26 0.21 -4.07 0.74 0.89 1.22 181.19 5.52 -1.30 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 117 A 0.26 0.29 -3.46 0.79 0.89 1.14 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 118 L 0.27 0.24 -3.46 0.79 0.91 1.14 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 119 V 0.28 0.23 -1.84 0.92 0.92 1.14 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 120 G 0.29 0.19 -2.89 0.84 0.94 1.15 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 121 I 0.29 0.20 -4.50 0.83 0.95 1.15 131.17 5.52 4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 122 P 0.31 0.27 -2.37 0.97 0.95 1.10 115.13 5.96 -1.60 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 123 L 0.32 0.19 -2.99 0.97 0.94 1.07 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 124 F 0.32 0.22 -5.11 0.83 0.93 1.12 165.19 5.52 2.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 125 G 0.33 0.12 -5.29 0.85 0.92 1.13 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 126 I 0.34 0.15 -5.29 0.72 0.92 1.13 131.17 5.52 4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 127 L 0.35 0.17 -3.16 0.86 0.92 1.08 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 128 L 0.37 0.12 -2.37 0.85 0.93 1.12 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 129 A 0.39 0.18 -2.37 0.85 0.94 1.12 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 130 G 0.43 0.36 0.20 0.99 0.96 1.08 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 131 V 0.44 0.85 2.11 1.04 0.98 1.03 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 132 G 0.46 0.69 2.11 1.04 1.00 1.03 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 133 D 0.47 0.69 2.63 1.17 1.01 1.00 133.10 3.80 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 134 R 0.48 1.25 2.74 1.15 1.03 1.02 174.20 9.75 -4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 135 L 0.49 1.69 4.20 1.28 1.04 0.97 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 136 G 0.50 0.83 2.07 1.14 1.05 1.02 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 137 S 0.51 0.83 1.24 1.07 1.05 1.02 105.09 5.24 -0.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 138 S 0.50 1.37 0.94 1.07 1.03 1.05 105.09 5.24 -0.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 139 L 0.50 1.37 3.07 1.21 1.00 1.00 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 140 R 0.49 0.72 1.11 1.05 0.97 1.04 174.20 9.75 -4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 141 H 0.50 0.53 1.00 1.07 0.96 1.02 155.16 6.74 -3.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 142 G 0.51 0.88 0.37 1.00 0.95 1.03 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 143 I 0.52 0.31 0.54 0.99 0.95 1.02 131.17 5.52 4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 144 G 0.53 0.40 1.06 0.96 0.94 1.02 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 145 H 0.53 0.41 1.06 0.92 0.94 1.01 155.16 6.74 -3.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 146 I 0.53 0.41 -0.90 0.76 0.93 1.05 131.17 5.52 4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 147 E 0.54 0.36 -1.07 0.78 0.92 1.04 147.13 4.00 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 148 A 0.55 0.22 -3.20 0.64 0.92 1.10 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 149 I 0.57 0.62 -2.69 0.65 0.93 1.07 131.17 5.52 4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 150 F 0.59 0.37 -2.97 0.72 0.94 1.03 165.19 5.52 2.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 151 L 0.60 0.50 -3.79 0.75 0.95 1.07 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 152 K 0.61 0.53 -4.61 0.73 0.95 1.11 146.19 8.75 -3.90 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 153 W 0.62 0.95 -3.17 0.88 0.96 1.10 204.23 5.52 -0.90 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 154 H 0.63 1.79 -1.56 1.01 0.96 1.10 155.16 6.74 -3.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 155 V 0.64 1.55 0.87 1.03 0.98 1.04 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 156 P 0.65 1.21 -1.26 0.97 1.00 1.09 115.13 5.96 -1.60 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 157 P 0.66 0.66 -0.36 0.90 1.01 1.16 115.13 5.96 -1.60 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 158 E 0.65 1.75 -0.06 0.90 1.00 1.12 147.13 4.00 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 159 L 0.64 0.84 -0.06 0.90 0.98 1.12 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 160 V 0.64 0.45 -1.67 0.77 0.95 1.15 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 161 R 0.63 0.35 -1.04 0.76 0.94 1.14 174.20 9.75 -4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 162 V 0.63 0.42 -1.86 0.75 0.93 1.17 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 163 L 0.62 0.57 -1.14 0.75 0.93 1.11 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 164 S 0.61 0.24 -1.93 0.76 0.92 1.09 105.09 5.24 -0.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 165 A 0.60 0.28 -3.84 0.71 0.91 1.13 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 166 M 0.57 0.28 -4.63 0.72 0.90 1.11 149.21 5.28 1.90 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 167 L 0.56 0.17 -4.63 0.72 0.90 1.11 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 168 F 0.53 0.12 -6.70 0.59 0.90 1.13 165.19 5.52 2.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 169 L 0.49 0.12 -6.19 0.71 0.91 1.10 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 170 L 0.47 0.08 -5.39 0.80 0.91 1.18 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 171 I 0.43 0.07 -5.39 0.80 0.91 1.18 131.17 5.52 4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 172 G 0.40 0.07 -5.39 0.80 0.91 1.21 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 173 C 0.36 0.08 -5.39 0.80 0.91 1.18 121.15 5.52 2.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 174 L 0.31 0.08 -4.60 0.79 0.91 1.20 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 175 L 0.28 0.07 -4.77 0.80 0.92 1.22 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 176 F 0.26 0.18 -4.84 0.72 0.93 1.22 165.19 5.52 2.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 177 V 0.26 0.34 -4.74 0.76 0.95 1.17 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 178 L 0.26 0.60 -2.69 0.82 0.98 1.12 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 179 T 0.26 0.60 -2.69 0.82 1.00 1.10 119.12 5.19 -0.70 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 180 P 0.26 0.60 -1.90 0.80 1.01 1.14 115.13 5.96 -1.60 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 181 T 0.27 0.63 -2.69 0.82 0.99 1.10 119.12 5.19 -0.70 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 182 F 0.30 0.23 -1.17 0.90 0.97 1.12 165.19 5.52 2.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 183 V 0.34 0.24 -2.19 0.93 0.94 1.16 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 184 F 0.38 0.16 -3.09 0.80 0.91 1.12 165.19 5.52 2.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 185 C 0.42 0.33 -2.71 0.77 0.90 1.12 121.15 5.52 2.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 186 Y 0.45 0.73 0.03 0.89 0.91 1.08 181.19 5.52 -1.30 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 187 M 0.48 0.89 -0.87 0.96 0.93 1.01 149.21 5.28 1.90 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 188 E 0.51 2.22 1.37 1.07 0.97 1.00 147.13 4.00 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 189 D 0.53 2.84 1.99 1.05 1.00 0.93 133.10 3.80 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 190 W 0.54 2.36 0.94 0.97 1.01 0.95 204.23 5.52 -0.90 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 191 S 0.53 2.36 2.66 0.99 1.02 0.95 105.09 5.24 -0.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 192 K 0.52 1.43 1.84 0.98 1.01 0.98 146.19 8.75 -3.90 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 193 L 0.47 0.95 -0.73 0.84 0.98 1.02 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 194 E 0.43 1.12 0.43 0.86 0.95 1.06 147.13 4.00 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 195 A 0.39 0.48 -1.81 0.74 0.93 1.07 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 196 I 0.35 0.43 -3.16 0.67 0.90 1.14 131.17 5.52 4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 197 Y 0.32 0.19 -2.37 0.66 0.89 1.15 181.19 5.52 -1.30 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 198 F 0.29 0.27 -2.74 0.69 0.90 1.16 165.19 5.52 2.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 199 V 0.26 0.31 -4.36 0.68 0.91 1.19 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 200 V 0.25 0.29 -2.47 0.75 0.93 1.16 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 201 T 0.24 0.48 -1.46 0.72 0.96 1.12 119.12 5.19 -0.70 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 202 L 0.26 0.48 -0.67 0.71 0.98 1.16 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 203 T 0.28 0.64 0.67 0.86 1.00 1.09 119.12 5.19 -0.70 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 204 T 0.32 0.38 -0.11 0.88 1.00 1.05 119.12 5.19 -0.70 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 205 V 0.35 0.46 -0.04 0.96 0.99 1.04 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 206 G 0.37 0.53 2.70 1.09 0.98 0.99 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 207 F 0.40 0.58 1.69 1.11 0.98 1.02 165.19 5.52 2.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 208 G 0.43 0.58 0.41 1.05 0.99 1.09 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 209 D 0.46 0.59 1.24 1.07 0.99 1.04 133.10 3.80 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 210 Y 0.49 0.68 1.24 1.07 0.97 1.04 181.19 5.52 -1.30 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 211 V 0.51 0.69 2.86 1.08 0.96 1.04 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 212 A 0.54 0.69 3.47 1.06 0.96 1.04 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 213 G 0.56 0.68 2.34 1.07 0.98 1.07 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 214 A 0.58 1.80 3.21 1.04 1.01 1.03 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 215 D 0.59 3.08 4.60 1.11 1.04 0.97 133.10 3.80 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 216 P 0.60 5.20 5.73 1.23 1.06 0.95 115.13 5.96 -1.60 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 217 R 0.62 6.90 5.84 1.21 1.08 0.97 174.20 9.75 -4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 218 Q 0.64 6.39 5.84 1.33 1.09 0.97 146.15 5.52 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 219 D 0.64 4.17 4.71 1.22 1.09 0.99 133.10 3.80 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 220 S 0.63 3.34 4.14 1.16 1.08 1.01 105.09 5.24 -0.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 221 P 0.61 3.34 4.40 1.17 1.05 1.03 115.13 5.96 -1.60 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 222 A 0.58 3.09 3.84 1.24 1.02 1.04 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 223 Y 0.55 1.90 1.10 1.12 1.01 1.09 181.19 5.52 -1.30 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 224 Q 0.52 0.91 -0.36 0.99 1.00 1.14 146.15 5.52 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 225 P 0.49 0.95 -2.09 0.91 0.98 1.12 115.13 5.96 -1.60 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 226 L 0.45 0.53 -3.70 0.90 0.96 1.12 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 227 V 0.40 0.32 -4.86 0.87 0.92 1.08 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 228 W 0.37 0.14 -6.86 0.80 0.89 1.10 204.23 5.52 -0.90 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 229 F 0.33 0.14 -8.47 0.67 0.87 1.13 165.19 5.52 2.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 230 W 0.30 0.16 -8.47 0.67 0.87 1.13 204.23 5.52 -0.90 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 231 I 0.28 0.15 -7.13 0.82 0.88 1.06 131.17 5.52 4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 232 L 0.28 0.14 -7.01 0.77 0.91 1.11 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 233 L 0.29 0.14 -5.40 0.77 0.92 1.10 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 234 G 0.28 0.31 -4.24 0.80 0.92 1.14 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 235 L 0.27 0.32 -4.41 0.82 0.92 1.13 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 236 A 0.29 0.40 -2.80 0.83 0.91 1.11 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 237 Y 0.29 0.54 -0.56 0.95 0.90 1.07 181.19 5.52 -1.30 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 238 F 0.32 0.48 -1.90 0.80 0.91 1.15 165.19 5.52 2.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 239 A 0.34 0.40 -1.90 0.80 0.92 1.15 89.09 5.57 1.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 240 S 0.37 0.36 -1.46 0.84 0.93 1.12 105.09 5.24 -0.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 241 V 0.36 0.61 -0.44 0.81 0.96 1.09 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 242 L 0.35 0.42 -0.27 0.80 0.98 1.10 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 243 T 0.37 0.31 0.24 0.92 1.00 1.07 119.12 5.19 -0.70 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 244 T 0.41 0.67 0.31 0.94 1.02 1.04 119.12 5.19 -0.70 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 245 I 0.40 0.86 -0.59 1.01 1.02 0.97 131.17 5.52 4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 246 G 0.43 0.49 -0.59 1.01 1.01 0.97 75.07 5.52 -0.40 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 247 N 0.44 0.67 -0.73 1.01 0.99 0.96 132.12 5.52 -3.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 248 W 0.43 0.71 -2.00 0.94 0.96 1.03 204.23 5.52 -0.90 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 249 L 0.37 0.53 -1.39 0.95 0.00 1.06 131.17 5.52 3.80 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 250 R 0.34 0.00 0.00 0.00 0.00 0.00 174.20 9.75 -4.50 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 251 V 0.30 0.00 0.00 0.00 0.00 0.00 117.15 5.49 4.20 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 252 V 0.24 0.00 0.00 0.00 0.00 0.00 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 1 R 0.19 0.00 0.00 0.00 0.00 0.00 174.20 9.75 -4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 2 S 0.23 0.00 0.00 0.00 0.00 0.00 105.09 5.24 -0.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 3 T 0.27 1.27 0.00 0.00 0.00 0.00 119.12 5.19 -0.70 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 4 T 0.30 0.66 0.69 0.88 1.03 1.04 119.12 5.19 -0.70 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 5 L 0.32 0.40 -1.23 0.83 0.99 1.09 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 6 L 0.32 0.23 -3.47 0.71 0.95 1.13 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 7 A 0.31 0.16 -3.91 0.66 0.93 1.15 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 8 L 0.30 0.16 -5.97 0.61 0.91 1.20 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 9 L 0.29 0.15 -5.19 0.60 0.91 1.22 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 10 A 0.29 0.12 -5.19 0.60 0.91 1.22 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 11 L 0.28 0.12 -6.80 0.59 0.91 1.24 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 12 V 0.26 0.23 -5.76 0.67 0.91 1.23 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 13 L 0.25 0.18 -5.76 0.67 0.91 1.23 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 14 L 0.27 0.17 -6.59 0.64 0.90 1.28 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 15 Y 0.28 0.30 -4.34 0.76 0.91 1.24 181.19 5.52 -1.30 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 16 L 0.30 0.36 -3.00 0.91 0.93 1.17 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 17 V 0.32 0.44 -1.39 0.92 0.95 1.14 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 18 S 0.33 0.23 -1.39 0.92 0.97 1.14 105.09 5.24 -0.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 19 G 0.31 0.21 -1.64 0.83 0.98 1.17 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 20 A 0.33 0.24 -1.64 0.83 0.96 1.15 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 21 L 0.36 0.36 -0.51 0.90 0.94 1.08 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 22 V 0.37 0.36 -1.14 0.79 0.93 1.09 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 23 F 0.38 0.30 -3.27 0.65 0.92 1.14 165.19 5.52 2.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 24 R 0.41 0.62 -2.46 0.66 0.93 1.11 174.20 9.75 -4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 25 A 0.44 1.45 -0.29 0.72 0.96 1.08 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 26 L 0.46 2.59 0.54 0.86 0.99 1.03 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 27 E 0.48 1.80 2.16 0.91 1.03 1.03 147.13 4.00 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 28 Q 0.53 3.09 2.67 0.88 1.06 1.03 146.15 5.52 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 29 P 0.54 6.48 3.23 0.93 1.07 1.02 115.13 5.96 -1.60 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 30 H 0.55 6.48 5.40 0.98 1.06 0.99 155.16 6.74 -3.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 31 E 0.59 3.78 4.59 0.97 1.06 1.02 147.13 4.00 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 32 Q 0.61 4.23 4.59 0.97 1.06 1.02 146.15 5.52 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 33 Q 0.61 6.09 4.89 0.89 1.05 0.99 146.15 5.52 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 34 A 0.59 6.09 5.70 0.86 1.05 0.95 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 35 Q 0.58 2.90 3.27 0.84 1.04 1.01 146.15 5.52 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 36 R 0.58 1.66 3.23 0.92 1.03 0.99 174.20 9.75 -4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 37 E 0.58 2.84 3.49 0.89 1.02 0.97 147.13 4.00 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 38 L 0.57 1.22 2.66 0.87 1.02 1.01 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 39 G 0.58 1.22 2.40 0.86 1.02 0.99 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 40 E 0.58 1.22 2.91 0.83 1.02 0.99 147.13 4.00 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 41 V 0.55 2.95 2.61 0.87 1.03 1.00 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 42 R 0.53 2.58 2.61 0.87 1.03 0.98 174.20 9.75 -4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 43 E 0.55 1.23 0.49 0.73 1.03 1.03 147.13 4.00 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 44 K 0.55 3.25 -0.03 0.76 1.01 1.04 146.19 8.75 -3.90 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 45 F 0.55 1.68 0.80 0.79 0.98 0.99 165.19 5.52 2.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 46 L 0.54 1.32 0.50 0.79 0.96 1.02 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 47 R 0.54 1.02 -0.31 0.90 0.94 1.05 174.20 9.75 -4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 48 A 0.53 0.63 -0.93 0.92 0.93 1.12 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 49 H 0.53 0.57 -0.14 0.91 0.93 1.16 155.16 6.74 -3.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 50 P 0.56 0.39 2.10 1.03 0.93 1.13 115.13 5.96 -1.60 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 51 C 0.57 0.64 2.93 1.10 0.94 1.13 121.15 5.52 2.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 52 V 0.58 0.82 3.49 1.15 0.97 1.12 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 53 S 0.57 0.91 4.30 1.12 1.01 1.09 105.09 5.24 -0.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 54 D 0.58 1.41 2.69 0.98 1.03 1.11 133.10 3.80 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 55 Q 0.58 1.88 3.30 1.04 1.05 1.04 146.15 5.52 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 56 E 0.55 1.15 2.51 1.05 1.03 1.02 147.13 4.00 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 57 L 0.52 0.57 0.27 0.93 1.00 1.05 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 58 G 0.51 0.23 -2.30 0.79 0.97 1.09 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 59 L 0.49 0.27 -2.34 0.79 0.95 1.08 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 60 L 0.46 0.56 -2.34 0.79 0.95 1.08 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 61 I 0.43 0.42 -1.56 0.78 0.96 1.10 131.17 5.52 4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 62 K 0.42 0.51 -2.07 0.65 0.98 1.13 146.19 8.75 -3.90 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 63 E 0.41 1.04 0.67 0.78 0.98 1.07 147.13 4.00 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 64 V 0.39 1.50 2.29 0.79 0.97 1.04 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 65 A 0.42 0.62 2.11 0.80 0.96 1.06 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 66 D 0.44 0.35 2.11 0.88 0.95 1.05 133.10 3.80 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 67 A 0.44 0.47 1.81 1.00 0.97 1.05 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 68 L 0.44 0.46 3.16 1.15 1.00 0.98 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 69 G 0.48 0.28 3.16 1.15 1.03 0.98 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 70 G 0.50 0.46 3.16 1.15 1.05 0.98 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 71 G 0.52 0.87 3.16 1.27 1.06 0.98 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 72 A 0.55 1.51 5.59 1.29 1.07 0.92 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 73 D 0.59 2.21 5.51 1.21 1.07 0.93 133.10 3.80 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 74 P 0.62 3.87 5.56 1.13 1.08 0.95 115.13 5.96 -1.60 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 75 E 0.63 5.13 5.67 1.11 1.09 0.97 147.13 4.00 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 76 T 0.65 4.11 6.30 1.22 1.10 0.96 119.12 5.19 -0.70 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 77 Q 0.68 3.62 5.17 1.14 1.11 1.00 146.15 5.52 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 78 S 0.68 2.80 5.80 1.13 1.09 0.99 105.09 5.24 -0.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 79 S 0.68 1.96 4.99 1.12 1.05 1.02 105.09 5.24 -0.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 80 H 0.67 1.19 2.81 1.12 1.01 1.02 155.16 6.74 -3.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 81 S 0.65 1.48 3.39 1.19 0.97 0.99 105.09 5.24 -0.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 82 A 0.63 0.91 1.14 1.07 0.95 1.03 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 83 W 0.61 0.66 1.03 1.09 0.94 1.01 204.23 5.52 -0.90 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 84 D 0.59 0.66 1.66 1.16 0.96 1.00 133.10 3.80 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 85 L 0.55 0.66 1.03 1.05 0.98 1.00 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 86 G 0.54 0.55 -0.59 1.04 0.99 1.01 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 87 S 0.52 0.28 -0.47 0.99 0.99 1.04 105.09 5.24 -0.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 88 A 0.48 0.30 -3.21 0.86 0.97 1.07 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 89 F 0.46 0.40 -0.97 0.98 0.95 1.03 165.19 5.52 2.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 90 F 0.43 0.30 -0.97 0.98 0.96 1.03 165.19 5.52 2.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 91 F 0.40 0.43 -1.16 0.92 0.98 1.02 165.19 5.52 2.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 92 S 0.37 0.34 -2.60 0.89 1.01 1.03 105.09 5.24 -0.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 93 G 0.35 0.28 -2.43 0.87 1.02 1.04 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 94 T 0.36 0.46 -0.37 0.92 1.01 1.01 119.12 5.19 -0.70 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 95 I 0.35 0.50 1.69 0.97 0.99 0.99 131.17 5.52 4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 96 I 0.36 0.35 -0.39 0.84 0.98 1.01 131.17 5.52 4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 97 T 0.38 0.24 -0.39 0.84 0.99 1.01 119.12 5.19 -0.70 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 98 T 0.41 0.54 -1.40 0.86 0.99 1.04 119.12 5.19 -0.70 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 99 I 0.44 0.77 0.56 1.02 0.99 1.00 131.17 5.52 4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 100 G 0.48 0.85 2.70 1.17 0.99 0.95 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 101 Y 0.52 0.44 1.43 1.11 0.98 1.02 181.19 5.52 -1.30 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 102 G 0.57 0.63 0.99 1.06 0.98 1.04 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 103 N 0.60 0.53 0.81 1.08 0.97 1.05 132.12 5.52 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 104 V 0.60 0.66 0.60 0.99 0.96 1.05 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 105 A 0.62 0.96 1.61 0.97 0.96 1.02 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 106 L 0.62 1.00 2.23 0.95 0.98 1.02 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 107 R 0.62 1.36 1.53 0.83 1.01 1.06 174.20 9.75 -4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 108 T 0.62 1.33 2.87 0.98 1.04 0.99 119.12 5.19 -0.70 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 109 D 0.60 3.16 3.17 1.02 1.05 0.96 133.10 3.80 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 110 A 0.58 1.33 3.17 1.02 1.05 0.96 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 111 G 0.54 0.80 1.26 0.97 1.03 0.99 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 112 R 0.50 0.26 0.71 1.00 1.00 1.06 174.20 9.75 -4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 113 L 0.46 0.18 -1.86 0.86 0.97 1.10 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 114 F 0.43 0.16 -3.47 0.85 0.94 1.11 165.19 5.52 2.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 115 C 0.39 0.12 -4.56 0.79 0.92 1.15 121.15 5.52 2.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 116 I 0.35 0.15 -4.86 0.75 0.90 1.17 131.17 5.52 4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 117 F 0.32 0.15 -4.86 0.75 0.89 1.17 165.19 5.52 2.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 118 Y 0.29 0.20 -4.07 0.74 0.89 1.22 181.19 5.52 -1.30 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 119 A 0.28 0.28 -3.46 0.79 0.89 1.14 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 120 L 0.28 0.23 -3.46 0.79 0.91 1.14 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 121 V 0.29 0.23 -1.84 0.92 0.92 1.14 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 122 G 0.30 0.19 -2.89 0.84 0.94 1.15 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 123 I 0.30 0.19 -4.50 0.83 0.95 1.15 131.17 5.52 4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 124 P 0.31 0.26 -2.37 0.97 0.95 1.10 115.13 5.96 -1.60 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 125 L 0.32 0.18 -2.99 0.97 0.94 1.07 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 126 F 0.33 0.22 -5.11 0.83 0.93 1.12 165.19 5.52 2.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 127 G 0.34 0.12 -5.29 0.85 0.92 1.13 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 128 I 0.35 0.14 -5.29 0.72 0.92 1.13 131.17 5.52 4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 129 L 0.36 0.16 -3.16 0.86 0.92 1.08 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 130 L 0.38 0.12 -2.37 0.85 0.93 1.12 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 131 A 0.40 0.17 -2.37 0.85 0.94 1.12 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 132 G 0.44 0.35 0.20 0.99 0.96 1.08 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 133 V 0.46 0.82 2.11 1.04 0.98 1.03 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 134 G 0.48 0.67 2.11 1.04 1.00 1.03 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 135 D 0.50 0.67 2.63 1.17 1.01 1.00 133.10 3.80 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 136 R 0.52 1.21 2.74 1.15 1.03 1.02 174.20 9.75 -4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 137 L 0.54 1.64 4.20 1.28 1.04 0.97 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 138 G 0.55 0.81 2.07 1.14 1.05 1.02 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 139 S 0.56 0.81 1.24 1.07 1.05 1.02 105.09 5.24 -0.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 140 S 0.56 1.34 0.94 1.07 1.03 1.05 105.09 5.24 -0.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 141 L 0.55 1.34 3.07 1.21 1.00 1.00 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 142 R 0.54 0.70 1.11 1.05 0.97 1.04 174.20 9.75 -4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 143 H 0.55 0.52 1.00 1.07 0.96 1.02 155.16 6.74 -3.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 144 G 0.55 0.85 0.37 1.00 0.95 1.03 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 145 I 0.56 0.31 0.54 0.99 0.95 1.02 131.17 5.52 4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 146 G 0.56 0.39 1.06 0.96 0.94 1.02 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 147 H 0.57 0.40 1.06 0.92 0.94 1.01 155.16 6.74 -3.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 148 I 0.59 0.40 -0.90 0.76 0.93 1.05 131.17 5.52 4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 149 E 0.59 0.35 -1.07 0.78 0.92 1.04 147.13 4.00 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 150 A 0.60 0.21 -3.20 0.64 0.92 1.10 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 151 I 0.62 0.60 -2.69 0.65 0.93 1.07 131.17 5.52 4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 152 F 0.63 0.36 -2.97 0.72 0.94 1.03 165.19 5.52 2.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 153 L 0.64 0.49 -3.79 0.75 0.95 1.07 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 154 K 0.64 0.52 -4.61 0.73 0.95 1.11 146.19 8.75 -3.90 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 155 W 0.64 0.93 -3.17 0.88 0.96 1.10 204.23 5.52 -0.90 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 156 H 0.64 1.74 -1.56 1.01 0.96 1.10 155.16 6.74 -3.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 157 V 0.64 1.51 0.87 1.03 0.98 1.04 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 158 P 0.65 1.18 -1.26 0.97 1.00 1.09 115.13 5.96 -1.60 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 159 P 0.67 0.64 -0.36 0.90 1.01 1.16 115.13 5.96 -1.60 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 160 E 0.65 1.70 -0.06 0.90 1.00 1.12 147.13 4.00 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 161 L 0.65 0.82 -0.06 0.90 0.98 1.12 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 162 V 0.63 0.44 -1.67 0.77 0.95 1.15 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 163 R 0.62 0.34 -1.04 0.76 0.94 1.14 174.20 9.75 -4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 164 V 0.60 0.41 -1.86 0.75 0.93 1.17 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 165 L 0.58 0.55 -1.14 0.75 0.93 1.11 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 166 S 0.56 0.23 -1.93 0.76 0.92 1.09 105.09 5.24 -0.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 167 A 0.55 0.27 -3.84 0.71 0.91 1.13 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 168 M 0.52 0.27 -4.63 0.72 0.90 1.11 149.21 5.28 1.90 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 169 L 0.53 0.17 -4.63 0.72 0.90 1.11 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 170 F 0.53 0.12 -6.70 0.59 0.90 1.13 165.19 5.52 2.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 171 L 0.53 0.12 -6.19 0.71 0.91 1.10 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 172 L 0.55 0.07 -5.39 0.80 0.91 1.18 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 173 I 0.56 0.07 -5.39 0.80 0.91 1.18 131.17 5.52 4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 174 G 0.56 0.07 -5.39 0.80 0.91 1.21 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 175 C 0.55 0.07 -5.39 0.80 0.91 1.18 121.15 5.52 2.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 176 L 0.52 0.08 -4.60 0.79 0.91 1.20 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 177 L 0.49 0.07 -4.77 0.80 0.92 1.22 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 178 F 0.45 0.18 -4.84 0.72 0.93 1.22 165.19 5.52 2.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 179 V 0.43 0.33 -4.74 0.76 0.95 1.17 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 180 L 0.41 0.58 -2.69 0.82 0.98 1.12 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 181 T 0.39 0.58 -2.69 0.82 1.00 1.10 119.12 5.19 -0.70 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 182 P 0.39 0.58 -1.90 0.80 1.01 1.14 115.13 5.96 -1.60 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 183 T 0.39 0.61 -2.69 0.82 0.99 1.10 119.12 5.19 -0.70 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 184 F 0.41 0.23 -1.17 0.90 0.97 1.12 165.19 5.52 2.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 185 V 0.44 0.23 -2.19 0.93 0.94 1.16 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 186 F 0.47 0.16 -3.09 0.80 0.91 1.12 165.19 5.52 2.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 187 C 0.50 0.32 -2.71 0.77 0.90 1.12 121.15 5.52 2.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 188 Y 0.52 0.71 0.03 0.89 0.91 1.08 181.19 5.52 -1.30 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 189 M 0.54 0.87 -0.87 0.96 0.93 1.01 149.21 5.28 1.90 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 190 E 0.54 2.16 1.37 1.07 0.97 1.00 147.13 4.00 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 191 D 0.53 2.76 1.99 1.05 1.00 0.93 133.10 3.80 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 192 W 0.53 2.30 0.94 0.97 1.01 0.95 204.23 5.52 -0.90 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 193 S 0.51 2.30 2.66 0.99 1.02 0.95 105.09 5.24 -0.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 194 K 0.48 1.39 1.84 0.98 1.01 0.98 146.19 8.75 -3.90 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 195 L 0.45 0.93 -0.73 0.84 0.98 1.02 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 196 E 0.41 1.08 0.43 0.86 0.95 1.06 147.13 4.00 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 197 A 0.37 0.47 -1.81 0.74 0.93 1.07 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 198 I 0.34 0.42 -3.16 0.67 0.90 1.14 131.17 5.52 4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 199 Y 0.30 0.17 -2.99 0.65 0.89 1.12 181.19 5.52 -1.30 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 200 F 0.28 0.13 -4.63 0.62 0.89 1.20 165.19 5.52 2.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 201 V 0.25 0.26 -4.19 0.66 0.90 1.18 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 202 I 0.26 0.14 -4.36 0.68 0.91 1.19 131.17 5.52 4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 203 V 0.26 0.23 -3.34 0.65 0.93 1.15 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 204 T 0.27 0.44 -1.29 0.71 0.95 1.13 119.12 5.19 -0.70 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 205 L 0.29 0.47 -1.29 0.71 0.98 1.13 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 206 T 0.32 0.62 0.67 0.86 1.00 1.09 119.12 5.19 -0.70 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 207 T 0.36 0.37 -0.11 0.88 1.00 1.05 119.12 5.19 -0.70 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 208 V 0.39 0.45 -0.04 0.96 0.99 1.04 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 209 G 0.42 0.52 2.70 1.09 0.98 0.99 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 210 F 0.45 0.56 1.69 1.11 0.98 1.02 165.19 5.52 2.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 211 G 0.46 0.56 0.41 1.05 0.99 1.09 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 212 D 0.48 0.58 1.24 1.07 0.99 1.04 133.10 3.80 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 213 Y 0.49 0.66 1.24 1.07 0.97 1.04 181.19 5.52 -1.30 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 214 V 0.51 0.67 2.86 1.08 0.96 1.04 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 215 A 0.54 0.67 3.47 1.06 0.96 1.04 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 216 G 0.56 0.66 2.34 1.07 0.98 1.07 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 217 A 0.58 1.75 3.21 1.04 1.01 1.03 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 218 D 0.59 3.00 4.60 1.11 1.04 0.97 133.10 3.80 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 219 P 0.60 5.06 5.73 1.23 1.06 0.95 115.13 5.96 -1.60 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 220 R 0.63 6.71 5.84 1.21 1.08 0.97 174.20 9.75 -4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 221 Q 0.64 6.21 5.84 1.33 1.09 0.97 146.15 5.52 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 222 D 0.64 4.06 4.71 1.22 1.09 0.99 133.10 3.80 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 223 S 0.63 3.25 4.14 1.16 1.08 1.01 105.09 5.24 -0.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 224 P 0.60 3.25 4.40 1.17 1.05 1.03 115.13 5.96 -1.60 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 225 A 0.57 3.01 3.84 1.24 1.02 1.04 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 226 Y 0.54 1.85 1.10 1.12 1.01 1.09 181.19 5.52 -1.30 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 227 Q 0.51 0.89 -0.36 0.99 1.00 1.14 146.15 5.52 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 228 P 0.48 0.92 -2.09 0.91 0.98 1.12 115.13 5.96 -1.60 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 229 L 0.44 0.51 -3.70 0.90 0.96 1.12 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 230 V 0.40 0.31 -4.86 0.87 0.92 1.08 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 231 W 0.37 0.14 -6.86 0.80 0.89 1.10 204.23 5.52 -0.90 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 232 F 0.34 0.14 -8.47 0.67 0.87 1.13 165.19 5.52 2.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 233 W 0.31 0.16 -8.47 0.67 0.87 1.13 204.23 5.52 -0.90 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 234 I 0.29 0.15 -7.13 0.82 0.88 1.06 131.17 5.52 4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 235 L 0.29 0.14 -7.01 0.77 0.91 1.11 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 236 L 0.30 0.13 -5.40 0.77 0.92 1.10 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 237 G 0.29 0.30 -4.24 0.80 0.92 1.14 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 238 L 0.28 0.32 -4.41 0.82 0.92 1.13 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 239 A 0.29 0.39 -2.80 0.83 0.91 1.11 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 240 Y 0.29 0.52 -0.56 0.95 0.90 1.07 181.19 5.52 -1.30 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 241 F 0.30 0.47 -1.90 0.80 0.91 1.15 165.19 5.52 2.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 242 A 0.33 0.38 -1.90 0.80 0.92 1.15 89.09 5.57 1.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 243 S 0.35 0.35 -1.46 0.84 0.93 1.12 105.09 5.24 -0.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 244 V 0.35 0.59 -0.44 0.81 0.96 1.09 117.15 5.49 4.20 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 245 L 0.34 0.41 -0.27 0.80 0.98 1.10 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 246 T 0.36 0.30 0.24 0.92 1.00 1.07 119.12 5.19 -0.70 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 247 T 0.39 0.66 0.31 0.94 1.02 1.04 119.12 5.19 -0.70 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 248 I 0.40 0.84 -0.59 1.01 1.02 0.97 131.17 5.52 4.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 249 G 0.41 0.48 -0.59 1.01 1.01 0.97 75.07 5.52 -0.40 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 250 N 0.37 0.65 -0.73 1.01 0.00 0.96 132.12 5.52 -3.50 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 251 W 0.33 0.00 0.00 0.00 0.00 0.00 204.23 5.52 -0.90 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 252 L 0.28 0.00 0.00 0.00 0.00 0.00 131.17 5.52 3.80 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 253 R 0.24 0.00 0.00 0.00 0.00 0.00 174.20 9.75 -4.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 1 C 0.24 0.00 0.00 0.00 0.00 0.00 121.15 5.52 2.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 2 D 0.29 0.00 0.00 0.00 0.00 0.00 133.10 3.80 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 3 A 0.34 0.12 0.00 0.00 0.00 0.00 89.09 5.57 1.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 4 F 0.40 0.32 1.64 0.99 0.95 1.09 165.19 5.52 2.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 5 V 0.45 0.20 0.01 0.96 0.96 1.01 117.15 5.49 4.20 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 6 G 0.47 0.40 -0.60 0.89 0.99 1.02 75.07 5.52 -0.40 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 7 T 0.49 0.38 -2.21 0.88 1.00 1.05 119.12 5.19 -0.70 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 8 W 0.50 0.38 -1.43 0.87 0.99 1.09 204.23 5.52 -0.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 9 K 0.52 0.52 0.03 1.00 1.00 1.04 146.19 8.75 -3.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 10 L 0.53 0.48 0.14 0.98 1.00 1.06 131.17 5.52 3.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 11 V 0.55 0.79 0.51 0.95 1.01 1.05 117.15 5.49 4.20 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 12 S 0.56 0.64 2.94 1.04 1.04 1.03 105.09 5.24 -0.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 13 S 0.57 0.67 0.81 0.98 1.05 1.05 105.09 5.24 -0.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 14 E 0.58 1.51 3.56 1.10 1.05 1.00 147.13 4.00 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 15 N 0.58 1.88 5.51 1.24 1.05 0.92 132.12 5.52 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 16 F 0.55 2.20 4.31 1.20 1.03 0.95 165.19 5.52 2.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 17 D 0.55 1.26 2.79 1.08 1.02 0.92 133.10 3.80 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 18 D 0.55 1.56 2.49 1.12 1.01 0.93 133.10 3.80 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 19 Y 0.54 3.13 2.60 1.00 0.99 0.94 181.19 5.52 -1.30 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 20 M 0.53 1.39 3.39 0.99 0.99 0.98 149.21 5.28 1.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 21 K 0.53 0.82 2.77 1.00 0.99 0.98 146.19 8.75 -3.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 22 E 0.52 0.39 0.81 0.86 0.99 1.06 147.13 4.00 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 23 V 0.53 0.39 1.90 0.92 0.98 1.02 117.15 5.49 4.20 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 24 G 0.54 0.17 1.19 0.92 0.97 1.06 75.07 5.52 -0.40 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 25 V 0.55 0.10 0.67 0.87 0.95 1.07 117.15 5.49 4.20 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 26 G 0.55 0.19 0.30 0.91 0.95 1.08 75.07 5.52 -0.40 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 27 F 0.54 0.38 1.43 0.97 0.96 1.01 165.19 5.52 2.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 28 A 0.54 1.02 1.43 0.89 0.98 1.02 89.09 5.57 1.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 29 T 0.52 0.77 1.43 0.89 1.00 1.02 119.12 5.19 -0.70 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 30 R 0.53 0.89 0.91 0.76 1.01 1.04 174.20 9.75 -4.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 31 K 0.52 0.88 3.04 0.90 1.01 1.01 146.19 8.75 -3.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 32 V 0.51 0.60 2.14 0.89 0.98 0.98 117.15 5.49 4.20 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 33 A 0.51 0.31 1.70 0.85 0.95 1.00 89.09 5.57 1.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 34 G 0.51 0.31 1.91 0.86 0.94 1.01 75.07 5.52 -0.40 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 35 M 0.50 0.65 1.40 0.93 0.94 1.03 149.21 5.28 1.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 36 A 0.48 1.03 2.93 1.08 0.97 0.94 89.09 5.57 1.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 37 K 0.47 1.03 2.03 1.07 0.99 0.91 146.19 8.75 -3.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 38 P 0.46 0.73 0.07 0.92 0.99 0.95 115.13 5.96 -1.60 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 39 N 0.45 0.50 -0.47 0.90 0.97 0.99 132.12 5.52 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 40 M 0.45 0.34 0.16 1.01 0.94 0.99 149.21 5.28 1.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 41 I 0.45 0.16 -1.19 0.94 0.92 1.05 131.17 5.52 4.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 42 I 0.45 0.16 -0.49 0.94 0.92 1.01 131.17 5.52 4.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 43 S 0.46 0.16 -0.67 0.94 0.94 1.02 105.09 5.24 -0.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 44 V 0.47 0.39 1.36 1.06 0.98 1.03 117.15 5.49 4.20 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 45 N 0.47 0.46 1.19 1.08 1.02 1.04 132.12 5.52 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 46 G 0.47 0.25 1.80 1.09 1.04 1.08 75.07 5.52 -0.40 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 47 D 0.47 0.49 1.61 1.02 1.03 1.06 133.10 3.80 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 48 L 0.47 0.21 1.00 1.01 1.00 1.03 131.17 5.52 3.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 49 V 0.46 0.42 0.60 0.93 0.98 1.04 117.15 5.49 4.20 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 50 T 0.46 0.34 0.71 0.91 0.98 1.06 119.12 5.19 -0.70 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 51 I 0.45 0.71 0.40 0.81 1.01 1.06 131.17 5.52 4.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 52 R 0.45 1.29 2.64 0.93 1.05 1.03 174.20 9.75 -4.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 53 S 0.45 1.29 3.91 0.99 1.09 0.96 105.09 5.24 -0.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 54 E 0.47 1.59 1.86 0.94 1.09 0.99 147.13 4.00 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 55 S 0.49 1.62 3.81 1.02 1.09 0.95 105.09 5.24 -0.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 56 T 0.50 1.95 4.21 1.10 1.07 0.94 119.12 5.19 -0.70 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 57 F 0.51 1.62 4.03 1.04 1.05 0.93 165.19 5.52 2.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 58 K 0.51 2.10 4.03 1.04 1.06 0.93 146.19 8.75 -3.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 59 N 0.50 1.02 1.96 0.90 1.06 0.95 132.12 5.52 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 60 T 0.49 1.58 2.14 0.97 1.05 0.96 119.12 5.19 -0.70 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 61 E 0.48 0.68 2.14 0.97 1.03 0.96 147.13 4.00 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 62 I 0.47 0.85 2.14 0.97 1.00 0.96 131.17 5.52 4.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 63 S 0.46 0.49 -0.17 0.83 0.98 1.03 105.09 5.24 -0.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 64 F 0.45 0.28 -0.10 0.91 0.97 1.02 165.19 5.52 2.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 65 K 0.46 0.29 -1.74 0.88 0.97 1.10 146.19 8.75 -3.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 66 L 0.46 0.38 0.51 0.92 0.97 1.06 131.17 5.52 3.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 67 G 0.47 0.38 -1.73 0.80 0.96 1.07 75.07 5.52 -0.40 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 68 V 0.49 0.32 1.01 0.92 0.96 1.04 117.15 5.49 4.20 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 69 E 0.52 0.67 1.31 0.88 0.97 1.02 147.13 4.00 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 70 F 0.53 0.47 1.49 0.87 0.98 1.01 165.19 5.52 2.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 71 D 0.54 0.92 1.41 0.78 1.00 1.01 133.10 3.80 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 72 E 0.56 0.53 2.24 0.80 1.01 0.97 147.13 4.00 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 73 I 0.57 1.03 2.56 0.91 1.01 0.97 131.17 5.52 4.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 74 T 0.58 1.03 5.30 1.03 1.01 0.94 119.12 5.19 -0.70 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 75 A 0.59 1.17 4.47 0.96 1.02 0.94 89.09 5.57 1.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 76 D 0.58 3.33 4.17 1.00 1.04 0.95 133.10 3.80 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 77 D 0.56 1.71 4.79 1.00 1.04 0.98 133.10 3.80 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 78 R 0.54 3.39 4.86 1.01 1.05 0.99 174.20 9.75 -4.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 79 K 0.52 2.72 5.49 1.12 1.05 0.98 146.19 8.75 -3.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 80 V 0.49 1.14 2.91 0.98 1.03 1.02 117.15 5.49 4.20 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 81 K 0.48 0.41 0.34 0.83 1.02 1.06 146.19 8.75 -3.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 82 S 0.46 0.29 0.49 0.84 0.99 1.07 105.09 5.24 -0.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 83 I 0.43 0.33 -1.64 0.78 0.96 1.11 131.17 5.52 4.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 84 I 0.42 0.27 0.31 0.91 0.95 1.04 131.17 5.52 4.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 85 T 0.43 0.20 0.31 0.99 0.97 1.03 119.12 5.19 -0.70 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 86 L 0.43 0.28 0.20 1.01 1.00 1.01 131.17 5.52 3.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 87 D 0.43 0.41 1.64 1.04 1.03 1.00 133.10 3.80 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 88 G 0.44 0.23 1.47 1.05 1.04 1.01 75.07 5.52 -0.40 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 89 G 0.46 0.21 0.20 0.99 1.02 1.08 75.07 5.52 -0.40 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 90 A 0.46 0.22 2.37 1.04 0.99 1.05 89.09 5.57 1.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 91 L 0.47 0.16 0.41 0.91 0.96 1.12 131.17 5.52 3.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 92 V 0.49 0.29 0.46 0.82 0.94 1.14 117.15 5.49 4.20 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 93 Q 0.50 0.57 0.46 0.75 0.95 1.15 146.15 5.52 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 94 V 0.52 0.73 -1.27 0.79 0.97 1.12 117.15 5.49 4.20 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 95 Q 0.53 1.63 1.47 0.91 1.00 1.07 146.15 5.52 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 96 K 0.54 0.93 2.81 1.06 1.02 1.00 146.19 8.75 -3.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 97 W 0.55 2.51 2.77 1.07 1.04 0.98 204.23 5.52 -0.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 98 D 0.55 1.94 4.23 1.20 1.07 0.93 133.10 3.80 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 99 G 0.56 1.40 4.11 1.20 1.09 0.92 75.07 5.52 -0.40 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 100 K 0.55 1.93 4.04 1.19 1.10 0.91 146.19 8.75 -3.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 101 S 0.55 0.81 4.33 1.12 1.10 0.95 105.09 5.24 -0.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 102 T 0.54 1.63 3.71 1.06 1.09 0.96 119.12 5.19 -0.70 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 103 T 0.53 1.60 3.50 0.97 1.07 0.96 119.12 5.19 -0.70 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 104 I 0.52 2.39 3.50 0.97 1.06 0.96 131.17 5.52 4.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 105 K 0.52 3.24 3.17 0.90 1.05 0.94 146.19 8.75 -3.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 106 R 0.51 3.75 3.86 0.97 1.05 0.93 174.20 9.75 -4.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 107 K 0.51 5.29 3.93 1.06 1.06 0.93 146.19 8.75 -3.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 108 R 0.51 4.42 6.50 1.20 1.06 0.89 174.20 9.75 -4.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 109 D 0.50 4.51 6.50 1.20 1.07 0.89 133.10 3.80 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 110 G 0.49 1.86 4.59 1.15 1.07 0.94 75.07 5.52 -0.40 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 111 D 0.47 0.71 3.24 1.08 1.05 1.01 133.10 3.80 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 112 K 0.46 0.31 2.11 1.01 1.02 1.08 146.19 8.75 -3.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 113 L 0.44 0.55 1.80 0.91 0.99 1.08 131.17 5.52 3.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 114 V 0.43 0.18 1.19 0.86 0.95 1.15 117.15 5.49 4.20 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 115 V 0.43 0.07 -0.77 0.72 0.93 1.23 117.15 5.49 4.20 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 116 E 0.43 0.08 -2.19 0.66 0.91 1.21 147.13 4.00 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 117 C 0.42 0.21 -0.06 0.72 0.91 1.17 121.15 5.52 2.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 118 V 0.41 0.28 1.29 0.87 0.93 1.09 117.15 5.49 4.20 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 119 M 0.42 0.12 1.29 0.87 0.95 1.09 149.21 5.28 1.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 120 K 0.42 0.33 0.91 0.90 0.98 1.10 146.19 8.75 -3.90 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 121 G 0.43 0.59 1.64 0.94 1.02 1.05 75.07 5.52 -0.40 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 122 V 0.45 0.86 2.91 1.00 1.04 0.98 117.15 5.49 4.20 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 123 T 0.44 0.84 4.11 1.05 1.06 0.98 119.12 5.19 -0.70 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 124 S 0.44 0.63 2.77 0.98 1.06 1.05 105.09 5.24 -0.80 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 125 T 0.44 1.33 1.69 0.92 1.05 1.09 119.12 5.19 -0.70 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 126 R 0.45 1.59 3.33 0.95 1.02 1.01 174.20 9.75 -4.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 127 V 0.45 2.33 3.19 0.95 1.00 1.01 117.15 5.49 4.20 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 128 Y 0.40 1.63 2.56 0.84 0.00 1.02 181.19 5.52 -1.30 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 129 E 0.35 0.00 0.00 0.00 0.00 0.00 147.13 4.00 -3.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 130 R 0.31 0.00 0.00 0.00 0.00 0.00 174.20 9.75 -4.50 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 131 A 0.25 0.00 0.00 0.00 0.00 0.00 89.09 5.57 1.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 1 L 0.26 0.00 0.00 0.00 0.00 0.00 131.17 5.52 3.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 2 G 0.31 0.00 0.00 0.00 0.00 0.00 75.07 5.52 -0.40 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 3 S 0.37 1.28 0.00 0.00 0.00 0.00 105.09 5.24 -0.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 4 R 0.43 1.28 1.06 1.00 1.06 1.01 174.20 9.75 -4.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 5 R 0.48 1.28 1.77 1.01 1.03 0.95 174.20 9.75 -4.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 6 T 0.46 0.79 -0.36 0.87 1.00 1.00 119.12 5.19 -0.70 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 7 L 0.47 0.33 -2.60 0.75 0.96 1.03 131.17 5.52 3.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 8 M 0.47 0.17 -2.90 0.71 0.92 1.06 149.21 5.28 1.90 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 9 L 0.44 0.21 -2.64 0.71 0.91 1.08 131.17 5.52 3.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 10 L 0.46 0.25 -3.99 0.66 0.91 1.07 131.17 5.52 3.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 11 A 0.47 0.49 -2.07 0.71 0.92 1.01 89.09 5.57 1.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 12 Q 0.48 1.18 -0.66 0.77 0.94 1.03 146.15 5.52 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 13 M 0.49 1.01 -0.49 0.75 0.97 1.02 149.21 5.28 1.90 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 14 R 0.51 1.33 1.76 0.87 0.99 0.98 174.20 9.75 -4.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 15 K 0.54 0.64 0.14 0.86 1.00 1.01 146.19 8.75 -3.90 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 16 I 0.55 0.56 -2.03 0.81 0.99 1.02 131.17 5.52 4.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 17 S 0.55 0.38 -0.50 0.93 0.97 1.05 105.09 5.24 -0.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 18 L 0.59 0.10 -0.90 0.96 0.95 1.12 131.17 5.52 3.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 19 F 0.58 0.12 -3.03 0.90 0.93 1.17 165.19 5.52 2.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 20 S 0.57 0.18 -1.07 0.98 0.93 1.14 105.09 5.24 -0.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 21 C 0.57 0.36 -0.57 0.98 0.95 1.12 121.15 5.52 2.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 22 L 0.58 0.82 1.34 1.03 0.97 1.06 131.17 5.52 3.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 23 K 0.58 0.83 2.96 1.08 1.00 1.06 146.19 8.75 -3.90 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 24 D 0.56 2.59 3.46 1.09 1.01 1.04 133.10 3.80 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 25 R 0.57 2.72 1.94 1.00 1.00 1.00 174.20 9.75 -4.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 26 H 0.57 1.35 4.07 1.14 0.98 0.94 155.16 6.74 -3.20 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 27 D 0.56 0.70 1.94 1.08 0.96 0.97 133.10 3.80 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 28 F 0.55 0.55 0.81 1.09 0.95 0.99 165.19 5.52 2.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 29 G 0.55 0.70 1.07 1.10 0.97 1.02 75.07 5.52 -0.40 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 30 F 0.54 0.73 1.89 1.07 1.00 0.98 165.19 5.52 2.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 31 P 0.53 1.46 1.57 0.96 1.04 0.98 115.13 5.96 -1.60 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 32 Q 0.54 1.27 1.57 0.96 1.06 0.98 146.15 5.52 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 33 E 0.55 1.46 1.57 0.96 1.06 0.98 147.13 4.00 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 34 E 0.56 1.52 3.89 1.10 1.05 0.93 147.13 4.00 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 35 F 0.58 1.52 4.44 1.02 1.04 0.92 165.19 5.52 2.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 36 G 0.60 0.76 2.27 0.97 1.03 0.94 75.07 5.52 -0.40 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 37 N 0.60 0.76 2.01 1.00 1.03 0.96 132.12 5.52 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 38 Q 0.61 1.75 1.71 1.04 1.03 0.97 146.15 5.52 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 39 F 0.61 1.79 3.33 1.05 1.02 0.97 165.19 5.52 2.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 40 Q 0.60 1.92 3.63 0.93 1.03 0.96 146.15 5.52 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 41 K 0.57 1.60 3.37 0.85 1.03 0.98 146.19 8.75 -3.90 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 42 A 0.55 1.30 1.37 0.77 1.04 1.00 89.09 5.57 1.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 43 E 0.51 1.16 2.99 0.91 1.03 1.00 147.13 4.00 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 44 T 0.46 0.43 1.60 0.84 1.02 1.05 119.12 5.19 -0.70 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 45 I 0.44 0.35 -0.53 0.78 0.99 1.10 131.17 5.52 4.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 46 P 0.41 0.28 -0.53 0.82 0.97 1.10 115.13 5.96 -1.60 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 47 V 0.38 0.33 -0.53 0.82 0.95 1.10 117.15 5.49 4.20 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 48 L 0.35 0.47 -1.87 0.77 0.93 1.09 131.17 5.52 3.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 49 H 0.34 0.21 -1.87 0.77 0.92 1.09 155.16 6.74 -3.20 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 50 E 0.35 0.49 -1.31 0.69 0.92 1.08 147.13 4.00 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 51 M 0.34 1.04 0.07 0.76 0.93 1.03 149.21 5.28 1.90 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 52 I 0.36 0.53 0.24 0.74 0.94 1.02 131.17 5.52 4.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 53 Q 0.39 0.27 -1.37 0.69 0.95 1.01 146.15 5.52 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 54 Q 0.38 0.43 -1.49 0.81 0.95 1.00 146.15 5.52 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 55 I 0.38 0.51 -2.20 0.81 0.95 1.06 131.17 5.52 4.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 56 F 0.41 0.26 -2.37 0.83 0.94 1.06 165.19 5.52 2.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 57 N 0.44 0.20 -2.30 0.89 0.94 1.06 132.12 5.52 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 58 L 0.46 0.41 -2.41 0.89 0.95 1.04 131.17 5.52 3.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 59 F 0.49 0.94 -0.46 0.96 0.98 1.01 165.19 5.52 2.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 60 S 0.54 0.98 2.29 1.09 1.01 0.98 105.09 5.24 -0.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 61 T 0.56 1.59 2.21 1.07 1.05 1.01 119.12 5.19 -0.70 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 62 K 0.58 2.46 4.46 1.19 1.07 0.98 146.19 8.75 -3.90 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 63 D 0.60 1.85 6.07 1.20 1.07 0.97 133.10 3.80 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 64 S 0.62 1.30 5.44 1.09 1.06 0.98 105.09 5.24 -0.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 65 S 0.62 0.68 3.27 1.09 1.02 0.98 105.09 5.24 -0.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 66 A 0.63 0.68 3.89 1.15 0.99 0.97 89.09 5.57 1.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 67 A 0.62 0.88 3.57 1.05 0.98 0.97 89.09 5.57 1.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 68 W 0.59 0.95 3.39 0.98 0.99 0.95 204.23 5.52 -0.90 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 69 D 0.56 0.77 1.14 0.86 1.01 0.99 133.10 3.80 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 70 E 0.53 0.63 -0.47 0.85 1.03 1.01 147.13 4.00 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 71 T 0.52 1.00 0.66 0.97 1.03 0.98 119.12 5.19 -0.70 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 72 L 0.48 1.20 2.90 0.97 1.03 0.99 131.17 5.52 3.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 73 L 0.48 0.60 0.16 0.85 1.02 1.02 131.17 5.52 3.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 74 D 0.47 0.65 -1.23 0.91 1.01 1.07 133.10 3.80 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 75 K 0.45 1.14 -1.23 0.91 1.01 1.07 146.19 8.75 -3.90 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 76 F 0.42 2.40 1.20 0.93 1.00 1.01 165.19 5.52 2.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 77 Y 0.43 1.18 1.20 0.93 0.99 1.01 181.19 5.52 -1.30 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 78 T 0.44 0.93 -0.50 0.88 0.99 1.05 119.12 5.19 -0.70 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 79 E 0.44 1.85 -0.46 0.88 0.99 1.06 147.13 4.00 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 80 L 0.43 2.05 1.71 0.93 0.99 1.05 131.17 5.52 3.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 81 Y 0.46 1.17 0.67 0.85 0.99 1.06 181.19 5.52 -1.30 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 82 Q 0.47 1.09 0.93 0.94 0.99 1.05 146.15 5.52 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 83 Q 0.46 2.20 1.24 1.04 1.00 1.05 146.15 5.52 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 84 L 0.48 1.16 1.24 1.04 1.01 1.05 131.17 5.52 3.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 85 N 0.51 1.16 2.63 0.99 1.01 1.00 132.12 5.52 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 86 D 0.48 0.68 2.07 0.94 1.00 1.01 133.10 3.80 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 87 L 0.48 0.44 1.41 0.97 0.98 1.07 131.17 5.52 3.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 88 E 0.48 0.20 2.20 0.96 0.96 1.09 147.13 4.00 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 89 A 0.50 0.09 0.06 0.80 0.94 1.14 89.09 5.57 1.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 90 C 0.50 0.18 -0.51 0.73 0.93 1.16 121.15 5.52 2.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 91 V 0.51 0.10 1.61 0.87 0.94 1.11 117.15 5.49 4.20 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 92 I 0.54 0.10 -0.10 0.85 0.95 1.10 131.17 5.52 4.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 93 Q 0.53 0.37 0.41 0.90 0.98 1.08 146.15 5.52 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 94 G 0.54 0.87 1.33 0.84 1.00 1.00 75.07 5.52 -0.40 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 95 M 0.56 2.08 3.29 0.97 1.02 0.93 149.21 5.28 1.90 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 96 K 0.57 1.61 5.36 1.11 1.04 0.91 146.19 8.75 -3.90 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 97 E 0.57 1.14 3.36 1.04 1.04 0.93 147.13 4.00 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 98 D 0.56 0.95 1.23 0.90 1.02 0.98 133.10 3.80 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 99 S 0.53 0.48 2.13 0.91 1.00 1.02 105.09 5.24 -0.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 100 I 0.52 0.21 0.79 0.84 0.96 1.08 131.17 5.52 4.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 101 L 0.53 0.24 0.27 0.87 0.94 1.09 131.17 5.52 3.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 102 A 0.51 0.36 -0.34 0.80 0.94 1.09 89.09 5.57 1.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 103 V 0.49 0.80 -1.54 0.76 0.96 1.12 117.15 5.49 4.20 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 104 R 0.48 0.84 -1.71 0.78 0.98 1.11 174.20 9.75 -4.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 105 K 0.48 1.45 0.46 0.83 0.99 1.07 146.19 8.75 -3.90 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 106 Y 0.46 3.82 0.76 0.88 0.99 1.05 181.19 5.52 -1.30 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 107 F 0.46 1.37 0.14 0.87 0.99 1.01 165.19 5.52 2.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 108 Q 0.49 0.99 0.29 0.87 0.99 1.02 146.15 5.52 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 109 R 0.48 0.52 -1.84 0.81 0.99 1.06 174.20 9.75 -4.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 110 I 0.44 0.94 -1.84 0.81 0.98 1.06 131.17 5.52 4.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 111 T 0.44 0.45 -1.84 0.81 0.96 1.09 119.12 5.19 -0.70 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 112 L 0.47 0.46 -1.89 0.82 0.95 1.08 131.17 5.52 3.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 113 Y 0.48 1.13 -1.37 0.79 0.95 1.07 181.19 5.52 -1.30 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 114 L 0.47 1.56 0.59 0.86 0.98 1.04 131.17 5.52 3.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 115 K 0.50 3.79 0.66 0.87 1.02 1.04 146.19 8.75 -3.90 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 116 E 0.49 3.79 1.70 0.95 1.05 1.03 147.13 4.00 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 117 K 0.48 6.16 2.90 0.99 1.06 1.01 146.19 8.75 -3.90 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 118 K 0.48 4.76 4.51 1.12 1.06 0.98 146.19 8.75 -3.90 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 119 Y 0.49 1.47 3.90 1.15 1.04 1.05 181.19 5.52 -1.30 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 120 S 0.48 0.74 3.09 1.14 1.01 1.08 105.09 5.24 -0.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 121 P 0.46 0.39 0.84 1.13 0.99 1.08 115.13 5.96 -1.60 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 122 C 0.45 0.43 1.14 1.09 0.95 1.07 121.15 5.52 2.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 123 A 0.41 0.24 0.89 1.00 0.94 1.10 89.09 5.57 1.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 124 W 0.40 0.11 -0.57 0.87 0.92 1.15 204.23 5.52 -0.90 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 125 E 0.39 0.42 -0.27 0.79 0.92 1.12 147.13 4.00 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 126 V 0.38 0.42 -0.17 0.71 0.93 1.07 117.15 5.49 4.20 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 127 V 0.36 0.69 0.64 0.72 0.94 1.04 117.15 5.49 4.20 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 128 R 0.39 0.28 0.93 0.65 0.94 1.08 174.20 9.75 -4.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 129 A 0.40 0.37 -0.79 0.63 0.94 1.08 89.09 5.57 1.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 130 E 0.39 0.99 0.34 0.70 0.94 1.00 147.13 4.00 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 131 I 0.37 0.67 1.80 0.83 0.94 0.95 131.17 5.52 4.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 132 M 0.40 0.58 -0.11 0.78 0.95 0.98 149.21 5.28 1.90 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 133 R 0.41 0.45 0.51 0.89 0.96 0.97 174.20 9.75 -4.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 134 S 0.41 0.53 -1.91 0.87 0.97 1.03 105.09 5.24 -0.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 135 F 0.42 0.71 0.16 1.00 0.97 1.01 165.19 5.52 2.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 136 S 0.45 0.52 1.50 1.06 0.98 1.02 105.09 5.24 -0.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 137 L 0.43 0.63 1.90 1.14 0.99 1.01 131.17 5.52 3.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 138 S 0.43 0.60 -0.34 1.02 1.00 1.04 105.09 5.24 -0.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 139 T 0.45 0.78 1.83 1.08 1.02 1.03 119.12 5.19 -0.70 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 140 N 0.47 1.63 2.01 0.98 1.02 1.01 132.12 5.52 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 141 L 0.45 1.63 4.26 1.10 1.02 0.97 131.17 5.52 3.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 142 Q 0.39 0.93 2.01 0.98 0.00 1.01 146.15 5.52 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 143 E 0.36 0.00 0.00 0.00 0.00 0.00 147.13 4.00 -3.50 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 144 S 0.29 0.00 0.00 0.00 0.00 0.00 105.09 5.24 -0.80 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 145 L 0.24 0.00 0.00 0.00 0.00 0.00 131.17 5.52 3.80
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/command-epifinder-topology.tsv Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,28 @@ +N Id Method Threshold Avg Score Cover Epitope Start End N-Glyc N-Glyc-Count N-Glyc-Motifs Length kDa I.P Avg Hydropathy Avg Cover +1 4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation BepiPred-2.0 0.60 0.65 - PETQSSHSAW 73 83 N 0 - 10 1.13 5.25 -1.40 0.98 + Emini 0.80 2.57 0.90 EEEEEEEEE. + Parker 0.80 4.19 1.00 EEEEEEEEEE + Chou Fosman 0.80 1.13 1.00 EEEEEEEEEE + Karplus Schulz 0.80 1.04 1.00 EEEEEEEEEE + Kolaskar 0.80 0.99 1.00 EEEEEEEEEE + All matches - - 0.90 EEEEEEEEE. + N-Glyc - - - .......... + Hydropathy - -1.40 - --------+- +2 4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation BepiPred-2.0 0.60 0.64 - AIFLKWHVPPELVR 149 163 N 0 - 14 1.71 8.80 0.42 0.60 + Emini 0.80 0.82 0.43 .....EEEE.EE.. + Parker 0.80 -1.83 0.07 .......E...... + Chou Fosman 0.80 0.83 0.50 .....EEEEEEE.. + Karplus Schulz 0.80 0.96 1.00 EEEEEEEEEEEEEE + Kolaskar 0.80 1.10 1.00 EEEEEEEEEEEEEE + All matches - - 0.07 .......E...... + N-Glyc - - - .............. + Hydropathy - 0.42 - ++++---+---++- +3 4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation BepiPred-2.0 0.60 0.63 - LKWHVPPELVRVLSA 150 165 N 0 - 15 1.74 8.75 0.39 0.59 + Emini 0.80 0.81 0.40 ..EEEE.EE...... + Parker 0.80 -1.70 0.07 ....E.......... + Chou Fosman 0.80 0.84 0.47 ..EEEEEEE...... + Karplus Schulz 0.80 0.96 1.00 EEEEEEEEEEEEEEE + Kolaskar 0.80 1.11 1.00 EEEEEEEEEEEEEEE + All matches - - 0.07 ....E.......... + N-Glyc - - - ............... + Hydropathy - 0.39 - +---+---++-++-+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/command-epifinder.log Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,14 @@ +makeblastdb -dbtype prot -in /usr/local/bioinfo/stingrayGalaxy/tools/stingray/epifinder/test-data/proteom.fasta -out ./command-test_proteom Success: + + +Building a new DB, current time: 03/20/2021 00:04:04 +New DB name: /usr/local/bioinfo/stingrayGalaxy/tools/stingray/epifinder/command-test_proteom +New DB title: /usr/local/bioinfo/stingrayGalaxy/tools/stingray/epifinder/test-data/proteom.fasta +Sequence type: Protein +Keep Linkouts: T +Keep MBits: T +Maximum file size: 1000000000B +Adding sequences from FASTA; added 6 sequences in 0.00420094 seconds. +Error: +blastp -query ./command-epifinder-epitopes-fasta.fasta -db ./command-test_proteom -outfmt 6 qacc sacc pident qcovs qseq sseq qacc -task blastp-short -word_size 4 -out ./command-test_proteom_blast.csv Success: +Error:
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/command-epifinder.txt Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,80 @@ + +---- Running Parameters ---- +BepiPred-2.0 Threshold : 0.6 +Min epitope length : 10 +Max epitope length : 30 + +---- Softwares Threshold ---- +Emini : 0.8 +Parker : 0.8 +Chou Fosman : 0.8 +Karplus Schulz : 0.8 +Kolaskar : 0.8 + +---- Proteomes ---- +Alias File +test_proteom /usr/local/bioinfo/stingrayGalaxy/tools/stingray/epifinder/test-data/proteom.fasta + +---- Blast ---- +Identity : 90.0 +Cover : 90.0 +Word size : 4 +Task blastp-short: blastp-short + +---- Stats ---- +Processed proteins : 6 +NGlycosylated proteins : 0 +Identified epitopes : 3 +N-glycosylated epitopes: 0 + +---- Protein Summary ---- +Id Epitopes N-Glyc +5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta 0 0 +4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD 0 0 +4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation 1 0 +4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 2 0 +5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. 0 0 +4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 0 0 + +---- Epitopes list ---- +N Id Epitope Start End N-Glyc N-Glyc-Count N-Glyc-Motifs Length MW(kDa) I.P Hydropathy All Matches Cover Avg Cover BepiPred2 Emini Parker Chou Fosman Karplus Schulz Kolaskar test_proteom_count test_proteom_acc test_proteom_count test_proteom_id +1 4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation PETQSSHSAW 73 83 N 0 - 10 1.13 5.25 -1.40 0.90 0.98 0.65 2.57 4.19 1.13 1.04 0.99 1 4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 1 4WFF_B(100.00,100.00) +2 4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation AIFLKWHVPPELVR 149 163 N 0 - 14 1.71 8.80 0.42 0.07 0.60 0.64 0.82 -1.83 0.83 0.96 1.10 2 4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation,4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 2 4WFF_B(100.00,100.00),4WFF_A(100.00,100.00) +3 4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation LKWHVPPELVRVLSA 150 165 N 0 - 15 1.74 8.75 0.39 0.07 0.59 0.63 0.81 -1.70 0.84 0.96 1.11 2 4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation,4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 2 4WFF_B(100.00,100.00),4WFF_A(100.00,100.00) + +---- Epitopes topology ---- +N Id Method Threshold Avg Score Cover Epitope Start End N-Glyc N-Glyc-Count N-Glyc-Motifs Length kDa I.P Avg Hydropathy Avg Cover +1 4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation BepiPred-2.0 0.60 0.65 - PETQSSHSAW 73 83 N 0 - 10 1.13 5.25 -1.40 0.98 + Emini 0.80 2.57 0.90 EEEEEEEEE. + Parker 0.80 4.19 1.00 EEEEEEEEEE + Chou Fosman 0.80 1.13 1.00 EEEEEEEEEE + Karplus Schulz 0.80 1.04 1.00 EEEEEEEEEE + Kolaskar 0.80 0.99 1.00 EEEEEEEEEE + All matches - - 0.90 EEEEEEEEE. + N-Glyc - - - .......... + Hydropathy - -1.40 - --------+- +2 4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation BepiPred-2.0 0.60 0.64 - AIFLKWHVPPELVR 149 163 N 0 - 14 1.71 8.80 0.42 0.60 + Emini 0.80 0.82 0.43 .....EEEE.EE.. + Parker 0.80 -1.83 0.07 .......E...... + Chou Fosman 0.80 0.83 0.50 .....EEEEEEE.. + Karplus Schulz 0.80 0.96 1.00 EEEEEEEEEEEEEE + Kolaskar 0.80 1.10 1.00 EEEEEEEEEEEEEE + All matches - - 0.07 .......E...... + N-Glyc - - - .............. + Hydropathy - 0.42 - ++++---+---++- +3 4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation BepiPred-2.0 0.60 0.63 - LKWHVPPELVRVLSA 150 165 N 0 - 15 1.74 8.75 0.39 0.59 + Emini 0.80 0.81 0.40 ..EEEE.EE...... + Parker 0.80 -1.70 0.07 ....E.......... + Chou Fosman 0.80 0.84 0.47 ..EEEEEEE...... + Karplus Schulz 0.80 0.96 1.00 EEEEEEEEEEEEEEE + Kolaskar 0.80 1.11 1.00 EEEEEEEEEEEEEEE + All matches - - 0.07 ....E.......... + N-Glyc - - - ............... + Hydropathy - 0.39 - +---+---++-++-+ +Generated files: + ./command-epifinder-parameters.txt + ./command-epifinder-protein-summary.tsv + ./command-epifinder-topology.tsv + ./command-epifinder-epitope-detail.tsv + ./command-epifinder-scores.tsv + ./command-epifinder-epitopes-fasta.fasta \ No newline at end of file
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/command-test_proteom_blast.csv Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,6 @@ +qacc sacc pident qcovs qseq sseq qacc +1-PETQSSHSAW 4WFF_B 100.00 100 PETQSSHSAW PETQSSHSAW +2-AIFLKWHVPPELVR 4WFF_B 100.00 100 AIFLKWHVPPELVR AIFLKWHVPPELVR +2-AIFLKWHVPPELVR 4WFF_A 100.00 100 AIFLKWHVPPELVR AIFLKWHVPPELVR +3-LKWHVPPELVRVLSA 4WFF_B 100.00 100 LKWHVPPELVRVLSA LKWHVPPELVRVLSA +3-LKWHVPPELVRVLSA 4WFF_A 100.00 100 LKWHVPPELVRVLSA LKWHVPPELVRVLSA
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/input_bcell_command_line.txt Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,1153 @@ +input: 5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. +Position Residue Score Assignment +0 C 0.243 E +1 D 0.294 E +2 A 0.340 E +3 F 0.402 E +4 V 0.452 E +5 G 0.469 E +6 T 0.488 E +7 W 0.502 E +8 K 0.522 E +9 L 0.533 E +10 V 0.554 E +11 S 0.562 E +12 S 0.573 E +13 E 0.582 E +14 N 0.576 E +15 F 0.554 E +16 D 0.546 E +17 D 0.545 E +18 Y 0.535 E +19 M 0.529 E +20 K 0.527 E +21 E 0.520 E +22 V 0.526 E +23 G 0.536 E +24 V 0.547 E +25 G 0.548 E +26 F 0.544 E +27 A 0.542 E +28 T 0.517 E +29 R 0.525 E +30 K 0.521 E +31 V 0.512 E +32 A 0.510 E +33 G 0.508 E +34 M 0.497 E +35 A 0.479 E +36 K 0.472 E +37 P 0.463 E +38 N 0.452 E +39 M 0.450 E +40 I 0.453 E +41 I 0.448 E +42 S 0.458 E +43 V 0.468 E +44 N 0.468 E +45 G 0.466 E +46 D 0.467 E +47 L 0.467 E +48 V 0.460 E +49 T 0.457 E +50 I 0.454 E +51 R 0.447 E +52 S 0.448 E +53 E 0.469 E +54 S 0.486 E +55 T 0.502 E +56 F 0.508 E +57 K 0.509 E +58 N 0.501 E +59 T 0.486 E +60 E 0.477 E +61 I 0.473 E +62 S 0.458 E +63 F 0.454 E +64 K 0.464 E +65 L 0.462 E +66 G 0.468 E +67 V 0.489 E +68 E 0.519 E +69 F 0.531 E +70 D 0.538 E +71 E 0.556 E +72 I 0.569 E +73 T 0.582 E +74 A 0.589 E +75 D 0.577 E +76 D 0.557 E +77 R 0.543 E +78 K 0.523 E +79 V 0.494 E +80 K 0.475 E +81 S 0.455 E +82 I 0.432 E +83 I 0.421 E +84 T 0.427 E +85 L 0.427 E +86 D 0.426 E +87 G 0.437 E +88 G 0.461 E +89 A 0.458 E +90 L 0.473 E +91 V 0.486 E +92 Q 0.502 E +93 V 0.515 E +94 Q 0.529 E +95 K 0.540 E +96 W 0.547 E +97 D 0.551 E +98 G 0.560 E +99 K 0.551 E +100 S 0.547 E +101 T 0.543 E +102 T 0.530 E +103 I 0.520 E +104 K 0.515 E +105 R 0.505 E +106 K 0.505 E +107 R 0.507 E +108 D 0.499 E +109 G 0.490 E +110 D 0.468 E +111 K 0.458 E +112 L 0.438 E +113 V 0.433 E +114 V 0.433 E +115 E 0.426 E +116 C 0.415 E +117 V 0.413 E +118 M 0.415 E +119 K 0.424 E +120 G 0.426 E +121 V 0.448 E +122 T 0.442 E +123 S 0.436 E +124 T 0.439 E +125 R 0.447 E +126 V 0.453 E +127 Y 0.401 E +128 E 0.353 E +129 R 0.308 E +130 A 0.251 E +input: 5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta +Position Residue Score Assignment +0 V 0.228 E +1 R 0.273 E +2 S 0.308 E +3 L 0.333 E +4 N 0.388 E +5 C 0.399 E +6 T 0.409 E +7 L 0.419 E +8 R 0.440 E +9 D 0.451 E +10 S 0.456 E +11 Q 0.449 E +12 Q 0.450 E +13 K 0.430 E +14 S 0.433 E +15 L 0.430 E +16 V 0.424 E +17 M 0.415 E +18 S 0.406 E +19 G 0.390 E +20 P 0.414 E +21 Y 0.415 E +22 E 0.427 E +23 L 0.425 E +24 K 0.425 E +25 A 0.439 E +26 L 0.456 E +27 H 0.482 E +28 L 0.523 E +29 Q 0.540 E +30 G 0.576 E +31 Q 0.591 E +32 D 0.609 E +33 M 0.600 E +34 E 0.582 E +35 Q 0.542 E +36 Q 0.512 E +37 V 0.469 E +38 V 0.456 E +39 F 0.437 E +40 S 0.421 E +41 M 0.414 E +42 S 0.436 E +43 F 0.459 E +44 V 0.502 E +45 Q 0.525 E +46 G 0.552 E +47 E 0.559 E +48 E 0.575 E +49 S 0.584 E +50 N 0.559 E +51 D 0.524 E +52 K 0.485 E +53 I 0.448 E +54 P 0.417 E +55 V 0.394 E +56 A 0.388 E +57 L 0.385 E +58 G 0.388 E +59 L 0.405 E +60 K 0.428 E +61 E 0.439 E +62 K 0.442 E +63 N 0.440 E +64 L 0.441 E +65 Y 0.434 E +66 L 0.429 E +67 S 0.426 E +68 C 0.427 E +69 V 0.428 E +70 L 0.435 E +71 K 0.448 E +72 D 0.460 E +73 D 0.453 E +74 K 0.454 E +75 P 0.439 E +76 T 0.448 E +77 L 0.459 E +78 Q 0.477 E +79 L 0.490 E +80 E 0.500 E +81 S 0.521 E +82 V 0.553 E +83 D 0.562 E +84 P 0.591 E +85 K 0.591 E +86 N 0.587 E +87 Y 0.579 E +88 P 0.559 E +89 K 0.550 E +90 K 0.534 E +91 K 0.523 E +92 M 0.513 E +93 E 0.492 E +94 K 0.475 E +95 R 0.460 E +96 F 0.446 E +97 V 0.460 E +98 F 0.471 E +99 N 0.485 E +100 K 0.499 E +101 I 0.512 E +102 E 0.538 E +103 I 0.543 E +104 N 0.559 E +105 N 0.539 E +106 K 0.536 E +107 L 0.510 E +108 E 0.490 E +109 F 0.477 E +110 E 0.469 E +111 S 0.448 E +112 A 0.447 E +113 Q 0.418 E +114 F 0.422 E +115 P 0.394 E +116 N 0.385 E +117 W 0.376 E +118 Y 0.370 E +119 I 0.383 E +120 S 0.391 E +121 T 0.406 E +122 S 0.433 E +123 Q 0.448 E +124 A 0.474 E +125 E 0.481 E +126 N 0.491 E +127 M 0.475 E +128 P 0.451 E +129 V 0.453 E +130 F 0.454 E +131 L 0.456 E +132 G 0.473 E +133 G 0.488 E +134 G 0.508 E +135 G 0.516 E +136 Q 0.540 E +137 D 0.535 E +138 I 0.521 E +139 T 0.493 E +140 D 0.485 E +141 F 0.478 E +142 T 0.468 E +143 M 0.466 E +144 Q 0.471 E +145 F 0.414 E +146 V 0.376 E +147 S 0.328 E +148 S 0.290 E +input: 4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD +Position Residue Score Assignment +0 V 0.269 E +1 E 0.332 E +2 C 0.394 E +3 D 0.452 E +4 F 0.519 E +5 S 0.526 E +6 P 0.542 E +7 L 0.539 E +8 L 0.532 E +9 S 0.525 E +10 G 0.525 E +11 T 0.519 E +12 P 0.523 E +13 P 0.513 E +14 Q 0.501 E +15 V 0.501 E +16 Y 0.503 E +17 N 0.505 E +18 F 0.505 E +19 K 0.493 E +20 R 0.489 E +21 L 0.495 E +22 V 0.501 E +23 F 0.521 E +24 T 0.531 E +25 N 0.544 E +26 C 0.542 E +27 N 0.548 E +28 Y 0.565 E +29 N 0.561 E +30 L 0.559 E +31 T 0.560 E +32 K 0.548 E +33 L 0.552 E +34 L 0.550 E +35 S 0.556 E +36 L 0.569 E +37 F 0.566 E +38 S 0.579 E +39 V 0.580 E +40 N 0.571 E +41 D 0.576 E +42 F 0.573 E +43 T 0.564 E +44 C 0.569 E +45 S 0.551 E +46 Q 0.542 E +47 I 0.538 E +48 S 0.518 E +49 P 0.512 E +50 A 0.513 E +51 A 0.511 E +52 I 0.522 E +53 A 0.530 E +54 S 0.545 E +55 N 0.554 E +56 C 0.562 E +57 Y 0.570 E +58 S 0.577 E +59 S 0.567 E +60 L 0.558 E +61 I 0.547 E +62 L 0.536 E +63 D 0.531 E +64 Y 0.519 E +65 F 0.515 E +66 S 0.525 E +67 Y 0.536 E +68 P 0.549 E +69 L 0.562 E +70 S 0.572 E +71 M 0.582 E +72 K 0.593 E +73 S 0.610 E +74 D 0.628 E +75 L 0.625 E +76 S 0.618 E +77 V 0.608 E +78 S 0.590 E +79 S 0.582 E +80 A 0.579 E +81 G 0.568 E +82 P 0.563 E +83 I 0.549 E +84 S 0.547 E +85 Q 0.555 E +86 F 0.569 E +87 N 0.581 E +88 Y 0.578 E +89 K 0.582 E +90 Q 0.582 E +91 S 0.572 E +92 F 0.568 E +93 S 0.569 E +94 N 0.561 E +95 P 0.536 E +96 T 0.525 E +97 C 0.516 E +98 L 0.507 E +99 I 0.500 E +100 L 0.505 E +101 A 0.511 E +102 T 0.520 E +103 V 0.513 E +104 P 0.523 E +105 H 0.534 E +106 N 0.538 E +107 L 0.531 E +108 T 0.539 E +109 T 0.529 E +110 I 0.518 E +111 T 0.501 E +112 K 0.510 E +113 P 0.504 E +114 L 0.499 E +115 K 0.507 E +116 Y 0.520 E +117 S 0.525 E +118 Y 0.532 E +119 I 0.534 E +120 N 0.547 E +121 K 0.545 E +122 C 0.558 E +123 S 0.556 E +124 R 0.560 E +125 F 0.559 E +126 L 0.557 E +127 S 0.559 E +128 D 0.556 E +129 D 0.539 E +130 R 0.532 E +131 T 0.532 E +132 E 0.530 E +133 V 0.527 E +134 P 0.533 E +135 Q 0.527 E +136 L 0.552 E +137 V 0.570 E +138 N 0.591 E +139 A 0.607 E +140 N 0.604 E +141 Q 0.604 E +142 Y 0.603 E +143 S 0.588 E +144 P 0.582 E +145 C 0.549 E +146 V 0.523 E +147 S 0.512 E +148 I 0.506 E +149 V 0.505 E +150 P 0.514 E +151 S 0.512 E +152 T 0.512 E +153 V 0.512 E +154 W 0.521 E +155 E 0.522 E +156 D 0.518 E +157 G 0.505 E +158 D 0.517 E +159 Y 0.520 E +160 Y 0.522 E +161 R 0.528 E +162 K 0.532 E +163 Q 0.530 E +164 L 0.545 E +165 S 0.547 E +166 P 0.558 E +167 L 0.546 E +168 E 0.539 E +169 G 0.540 E +170 G 0.540 E +171 G 0.544 E +172 W 0.562 E +173 L 0.558 E +174 V 0.580 E +175 A 0.583 E +176 S 0.589 E +177 G 0.597 E +178 S 0.610 E +179 T 0.616 E +180 V 0.628 E +181 A 0.627 E +182 M 0.626 E +183 T 0.621 E +184 E 0.627 E +185 Q 0.623 E +186 L 0.607 E +187 Q 0.589 E +188 M 0.571 E +189 G 0.556 E +190 F 0.545 E +191 G 0.551 E +192 I 0.549 E +193 T 0.542 E +194 V 0.548 E +195 Q 0.558 E +196 Y 0.572 E +197 G 0.587 E +198 T 0.587 E +199 T 0.584 E +200 N 0.574 E +201 S 0.567 E +202 V 0.564 E +203 C 0.570 E +204 P 0.564 E +205 K 0.560 E +206 L 0.495 E +207 E 0.437 E +208 F 0.378 E +209 A 0.320 E +input: 4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation +Position Residue Score Assignment +0 R 0.182 E +1 S 0.223 E +2 T 0.268 E +3 T 0.291 E +4 L 0.316 E +5 L 0.313 E +6 A 0.310 E +7 L 0.295 E +8 L 0.285 E +9 A 0.279 E +10 L 0.269 E +11 V 0.252 E +12 L 0.251 E +13 L 0.266 E +14 Y 0.276 E +15 L 0.291 E +16 V 0.313 E +17 S 0.324 E +18 G 0.309 E +19 A 0.328 E +20 L 0.351 E +21 V 0.358 E +22 F 0.366 E +23 R 0.398 E +24 A 0.426 E +25 L 0.440 E +26 E 0.464 E +27 Q 0.507 E +28 P 0.524 E +29 H 0.533 E +30 E 0.572 E +31 Q 0.593 E +32 Q 0.591 E +33 A 0.574 E +34 Q 0.574 E +35 R 0.572 E +36 E 0.572 E +37 L 0.566 E +38 G 0.575 E +39 E 0.566 E +40 V 0.537 E +41 R 0.528 E +42 E 0.548 E +43 K 0.549 E +44 F 0.545 E +45 L 0.541 E +46 R 0.542 E +47 A 0.536 E +48 H 0.541 E +49 P 0.567 E +50 C 0.572 E +51 V 0.584 E +52 S 0.577 E +53 D 0.583 E +54 Q 0.577 E +55 E 0.550 E +56 L 0.533 E +57 G 0.526 E +58 L 0.507 E +59 L 0.471 E +60 I 0.444 E +61 K 0.443 E +62 E 0.432 E +63 V 0.416 E +64 A 0.443 E +65 D 0.455 E +66 A 0.463 E +67 L 0.473 E +68 G 0.514 E +69 G 0.532 E +70 G 0.553 E +71 A 0.588 E +72 D 0.623 E +73 P 0.631 E +74 E 0.647 E +75 T 0.651 E +76 S 0.653 E +77 H 0.645 E +78 S 0.627 E +79 A 0.610 E +80 W 0.577 E +81 D 0.544 E +82 L 0.519 E +83 G 0.493 E +84 S 0.457 E +85 A 0.424 E +86 F 0.395 E +87 F 0.380 E +88 F 0.353 E +89 S 0.339 E +90 G 0.338 E +91 T 0.348 E +92 I 0.365 E +93 I 0.394 E +94 T 0.435 E +95 T 0.477 E +96 I 0.501 E +97 G 0.534 E +98 Y 0.562 E +99 G 0.573 E +100 N 0.595 E +101 V 0.583 E +102 A 0.581 E +103 L 0.573 E +104 R 0.549 E +105 T 0.538 E +106 D 0.520 E +107 A 0.490 E +108 G 0.467 E +109 R 0.417 E +110 L 0.389 E +111 F 0.357 E +112 C 0.321 E +113 I 0.301 E +114 F 0.277 E +115 Y 0.263 E +116 A 0.260 E +117 L 0.270 E +118 V 0.277 E +119 G 0.286 E +120 I 0.289 E +121 P 0.310 E +122 L 0.316 E +123 F 0.322 E +124 G 0.329 E +125 I 0.339 E +126 L 0.347 E +127 L 0.366 E +128 A 0.393 E +129 G 0.430 E +130 V 0.444 E +131 G 0.458 E +132 D 0.472 E +133 R 0.484 E +134 L 0.485 E +135 G 0.504 E +136 S 0.510 E +137 S 0.500 E +138 L 0.497 E +139 R 0.493 E +140 H 0.499 E +141 G 0.505 E +142 I 0.518 E +143 G 0.529 E +144 H 0.526 E +145 I 0.528 E +146 E 0.543 E +147 A 0.550 E +148 I 0.567 E +149 F 0.585 E +150 L 0.604 E +151 K 0.606 E +152 W 0.617 E +153 H 0.628 E +154 V 0.644 E +155 P 0.648 E +156 P 0.664 E +157 E 0.648 E +158 L 0.642 E +159 V 0.638 E +160 R 0.630 E +161 V 0.627 E +162 L 0.619 E +163 S 0.607 E +164 A 0.604 E +165 M 0.569 E +166 L 0.564 E +167 F 0.532 E +168 L 0.493 E +169 L 0.466 E +170 I 0.433 E +171 G 0.401 E +172 C 0.356 E +173 L 0.305 E +174 L 0.282 E +175 F 0.261 E +176 V 0.255 E +177 L 0.261 E +178 T 0.262 E +179 P 0.263 E +180 T 0.271 E +181 F 0.304 E +182 V 0.342 E +183 F 0.379 E +184 C 0.420 E +185 Y 0.445 E +186 M 0.481 E +187 E 0.509 E +188 D 0.532 E +189 W 0.540 E +190 S 0.528 E +191 K 0.515 E +192 L 0.470 E +193 E 0.427 E +194 A 0.393 E +195 I 0.352 E +196 Y 0.320 E +197 F 0.288 E +198 V 0.262 E +199 V 0.253 E +200 T 0.243 E +201 L 0.258 E +202 T 0.280 E +203 T 0.318 E +204 V 0.345 E +205 G 0.372 E +206 F 0.404 E +207 G 0.431 E +208 D 0.459 E +209 Y 0.488 E +210 V 0.513 E +211 A 0.538 E +212 G 0.559 E +213 A 0.578 E +214 D 0.591 E +215 P 0.602 E +216 R 0.624 E +217 Q 0.639 E +218 D 0.638 E +219 S 0.631 E +220 P 0.607 E +221 A 0.579 E +222 Y 0.545 E +223 Q 0.519 E +224 P 0.487 E +225 L 0.446 E +226 V 0.400 E +227 W 0.365 E +228 F 0.329 E +229 W 0.304 E +230 I 0.282 E +231 L 0.281 E +232 L 0.288 E +233 G 0.281 E +234 L 0.274 E +235 A 0.285 E +236 Y 0.293 E +237 F 0.317 E +238 A 0.339 E +239 S 0.367 E +240 V 0.360 E +241 L 0.349 E +242 T 0.374 E +243 T 0.406 E +244 I 0.403 E +245 G 0.427 E +246 N 0.435 E +247 W 0.426 E +248 L 0.372 E +249 R 0.337 E +250 V 0.296 E +251 V 0.243 E +input: 4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation +Position Residue Score Assignment +0 R 0.185 E +1 S 0.226 E +2 T 0.274 E +3 T 0.297 E +4 L 0.323 E +5 L 0.319 E +6 A 0.314 E +7 L 0.300 E +8 L 0.291 E +9 A 0.286 E +10 L 0.275 E +11 V 0.255 E +12 L 0.253 E +13 L 0.269 E +14 Y 0.281 E +15 L 0.297 E +16 V 0.318 E +17 S 0.327 E +18 G 0.314 E +19 A 0.333 E +20 L 0.360 E +21 V 0.368 E +22 F 0.375 E +23 R 0.406 E +24 A 0.438 E +25 L 0.455 E +26 E 0.484 E +27 Q 0.526 E +28 P 0.543 E +29 H 0.551 E +30 E 0.589 E +31 Q 0.610 E +32 Q 0.609 E +33 A 0.586 E +34 Q 0.581 E +35 R 0.576 E +36 E 0.577 E +37 L 0.570 E +38 G 0.581 E +39 E 0.575 E +40 V 0.548 E +41 R 0.528 E +42 E 0.551 E +43 K 0.552 E +44 F 0.546 E +45 L 0.537 E +46 R 0.538 E +47 A 0.531 E +48 H 0.534 E +49 P 0.556 E +50 C 0.569 E +51 V 0.578 E +52 S 0.573 E +53 D 0.577 E +54 Q 0.575 E +55 E 0.546 E +56 L 0.520 E +57 G 0.509 E +58 L 0.490 E +59 L 0.456 E +60 I 0.426 E +61 K 0.424 E +62 E 0.413 E +63 V 0.393 E +64 A 0.418 E +65 D 0.436 E +66 A 0.444 E +67 L 0.442 E +68 G 0.480 E +69 G 0.503 E +70 G 0.523 E +71 A 0.552 E +72 D 0.591 E +73 P 0.618 E +74 E 0.634 E +75 T 0.649 E +76 Q 0.682 E +77 S 0.682 E +78 S 0.684 E +79 H 0.673 E +80 S 0.651 E +81 A 0.632 E +82 W 0.607 E +83 D 0.587 E +84 L 0.553 E +85 G 0.535 E +86 S 0.516 E +87 A 0.482 E +88 F 0.458 E +89 F 0.434 E +90 F 0.403 E +91 S 0.371 E +92 G 0.349 E +93 T 0.357 E +94 I 0.350 E +95 I 0.355 E +96 T 0.375 E +97 T 0.405 E +98 I 0.441 E +99 G 0.478 E +100 Y 0.524 E +101 G 0.569 E +102 N 0.598 E +103 V 0.602 E +104 A 0.619 E +105 L 0.623 E +106 R 0.621 E +107 T 0.616 E +108 D 0.603 E +109 A 0.576 E +110 G 0.541 E +111 R 0.497 E +112 L 0.463 E +113 F 0.425 E +114 C 0.390 E +115 I 0.347 E +116 F 0.316 E +117 Y 0.294 E +118 A 0.282 E +119 L 0.284 E +120 V 0.287 E +121 G 0.299 E +122 I 0.300 E +123 P 0.313 E +124 L 0.324 E +125 F 0.329 E +126 G 0.338 E +127 I 0.352 E +128 L 0.362 E +129 L 0.381 E +130 A 0.403 E +131 G 0.440 E +132 V 0.464 E +133 G 0.484 E +134 D 0.501 E +135 R 0.524 E +136 L 0.538 E +137 G 0.553 E +138 S 0.555 E +139 S 0.555 E +140 L 0.549 E +141 R 0.542 E +142 H 0.547 E +143 G 0.553 E +144 I 0.563 E +145 G 0.564 E +146 H 0.573 E +147 I 0.590 E +148 E 0.593 E +149 A 0.602 E +150 I 0.616 E +151 F 0.629 E +152 L 0.644 E +153 K 0.637 E +154 W 0.641 E +155 H 0.642 E +156 V 0.640 E +157 P 0.649 E +158 P 0.665 E +159 E 0.654 E +160 L 0.645 E +161 V 0.631 E +162 R 0.619 E +163 V 0.598 E +164 L 0.577 E +165 S 0.557 E +166 A 0.548 E +167 M 0.522 E +168 L 0.533 E +169 F 0.527 E +170 L 0.529 E +171 L 0.545 E +172 I 0.559 E +173 G 0.562 E +174 C 0.549 E +175 L 0.517 E +176 L 0.485 E +177 F 0.447 E +178 V 0.429 E +179 L 0.411 E +180 T 0.391 E +181 P 0.387 E +182 T 0.387 E +183 F 0.407 E +184 V 0.438 E +185 F 0.471 E +186 C 0.503 E +187 Y 0.524 E +188 M 0.538 E +189 E 0.543 E +190 D 0.530 E +191 W 0.526 E +192 S 0.505 E +193 K 0.479 E +194 L 0.454 E +195 E 0.413 E +196 A 0.371 E +197 I 0.335 E +198 Y 0.302 E +199 F 0.281 E +200 V 0.254 E +201 I 0.255 E +202 V 0.260 E +203 T 0.267 E +204 L 0.287 E +205 T 0.318 E +206 T 0.355 E +207 V 0.387 E +208 G 0.421 E +209 F 0.451 E +210 G 0.461 E +211 D 0.478 E +212 Y 0.493 E +213 V 0.513 E +214 A 0.538 E +215 G 0.558 E +216 A 0.578 E +217 D 0.592 E +218 P 0.604 E +219 R 0.626 E +220 Q 0.640 E +221 D 0.637 E +222 S 0.628 E +223 P 0.603 E +224 A 0.572 E +225 Y 0.538 E +226 Q 0.511 E +227 P 0.480 E +228 L 0.441 E +229 V 0.398 E +230 W 0.368 E +231 F 0.337 E +232 W 0.312 E +233 I 0.289 E +234 L 0.289 E +235 L 0.297 E +236 G 0.288 E +237 L 0.279 E +238 A 0.286 E +239 Y 0.290 E +240 F 0.304 E +241 A 0.325 E +242 S 0.350 E +243 V 0.349 E +244 L 0.335 E +245 T 0.357 E +246 T 0.390 E +247 I 0.397 E +248 G 0.413 E +249 N 0.374 E +250 W 0.329 E +251 L 0.278 E +252 R 0.237 E +input: 4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 +Position Residue Score Assignment +0 L 0.257 E +1 G 0.312 E +2 S 0.367 E +3 R 0.427 E +4 R 0.476 E +5 T 0.462 E +6 L 0.471 E +7 M 0.472 E +8 L 0.444 E +9 L 0.458 E +10 A 0.472 E +11 Q 0.484 E +12 M 0.492 E +13 R 0.505 E +14 K 0.544 E +15 I 0.553 E +16 S 0.552 E +17 L 0.588 E +18 F 0.578 E +19 S 0.571 E +20 C 0.572 E +21 L 0.575 E +22 K 0.579 E +23 D 0.564 E +24 R 0.569 E +25 H 0.568 E +26 D 0.555 E +27 F 0.552 E +28 G 0.550 E +29 F 0.542 E +30 P 0.533 E +31 Q 0.542 E +32 E 0.554 E +33 E 0.562 E +34 F 0.583 E +35 G 0.602 E +36 N 0.603 E +37 Q 0.605 E +38 F 0.608 E +39 Q 0.600 E +40 K 0.568 E +41 A 0.552 E +42 E 0.509 E +43 T 0.464 E +44 I 0.439 E +45 P 0.414 E +46 V 0.378 E +47 L 0.349 E +48 H 0.343 E +49 E 0.352 E +50 M 0.338 E +51 I 0.355 E +52 Q 0.391 E +53 Q 0.377 E +54 I 0.377 E +55 F 0.409 E +56 N 0.438 E +57 L 0.461 E +58 F 0.491 E +59 S 0.535 E +60 T 0.563 E +61 K 0.575 E +62 D 0.604 E +63 S 0.621 E +64 S 0.624 E +65 A 0.626 E +66 A 0.617 E +67 W 0.593 E +68 D 0.556 E +69 E 0.530 E +70 T 0.517 E +71 L 0.479 E +72 L 0.478 E +73 D 0.467 E +74 K 0.449 E +75 F 0.417 E +76 Y 0.426 E +77 T 0.442 E +78 E 0.443 E +79 L 0.434 E +80 Y 0.463 E +81 Q 0.468 E +82 Q 0.458 E +83 L 0.484 E +84 N 0.508 E +85 D 0.476 E +86 L 0.476 E +87 E 0.482 E +88 A 0.497 E +89 C 0.502 E +90 V 0.512 E +91 I 0.535 E +92 Q 0.528 E +93 G 0.538 E +94 M 0.560 E +95 K 0.568 E +96 E 0.570 E +97 D 0.560 E +98 S 0.531 E +99 I 0.524 E +100 L 0.525 E +101 A 0.513 E +102 V 0.486 E +103 R 0.482 E +104 K 0.480 E +105 Y 0.455 E +106 F 0.456 E +107 Q 0.486 E +108 R 0.476 E +109 I 0.444 E +110 T 0.444 E +111 L 0.468 E +112 Y 0.480 E +113 L 0.472 E +114 K 0.495 E +115 E 0.491 E +116 K 0.480 E +117 K 0.481 E +118 Y 0.485 E +119 S 0.475 E +120 P 0.463 E +121 C 0.445 E +122 A 0.414 E +123 W 0.402 E +124 E 0.394 E +125 V 0.384 E +126 V 0.362 E +127 R 0.389 E +128 A 0.398 E +129 E 0.387 E +130 I 0.370 E +131 M 0.400 E +132 R 0.411 E +133 S 0.405 E +134 F 0.423 E +135 S 0.446 E +136 L 0.429 E +137 S 0.432 E +138 T 0.446 E +139 N 0.468 E +140 L 0.447 E +141 Q 0.392 E +142 E 0.355 E +143 S 0.294 E +144 L 0.242 E +
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/input_bepi_online.csv Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,1142 @@ +Entry,Position,AminoAcid,Exposed/Buried,RelativeSurfaceAccessilibity,HelixProbability,SheetProbability,CoilProbability,EpitopeProbability +5C0N_A,1,C,E,0.705,0.005,0.015,0.979,0.250333333333 +5C0N_A,2,D,E,0.657,0.020,0.205,0.775,0.308444444444 +5C0N_A,3,A,E,0.441,0.021,0.279,0.699,0.353 +5C0N_A,4,F,B,0.16,0.004,0.514,0.481,0.415555555556 +5C0N_A,5,V,E,0.422,0.004,0.514,0.481,0.469777777778 +5C0N_A,6,G,B,0.126,0.003,0.718,0.279,0.480777777778 +5C0N_A,7,T,E,0.41,0.001,0.900,0.099,0.493444444444 +5C0N_A,8,W,B,0.169,0.011,0.918,0.071,0.505222222222 +5C0N_A,9,K,E,0.473,0.001,0.900,0.099,0.517888888889 +5C0N_A,10,L,B,0.201,0.001,0.900,0.099,0.523888888889 +5C0N_A,11,V,E,0.456,0.003,0.718,0.279,0.536333333333 +5C0N_A,12,S,E,0.579,0.004,0.514,0.481,0.546 +5C0N_A,13,S,E,0.447,0.019,0.141,0.840,0.555666666667 +5C0N_A,14,E,E,0.637,0.053,0.043,0.903,0.562666666667 +5C0N_A,15,N,E,0.398,0.058,0.017,0.925,0.570888888889 +5C0N_A,16,F,B,0.092,0.782,0.003,0.216,0.555444444444 +5C0N_A,17,D,E,0.437,0.923,0.002,0.076,0.548777777778 +5C0N_A,18,D,E,0.576,0.970,0.001,0.030,0.551222222222 +5C0N_A,19,Y,B,0.096,0.970,0.001,0.030,0.543111111111 +5C0N_A,20,M,B,0.073,0.970,0.001,0.030,0.538333333333 +5C0N_A,21,K,E,0.627,0.923,0.002,0.076,0.532888888889 +5C0N_A,22,E,E,0.511,0.858,0.002,0.139,0.525222222222 +5C0N_A,23,V,B,0.156,0.502,0.002,0.495,0.529555555556 +5C0N_A,24,G,E,0.7,0.018,0.019,0.964,0.531555555556 +5C0N_A,25,V,B,0.116,0.018,0.019,0.964,0.539666666667 +5C0N_A,26,G,E,0.425,0.058,0.017,0.925,0.539888888889 +5C0N_A,27,F,E,0.398,0.802,0.014,0.185,0.536 +5C0N_A,28,A,E,0.431,0.802,0.014,0.185,0.533888888889 +5C0N_A,29,T,B,0.19,0.717,0.014,0.269,0.508333333333 +5C0N_A,30,R,B,0.172,0.751,0.050,0.199,0.518666666667 +5C0N_A,31,K,E,0.492,0.660,0.049,0.291,0.513777777778 +5C0N_A,32,V,B,0.196,0.522,0.016,0.462,0.504555555556 +5C0N_A,33,A,B,0.07,0.430,0.016,0.555,0.504666666667 +5C0N_A,34,G,E,0.48,0.181,0.016,0.803,0.503222222222 +5C0N_A,35,M,E,0.442,0.113,0.043,0.844,0.492555555556 +5C0N_A,36,A,B,0.136,0.018,0.047,0.935,0.47 +5C0N_A,37,K,E,0.453,0.004,0.085,0.910,0.462555555556 +5C0N_A,38,P,B,0.113,0.005,0.262,0.733,0.451111111111 +5C0N_A,39,N,E,0.43,0.002,0.816,0.182,0.437222222222 +5C0N_A,40,M,B,0.109,0.001,0.959,0.040,0.434333333333 +5C0N_A,41,I,E,0.296,0.001,0.959,0.040,0.437666666667 +5C0N_A,42,I,B,0.043,0.001,0.959,0.040,0.432111111111 +5C0N_A,43,S,E,0.373,0.001,0.959,0.040,0.441777777778 +5C0N_A,44,V,E,0.277,0.001,0.959,0.040,0.451555555556 +5C0N_A,45,N,E,0.544,0.004,0.420,0.576,0.456 +5C0N_A,46,G,E,0.693,0.003,0.003,0.994,0.454888888889 +5C0N_A,47,D,E,0.636,0.005,0.045,0.951,0.458222222222 +5C0N_A,48,L,E,0.438,0.001,0.900,0.099,0.462666666667 +5C0N_A,49,V,B,0.085,0.001,0.959,0.040,0.456888888889 +5C0N_A,50,T,E,0.293,0.001,0.959,0.040,0.454666666667 +5C0N_A,51,I,B,0.072,0.001,0.959,0.040,0.451333333333 +5C0N_A,52,R,E,0.305,0.001,0.959,0.040,0.444888888889 +5C0N_A,53,S,B,0.147,0.001,0.900,0.099,0.445888888889 +5C0N_A,54,E,E,0.428,0.001,0.959,0.040,0.468666666667 +5C0N_A,55,S,B,0.151,0.003,0.718,0.279,0.484666666667 +5C0N_A,56,T,E,0.451,0.005,0.262,0.733,0.503444444444 +5C0N_A,57,F,E,0.418,0.005,0.336,0.660,0.509 +5C0N_A,58,K,E,0.399,0.003,0.718,0.279,0.512333333333 +5C0N_A,59,N,E,0.407,0.001,0.900,0.099,0.504555555556 +5C0N_A,60,T,E,0.269,0.001,0.900,0.099,0.493111111111 +5C0N_A,61,E,E,0.417,0.001,0.900,0.099,0.484444444444 +5C0N_A,62,I,B,0.142,0.001,0.959,0.040,0.482888888889 +5C0N_A,63,S,E,0.442,0.001,0.959,0.040,0.467888888889 +5C0N_A,64,F,B,0.096,0.001,0.900,0.099,0.464 +5C0N_A,65,K,E,0.489,0.001,0.900,0.099,0.473111111111 +5C0N_A,66,L,B,0.234,0.004,0.514,0.481,0.474111111111 +5C0N_A,67,G,E,0.481,0.018,0.047,0.935,0.476888888889 +5C0N_A,68,V,E,0.487,0.020,0.205,0.775,0.493555555556 +5C0N_A,69,E,E,0.575,0.021,0.756,0.223,0.517111111111 +5C0N_A,70,F,B,0.164,0.021,0.756,0.223,0.526666666667 +5C0N_A,71,D,E,0.493,0.023,0.655,0.322,0.532 +5C0N_A,72,E,E,0.309,0.022,0.552,0.426,0.543222222222 +5C0N_A,73,I,E,0.519,0.022,0.552,0.426,0.554111111111 +5C0N_A,74,T,E,0.304,0.021,0.279,0.699,0.559555555556 +5C0N_A,75,A,B,0.247,0.018,0.088,0.893,0.557 +5C0N_A,76,D,E,0.648,0.018,0.047,0.935,0.547333333333 +5C0N_A,77,D,E,0.467,0.019,0.141,0.840,0.525777777778 +5C0N_A,78,R,E,0.41,0.004,0.514,0.481,0.510333333333 +5C0N_A,79,K,E,0.488,0.002,0.816,0.182,0.492222222222 +5C0N_A,80,V,B,0.113,0.001,0.900,0.099,0.459888888889 +5C0N_A,81,K,E,0.352,0.001,0.959,0.040,0.444444444444 +5C0N_A,82,S,B,0.09,0.001,0.959,0.040,0.426333333333 +5C0N_A,83,I,B,0.112,0.001,0.959,0.040,0.413555555556 +5C0N_A,84,I,B,0.044,0.001,0.959,0.040,0.405111111111 +5C0N_A,85,T,E,0.289,0.001,0.959,0.040,0.416222222222 +5C0N_A,86,L,B,0.16,0.001,0.900,0.099,0.423111111111 +5C0N_A,87,D,E,0.566,0.004,0.420,0.576,0.423222222222 +5C0N_A,88,G,E,0.771,0.003,0.003,0.994,0.433222222222 +5C0N_A,89,G,E,0.621,0.003,0.003,0.994,0.457222222222 +5C0N_A,90,A,E,0.308,0.003,0.718,0.279,0.456 +5C0N_A,91,L,B,0.11,0.001,0.900,0.099,0.468777777778 +5C0N_A,92,V,B,0.168,0.001,0.959,0.040,0.477444444444 +5C0N_A,93,Q,B,0.09,0.001,0.959,0.040,0.496888888889 +5C0N_A,94,V,B,0.143,0.001,0.959,0.040,0.504666666667 +5C0N_A,95,Q,B,0.22,0.001,0.959,0.040,0.516333333333 +5C0N_A,96,K,E,0.446,0.003,0.718,0.279,0.530666666667 +5C0N_A,97,W,E,0.432,0.004,0.138,0.858,0.538111111111 +5C0N_A,98,D,E,0.857,0.005,0.015,0.979,0.542555555556 +5C0N_A,99,G,E,0.698,0.005,0.015,0.979,0.551222222222 +5C0N_A,100,K,E,0.67,0.005,0.045,0.951,0.543222222222 +5C0N_A,101,S,E,0.556,0.004,0.420,0.576,0.541444444444 +5C0N_A,102,T,E,0.3,0.002,0.816,0.182,0.538444444444 +5C0N_A,103,T,E,0.313,0.001,0.959,0.040,0.526444444444 +5C0N_A,104,I,B,0.152,0.001,0.959,0.040,0.517 +5C0N_A,105,K,E,0.265,0.001,0.959,0.040,0.512222222222 +5C0N_A,106,R,B,0.173,0.001,0.959,0.040,0.505111111111 +5C0N_A,107,K,E,0.352,0.001,0.959,0.040,0.506555555556 +5C0N_A,108,R,B,0.109,0.001,0.959,0.040,0.509222222222 +5C0N_A,109,D,E,0.521,0.003,0.718,0.279,0.501888888889 +5C0N_A,110,G,E,0.786,0.003,0.003,0.994,0.493 +5C0N_A,111,D,E,0.613,0.003,0.003,0.994,0.465 +5C0N_A,112,K,E,0.429,0.003,0.718,0.279,0.452 +5C0N_A,113,L,B,0.071,0.001,0.959,0.040,0.432111111111 +5C0N_A,114,V,B,0.171,0.001,0.959,0.040,0.425777777778 +5C0N_A,115,V,B,0.075,0.000,0.983,0.017,0.424888888889 +5C0N_A,116,E,B,0.192,0.001,0.959,0.040,0.417222222222 +5C0N_A,117,C,B,0.051,0.001,0.959,0.040,0.403222222222 +5C0N_A,118,V,E,0.339,0.000,0.983,0.017,0.401666666667 +5C0N_A,119,M,B,0.224,0.002,0.816,0.182,0.403111111111 +5C0N_A,120,K,E,0.672,0.005,0.015,0.979,0.418444444444 +5C0N_A,121,G,E,0.617,0.005,0.015,0.979,0.422444444444 +5C0N_A,122,V,B,0.168,0.002,0.816,0.182,0.445444444444 +5C0N_A,123,T,E,0.343,0.001,0.959,0.040,0.441777777778 +5C0N_A,124,S,B,0.055,0.006,0.962,0.032,0.437444444444 +5C0N_A,125,T,E,0.327,0.001,0.959,0.040,0.442222222222 +5C0N_A,126,R,B,0.167,0.000,0.983,0.017,0.453 +5C0N_A,127,V,E,0.296,0.001,0.959,0.040,0.459555555556 +5C0N_A,128,Y,B,0.078,0.001,0.959,0.040,0.407444444444 +5C0N_A,129,E,E,0.507,0.001,0.900,0.099,0.358444444444 +5C0N_A,130,R,E,0.433,0.002,0.816,0.182,0.313111111111 +5C0N_A,131,A,E,0.675,0.016,0.005,0.979,0.256111111111 +5BVP_A,1,V,E,0.798,0.003,0.003,0.994,0.221222222222 +5BVP_A,2,R,E,0.599,0.020,0.205,0.775,0.266666666667 +5BVP_A,3,S,E,0.423,0.022,0.359,0.619,0.301555555556 +5BVP_A,4,L,B,0.198,0.022,0.552,0.426,0.328333333333 +5BVP_A,5,N,E,0.558,0.021,0.756,0.223,0.385666666667 +5BVP_A,6,C,B,0.074,0.018,0.846,0.136,0.406333333333 +5BVP_A,7,T,E,0.333,0.011,0.918,0.071,0.416666666667 +5BVP_A,8,L,B,0.041,0.011,0.918,0.071,0.423 +5BVP_A,9,R,E,0.365,0.018,0.846,0.136,0.447333333333 +5BVP_A,10,D,B,0.111,0.022,0.552,0.426,0.462444444444 +5BVP_A,11,S,E,0.42,0.113,0.087,0.800,0.464777777778 +5BVP_A,12,Q,E,0.459,0.056,0.142,0.802,0.458111111111 +5BVP_A,13,Q,E,0.355,0.021,0.279,0.699,0.455444444444 +5BVP_A,14,K,B,0.166,0.004,0.514,0.481,0.431333333333 +5BVP_A,15,S,B,0.053,0.001,0.900,0.099,0.424888888889 +5BVP_A,16,L,B,0.04,0.001,0.959,0.040,0.418888888889 +5BVP_A,17,V,B,0.05,0.000,0.983,0.017,0.417888888889 +5BVP_A,18,M,B,0.053,0.001,0.959,0.040,0.409666666667 +5BVP_A,19,S,E,0.257,0.002,0.816,0.182,0.405 +5BVP_A,20,G,E,0.407,0.004,0.197,0.799,0.391777777778 +5BVP_A,21,P,E,0.647,0.005,0.015,0.979,0.412888888889 +5BVP_A,22,Y,B,0.236,0.004,0.197,0.799,0.417777777778 +5BVP_A,23,E,B,0.194,0.002,0.816,0.182,0.421888888889 +5BVP_A,24,L,B,0.031,0.001,0.900,0.099,0.417444444444 +5BVP_A,25,K,B,0.114,0.001,0.900,0.099,0.410555555556 +5BVP_A,26,A,B,0.03,0.001,0.900,0.099,0.42 +5BVP_A,27,L,B,0.042,0.001,0.900,0.099,0.435555555556 +5BVP_A,28,H,B,0.201,0.002,0.816,0.182,0.452888888889 +5BVP_A,29,L,B,0.106,0.004,0.420,0.576,0.493333333333 +5BVP_A,30,Q,E,0.512,0.004,0.085,0.910,0.509555555556 +5BVP_A,31,G,E,0.582,0.018,0.019,0.964,0.546777777778 +5BVP_A,32,Q,E,0.546,0.018,0.019,0.964,0.572222222222 +5BVP_A,33,D,E,0.59,0.018,0.019,0.964,0.594444444444 +5BVP_A,34,M,E,0.382,0.004,0.085,0.910,0.590777777778 +5BVP_A,35,E,E,0.533,0.004,0.197,0.799,0.573111111111 +5BVP_A,36,Q,E,0.437,0.005,0.336,0.660,0.532888888889 +5BVP_A,37,Q,E,0.389,0.004,0.616,0.381,0.506777777778 +5BVP_A,38,V,B,0.063,0.001,0.959,0.040,0.463 +5BVP_A,39,V,E,0.292,0.001,0.959,0.040,0.451888888889 +5BVP_A,40,F,B,0.036,0.001,0.959,0.040,0.426111111111 +5BVP_A,41,S,B,0.201,0.001,0.900,0.099,0.408333333333 +5BVP_A,42,M,B,0.032,0.002,0.816,0.182,0.404111111111 +5BVP_A,43,S,B,0.161,0.002,0.816,0.182,0.427444444444 +5BVP_A,44,F,B,0.102,0.003,0.718,0.279,0.452222222222 +5BVP_A,45,V,B,0.136,0.004,0.514,0.481,0.497444444444 +5BVP_A,46,Q,E,0.399,0.004,0.138,0.858,0.516555555556 +5BVP_A,47,G,E,0.343,0.005,0.015,0.979,0.547777777778 +5BVP_A,48,E,E,0.525,0.018,0.019,0.964,0.555111111111 +5BVP_A,49,E,E,0.611,0.018,0.019,0.964,0.577222222222 +5BVP_A,50,S,E,0.614,0.018,0.019,0.964,0.588555555556 +5BVP_A,51,N,E,0.542,0.018,0.019,0.964,0.562888888889 +5BVP_A,52,D,E,0.583,0.018,0.047,0.935,0.528333333333 +5BVP_A,53,K,E,0.272,0.004,0.138,0.858,0.488777777778 +5BVP_A,54,I,B,0.222,0.005,0.336,0.660,0.453 +5BVP_A,55,P,B,0.044,0.003,0.718,0.279,0.420666666667 +5BVP_A,56,V,B,0.024,0.001,0.959,0.040,0.394555555556 +5BVP_A,57,A,B,0.043,0.001,0.959,0.040,0.388777777778 +5BVP_A,58,L,B,0.018,0.001,0.959,0.040,0.385 +5BVP_A,59,G,B,0.049,0.001,0.900,0.099,0.385888888889 +5BVP_A,60,L,B,0.038,0.003,0.718,0.279,0.405666666667 +5BVP_A,61,K,E,0.439,0.005,0.336,0.660,0.425333333333 +5BVP_A,62,E,E,0.631,0.005,0.015,0.979,0.436888888889 +5BVP_A,63,K,E,0.494,0.003,0.003,0.994,0.437888888889 +5BVP_A,64,N,E,0.48,0.004,0.085,0.910,0.432777777778 +5BVP_A,65,L,B,0.105,0.003,0.718,0.279,0.434666666667 +5BVP_A,66,Y,B,0.043,0.001,0.900,0.099,0.426555555556 +5BVP_A,67,L,B,0.029,0.001,0.900,0.099,0.422888888889 +5BVP_A,68,S,B,0.056,0.001,0.959,0.040,0.420888888889 +5BVP_A,69,C,B,0.024,0.001,0.900,0.099,0.421777777778 +5BVP_A,70,V,B,0.253,0.002,0.816,0.182,0.426888888889 +5BVP_A,71,L,E,0.456,0.004,0.616,0.381,0.433111111111 +5BVP_A,72,K,E,0.576,0.005,0.336,0.660,0.448222222222 +5BVP_A,73,D,E,0.759,0.005,0.015,0.979,0.465666666667 +5BVP_A,74,D,E,0.789,0.003,0.003,0.994,0.459111111111 +5BVP_A,75,K,E,0.502,0.004,0.197,0.799,0.462 +5BVP_A,76,P,B,0.208,0.004,0.616,0.381,0.450888888889 +5BVP_A,77,T,E,0.291,0.001,0.900,0.099,0.46 +5BVP_A,78,L,B,0.129,0.001,0.900,0.099,0.469555555556 +5BVP_A,79,Q,B,0.262,0.001,0.900,0.099,0.484777777778 +5BVP_A,80,L,B,0.1,0.001,0.900,0.099,0.497555555556 +5BVP_A,81,E,E,0.453,0.001,0.900,0.099,0.505 +5BVP_A,82,S,E,0.654,0.002,0.816,0.182,0.523111111111 +5BVP_A,83,V,E,0.252,0.022,0.552,0.426,0.555555555556 +5BVP_A,84,D,E,0.624,0.021,0.279,0.699,0.561111111111 +5BVP_A,85,P,E,0.354,0.056,0.142,0.802,0.583888888889 +5BVP_A,86,K,E,0.52,0.064,0.216,0.721,0.581777777778 +5BVP_A,87,N,E,0.604,0.064,0.216,0.721,0.576888888889 +5BVP_A,88,Y,B,0.115,0.056,0.142,0.802,0.570666666667 +5BVP_A,89,P,E,0.504,0.053,0.043,0.903,0.551111111111 +5BVP_A,90,K,E,0.651,0.053,0.043,0.903,0.539 +5BVP_A,91,K,E,0.73,0.018,0.019,0.964,0.529111111111 +5BVP_A,92,K,E,0.592,0.018,0.019,0.964,0.523777777778 +5BVP_A,93,M,E,0.573,0.052,0.084,0.864,0.510888888889 +5BVP_A,94,E,E,0.304,0.021,0.279,0.699,0.490333333333 +5BVP_A,95,K,E,0.304,0.022,0.359,0.619,0.473666666667 +5BVP_A,96,R,B,0.225,0.022,0.552,0.426,0.459555555556 +5BVP_A,97,F,B,0.03,0.018,0.846,0.136,0.446666666667 +5BVP_A,98,V,B,0.046,0.011,0.918,0.071,0.460444444444 +5BVP_A,99,F,B,0.033,0.011,0.918,0.071,0.475333333333 +5BVP_A,100,N,B,0.091,0.011,0.918,0.071,0.485444444444 +5BVP_A,101,K,B,0.15,0.018,0.846,0.136,0.493555555556 +5BVP_A,102,I,E,0.333,0.023,0.655,0.322,0.510333333333 +5BVP_A,103,E,E,0.586,0.021,0.279,0.699,0.540444444444 +5BVP_A,104,I,E,0.507,0.018,0.088,0.893,0.545666666667 +5BVP_A,105,N,E,0.577,0.018,0.047,0.935,0.562 +5BVP_A,106,N,E,0.428,0.018,0.047,0.935,0.544111111111 +5BVP_A,107,K,E,0.455,0.021,0.451,0.528,0.540555555556 +5BVP_A,108,L,B,0.148,0.023,0.655,0.322,0.519 +5BVP_A,109,E,E,0.3,0.021,0.756,0.223,0.501222222222 +5BVP_A,110,F,B,0.073,0.021,0.756,0.223,0.497 +5BVP_A,111,E,E,0.298,0.021,0.756,0.223,0.491444444444 +5BVP_A,112,S,B,0.088,0.023,0.655,0.322,0.467888888889 +5BVP_A,113,A,B,0.14,0.069,0.386,0.545,0.470444444444 +5BVP_A,114,Q,E,0.309,0.066,0.296,0.638,0.444555555556 +5BVP_A,115,F,B,0.215,0.018,0.088,0.893,0.445666666667 +5BVP_A,116,P,B,0.284,0.005,0.015,0.979,0.415444444444 +5BVP_A,117,N,E,0.327,0.005,0.045,0.951,0.401333333333 +5BVP_A,118,W,B,0.058,0.022,0.552,0.426,0.389888888889 +5BVP_A,119,Y,B,0.048,0.018,0.846,0.136,0.375555555556 +5BVP_A,120,I,B,0.035,0.018,0.846,0.136,0.387777777778 +5BVP_A,121,S,B,0.026,0.021,0.756,0.223,0.395888888889 +5BVP_A,122,T,B,0.059,0.021,0.451,0.528,0.407888888889 +5BVP_A,123,S,B,0.203,0.020,0.205,0.775,0.431444444444 +5BVP_A,124,Q,E,0.491,0.019,0.141,0.840,0.445666666667 +5BVP_A,125,A,E,0.499,0.018,0.047,0.935,0.474666666667 +5BVP_A,126,E,E,0.755,0.018,0.019,0.964,0.479555555556 +5BVP_A,127,N,E,0.729,0.003,0.003,0.994,0.490222222222 +5BVP_A,128,M,E,0.303,0.004,0.138,0.858,0.472666666667 +5BVP_A,129,P,B,0.179,0.022,0.552,0.426,0.446222222222 +5BVP_A,130,V,B,0.036,0.018,0.846,0.136,0.447444444444 +5BVP_A,131,F,B,0.234,0.018,0.846,0.136,0.446666666667 +5BVP_A,132,L,B,0.044,0.023,0.655,0.322,0.448666666667 +5BVP_A,133,G,B,0.087,0.021,0.279,0.699,0.467666666667 +5BVP_A,134,G,E,0.536,0.019,0.141,0.840,0.480777777778 +5BVP_A,135,G,E,0.541,0.005,0.045,0.951,0.505555555556 +5BVP_A,136,G,E,0.55,0.018,0.047,0.935,0.519333333333 +5BVP_A,137,Q,E,0.573,0.019,0.141,0.840,0.548333333333 +5BVP_A,138,D,E,0.393,0.021,0.279,0.699,0.547888888889 +5BVP_A,139,I,B,0.217,0.022,0.552,0.426,0.533666666667 +5BVP_A,140,T,B,0.157,0.004,0.616,0.381,0.506555555556 +5BVP_A,141,D,E,0.326,0.002,0.816,0.182,0.496888888889 +5BVP_A,142,F,B,0.05,0.001,0.900,0.099,0.488222222222 +5BVP_A,143,T,B,0.269,0.001,0.900,0.099,0.481555555556 +5BVP_A,144,M,B,0.071,0.001,0.900,0.099,0.476555555556 +5BVP_A,145,Q,E,0.395,0.011,0.918,0.071,0.473111111111 +5BVP_A,146,F,B,0.285,0.021,0.756,0.223,0.413333333333 +5BVP_A,147,V,E,0.408,0.022,0.552,0.426,0.373333333333 +5BVP_A,148,S,E,0.516,0.021,0.279,0.699,0.325444444444 +5BVP_A,149,S,E,0.867,0.003,0.003,0.994,0.288 +4XAK_A,1,V,E,0.728,0.003,0.003,0.994,0.255 +4XAK_A,2,E,E,0.794,0.005,0.045,0.951,0.310888888889 +4XAK_A,3,C,B,0.099,0.005,0.045,0.951,0.372222222222 +4XAK_A,4,D,E,0.622,0.018,0.088,0.893,0.425333333333 +4XAK_A,5,F,B,0.164,0.053,0.043,0.903,0.491666666667 +4XAK_A,6,S,E,0.55,0.115,0.016,0.868,0.496333333333 +4XAK_A,7,P,E,0.508,0.184,0.043,0.773,0.511 +4XAK_A,8,L,B,0.206,0.184,0.043,0.773,0.534222222222 +4XAK_A,9,L,B,0.182,0.191,0.086,0.723,0.548555555556 +4XAK_A,10,S,E,0.494,0.113,0.043,0.844,0.562444444444 +4XAK_A,11,G,E,0.6,0.018,0.047,0.935,0.570555555556 +4XAK_A,12,T,E,0.536,0.018,0.019,0.964,0.565777777778 +4XAK_A,13,P,E,0.382,0.018,0.019,0.964,0.575111111111 +4XAK_A,14,P,B,0.263,0.018,0.019,0.964,0.583111111111 +4XAK_A,15,Q,E,0.455,0.018,0.047,0.935,0.577666666667 +4XAK_A,16,V,B,0.264,0.056,0.142,0.802,0.574666666667 +4XAK_A,17,Y,B,0.208,0.069,0.386,0.545,0.569444444444 +4XAK_A,18,N,E,0.323,0.074,0.484,0.442,0.554222222222 +4XAK_A,19,F,B,0.144,0.079,0.592,0.329,0.552 +4XAK_A,20,K,E,0.437,0.087,0.683,0.230,0.534 +4XAK_A,21,R,B,0.283,0.169,0.612,0.219,0.531888888889 +4XAK_A,22,L,B,0.232,0.169,0.612,0.219,0.529666666667 +4XAK_A,23,V,B,0.203,0.169,0.612,0.219,0.504111111111 +4XAK_A,24,F,B,0.112,0.268,0.505,0.227,0.512222222222 +4XAK_A,25,T,B,0.308,0.252,0.423,0.325,0.513666666667 +4XAK_A,26,N,E,0.38,0.135,0.317,0.548,0.513333333333 +4XAK_A,27,C,B,0.083,0.125,0.227,0.648,0.514444444444 +4XAK_A,28,N,E,0.372,0.118,0.150,0.732,0.517888888889 +4XAK_A,29,Y,B,0.232,0.199,0.152,0.649,0.540222222222 +4XAK_A,30,N,E,0.364,0.428,0.171,0.402,0.524444444444 +4XAK_A,31,L,B,0.107,0.701,0.107,0.192,0.520555555556 +4XAK_A,32,T,E,0.397,0.779,0.100,0.120,0.530555555556 +4XAK_A,33,K,E,0.307,0.779,0.100,0.120,0.525333333333 +4XAK_A,34,L,B,0.056,0.779,0.100,0.120,0.514888888889 +4XAK_A,35,L,B,0.109,0.701,0.107,0.192,0.516666666667 +4XAK_A,36,S,E,0.488,0.561,0.047,0.393,0.510444444444 +4XAK_A,37,L,B,0.248,0.502,0.102,0.396,0.514111111111 +4XAK_A,38,F,B,0.108,0.307,0.165,0.527,0.512777777778 +4XAK_A,39,S,E,0.338,0.118,0.150,0.732,0.523333333333 +4XAK_A,40,V,B,0.181,0.056,0.142,0.802,0.532777777778 +4XAK_A,41,N,E,0.493,0.056,0.142,0.802,0.515444444444 +4XAK_A,42,D,E,0.455,0.064,0.216,0.721,0.506 +4XAK_A,43,F,B,0.064,0.022,0.359,0.619,0.516444444444 +4XAK_A,44,T,E,0.416,0.022,0.552,0.426,0.506555555556 +4XAK_A,45,C,B,0.066,0.022,0.552,0.426,0.517555555556 +4XAK_A,46,S,E,0.344,0.021,0.279,0.699,0.508444444444 +4XAK_A,47,Q,E,0.485,0.004,0.197,0.799,0.502222222222 +4XAK_A,48,I,B,0.121,0.020,0.205,0.775,0.513333333333 +4XAK_A,49,S,E,0.396,0.052,0.084,0.864,0.490333333333 +4XAK_A,50,P,B,0.233,0.622,0.015,0.363,0.503444444444 +4XAK_A,51,A,E,0.473,0.717,0.014,0.269,0.510444444444 +4XAK_A,52,A,E,0.384,0.717,0.014,0.269,0.502888888889 +4XAK_A,53,I,B,0.098,0.660,0.049,0.291,0.497111111111 +4XAK_A,54,A,B,0.273,0.522,0.016,0.462,0.481666666667 +4XAK_A,55,S,E,0.574,0.257,0.016,0.727,0.472111111111 +4XAK_A,56,N,B,0.258,0.184,0.043,0.773,0.457777777778 +4XAK_A,57,C,B,0.05,0.118,0.150,0.732,0.428666666667 +4XAK_A,58,Y,B,0.163,0.066,0.296,0.638,0.435444444444 +4XAK_A,59,S,B,0.214,0.022,0.359,0.619,0.418777777778 +4XAK_A,60,S,B,0.228,0.023,0.655,0.322,0.405555555556 +4XAK_A,61,L,B,0.061,0.018,0.846,0.136,0.399555555556 +4XAK_A,62,I,B,0.197,0.011,0.918,0.071,0.400888888889 +4XAK_A,63,L,B,0.074,0.018,0.846,0.136,0.411666666667 +4XAK_A,64,D,B,0.127,0.021,0.756,0.223,0.414333333333 +4XAK_A,65,Y,B,0.174,0.021,0.756,0.223,0.426333333333 +4XAK_A,66,F,B,0.086,0.018,0.846,0.136,0.468111111111 +4XAK_A,67,S,B,0.192,0.018,0.846,0.136,0.490333333333 +4XAK_A,68,Y,B,0.1,0.023,0.655,0.322,0.526111111111 +4XAK_A,69,P,E,0.405,0.021,0.451,0.528,0.554 +4XAK_A,70,L,E,0.457,0.019,0.141,0.840,0.569666666667 +4XAK_A,71,S,E,0.486,0.056,0.142,0.802,0.585 +4XAK_A,72,M,E,0.366,0.064,0.216,0.721,0.582555555556 +4XAK_A,73,K,E,0.349,0.069,0.386,0.545,0.608444444444 +4XAK_A,74,S,E,0.31,0.069,0.386,0.545,0.619888888889 +4XAK_A,75,D,B,0.326,0.148,0.418,0.435,0.619555555556 +4XAK_A,76,L,B,0.085,0.135,0.317,0.548,0.623 +4XAK_A,77,S,E,0.342,0.064,0.216,0.721,0.616222222222 +4XAK_A,78,V,E,0.348,0.052,0.084,0.864,0.611666666667 +4XAK_A,79,S,E,0.351,0.018,0.047,0.935,0.601777777778 +4XAK_A,80,S,E,0.381,0.018,0.047,0.935,0.59 +4XAK_A,81,A,E,0.423,0.053,0.043,0.903,0.606666666667 +4XAK_A,82,G,E,0.452,0.052,0.084,0.864,0.604222222222 +4XAK_A,83,P,E,0.291,0.118,0.150,0.732,0.599 +4XAK_A,84,I,B,0.1,0.125,0.227,0.648,0.595888888889 +4XAK_A,85,S,E,0.403,0.125,0.227,0.648,0.580555555556 +4XAK_A,86,Q,E,0.488,0.125,0.227,0.648,0.584333333333 +4XAK_A,87,F,B,0.168,0.125,0.227,0.648,0.583666666667 +4XAK_A,88,N,E,0.404,0.066,0.296,0.638,0.601333333333 +4XAK_A,89,Y,B,0.185,0.069,0.386,0.545,0.622888888889 +4XAK_A,90,K,E,0.493,0.069,0.386,0.545,0.622 +4XAK_A,91,Q,B,0.197,0.020,0.205,0.775,0.603555555556 +4XAK_A,92,S,E,0.47,0.018,0.088,0.893,0.590222222222 +4XAK_A,93,F,E,0.418,0.018,0.047,0.935,0.566666666667 +4XAK_A,94,S,E,0.58,0.018,0.019,0.964,0.539888888889 +4XAK_A,95,N,B,0.207,0.053,0.043,0.903,0.504333333333 +4XAK_A,96,P,B,0.263,0.113,0.087,0.800,0.457888888889 +4XAK_A,97,T,B,0.104,0.066,0.296,0.638,0.416 +4XAK_A,98,C,B,0.02,0.087,0.683,0.230,0.364888888889 +4XAK_A,99,L,B,0.078,0.018,0.846,0.136,0.332111111111 +4XAK_A,100,I,B,0.038,0.011,0.918,0.071,0.311 +4XAK_A,101,L,B,0.037,0.011,0.918,0.071,0.316666666667 +4XAK_A,102,A,B,0.045,0.011,0.918,0.071,0.338777777778 +4XAK_A,103,T,B,0.112,0.018,0.846,0.136,0.372333333333 +4XAK_A,104,V,B,0.087,0.022,0.552,0.426,0.4 +4XAK_A,105,P,B,0.177,0.020,0.205,0.775,0.437777777778 +4XAK_A,106,H,E,0.368,0.019,0.141,0.840,0.460222222222 +4XAK_A,107,N,E,0.486,0.019,0.141,0.840,0.480777777778 +4XAK_A,108,L,E,0.438,0.020,0.205,0.775,0.499 +4XAK_A,109,T,B,0.166,0.021,0.451,0.528,0.533111111111 +4XAK_A,110,T,E,0.368,0.023,0.655,0.322,0.542888888889 +4XAK_A,111,I,B,0.099,0.022,0.552,0.426,0.551888888889 +4XAK_A,112,T,E,0.379,0.022,0.359,0.619,0.553777777778 +4XAK_A,113,K,E,0.407,0.019,0.141,0.840,0.559666666667 +4XAK_A,114,P,E,0.426,0.018,0.088,0.893,0.557666666667 +4XAK_A,115,L,E,0.357,0.018,0.047,0.935,0.570777777778 +4XAK_A,116,K,E,0.495,0.053,0.043,0.903,0.586111111111 +4XAK_A,117,Y,B,0.339,0.052,0.084,0.864,0.600222222222 +4XAK_A,118,S,E,0.328,0.066,0.296,0.638,0.608666666667 +4XAK_A,119,Y,B,0.242,0.148,0.418,0.435,0.598111111111 +4XAK_A,120,I,B,0.295,0.148,0.418,0.435,0.586111111111 +4XAK_A,121,N,B,0.31,0.135,0.317,0.548,0.59 +4XAK_A,122,K,E,0.402,0.066,0.296,0.638,0.586555555556 +4XAK_A,123,C,B,0.282,0.066,0.296,0.638,0.599444444444 +4XAK_A,124,S,B,0.275,0.064,0.216,0.721,0.597777777778 +4XAK_A,125,R,E,0.358,0.064,0.216,0.721,0.607555555556 +4XAK_A,126,F,B,0.185,0.064,0.216,0.721,0.616555555556 +4XAK_A,127,L,E,0.415,0.064,0.216,0.721,0.620888888889 +4XAK_A,128,S,E,0.427,0.064,0.216,0.721,0.633 +4XAK_A,129,D,E,0.475,0.056,0.142,0.802,0.632777777778 +4XAK_A,130,D,E,0.588,0.018,0.088,0.893,0.615666666667 +4XAK_A,131,R,E,0.508,0.019,0.141,0.840,0.606 +4XAK_A,132,T,E,0.338,0.022,0.359,0.619,0.592 +4XAK_A,133,E,E,0.456,0.021,0.451,0.528,0.576222222222 +4XAK_A,134,V,B,0.281,0.021,0.451,0.528,0.555444444444 +4XAK_A,135,P,E,0.368,0.022,0.552,0.426,0.531666666667 +4XAK_A,136,Q,B,0.165,0.021,0.756,0.223,0.512 +4XAK_A,137,L,B,0.162,0.018,0.846,0.136,0.513555555556 +4XAK_A,138,V,B,0.135,0.018,0.846,0.136,0.515444444444 +4XAK_A,139,N,B,0.153,0.022,0.552,0.426,0.519333333333 +4XAK_A,140,A,E,0.309,0.019,0.141,0.840,0.522666666667 +4XAK_A,141,N,E,0.509,0.018,0.047,0.935,0.517888888889 +4XAK_A,142,Q,E,0.412,0.019,0.141,0.840,0.516333333333 +4XAK_A,143,Y,B,0.191,0.021,0.279,0.699,0.533777777778 +4XAK_A,144,S,B,0.13,0.021,0.279,0.699,0.541777777778 +4XAK_A,145,P,B,0.164,0.021,0.279,0.699,0.539222222222 +4XAK_A,146,C,B,0.059,0.022,0.359,0.619,0.538777777778 +4XAK_A,147,V,B,0.258,0.021,0.279,0.699,0.539333333333 +4XAK_A,148,S,E,0.562,0.021,0.279,0.699,0.537111111111 +4XAK_A,149,I,B,0.23,0.019,0.141,0.840,0.545222222222 +4XAK_A,150,V,E,0.365,0.018,0.047,0.935,0.553222222222 +4XAK_A,151,P,E,0.49,0.018,0.019,0.964,0.575888888889 +4XAK_A,152,S,E,0.666,0.018,0.019,0.964,0.572333333333 +4XAK_A,153,T,E,0.406,0.019,0.141,0.840,0.576555555556 +4XAK_A,154,V,E,0.339,0.021,0.279,0.699,0.581222222222 +4XAK_A,155,W,E,0.345,0.020,0.205,0.775,0.572 +4XAK_A,156,E,E,0.573,0.056,0.142,0.802,0.566777777778 +4XAK_A,157,D,E,0.354,0.056,0.142,0.802,0.574 +4XAK_A,158,G,E,0.317,0.056,0.142,0.802,0.567777777778 +4XAK_A,159,D,E,0.454,0.066,0.296,0.638,0.577111111111 +4XAK_A,160,Y,E,0.31,0.087,0.683,0.230,0.577777777778 +4XAK_A,161,Y,B,0.26,0.021,0.756,0.223,0.585111111111 +4XAK_A,162,R,E,0.399,0.021,0.756,0.223,0.594444444444 +4XAK_A,163,K,E,0.423,0.021,0.756,0.223,0.603111111111 +4XAK_A,164,Q,E,0.406,0.021,0.756,0.223,0.615888888889 +4XAK_A,165,L,E,0.333,0.022,0.552,0.426,0.623777777778 +4XAK_A,166,S,E,0.532,0.021,0.279,0.699,0.617444444444 +4XAK_A,167,P,E,0.403,0.019,0.141,0.840,0.617777777778 +4XAK_A,168,L,E,0.303,0.019,0.141,0.840,0.599333333333 +4XAK_A,169,E,E,0.61,0.018,0.047,0.935,0.582888888889 +4XAK_A,170,G,E,0.389,0.005,0.015,0.979,0.570666666667 +4XAK_A,171,G,E,0.653,0.005,0.015,0.979,0.533777777778 +4XAK_A,172,G,B,0.284,0.004,0.138,0.858,0.506777777778 +4XAK_A,173,W,B,0.133,0.004,0.616,0.381,0.491333333333 +4XAK_A,174,L,B,0.157,0.003,0.718,0.279,0.474444444444 +4XAK_A,175,V,B,0.059,0.002,0.816,0.182,0.477777777778 +4XAK_A,176,A,B,0.239,0.004,0.616,0.381,0.469444444444 +4XAK_A,177,S,B,0.227,0.005,0.262,0.733,0.476666666667 +4XAK_A,178,G,E,0.333,0.021,0.279,0.699,0.476444444444 +4XAK_A,179,S,B,0.313,0.022,0.359,0.619,0.478444444444 +4XAK_A,180,T,E,0.474,0.022,0.552,0.426,0.505333333333 +4XAK_A,181,V,B,0.19,0.022,0.552,0.426,0.526555555556 +4XAK_A,182,A,E,0.383,0.022,0.552,0.426,0.538777777778 +4XAK_A,183,M,B,0.242,0.021,0.451,0.528,0.536888888889 +4XAK_A,184,T,E,0.458,0.022,0.359,0.619,0.536555555556 +4XAK_A,185,E,E,0.598,0.019,0.141,0.840,0.535777777778 +4XAK_A,186,Q,E,0.477,0.020,0.205,0.775,0.511888888889 +4XAK_A,187,L,B,0.121,0.021,0.451,0.528,0.492555555556 +4XAK_A,188,Q,E,0.307,0.023,0.655,0.322,0.462333333333 +4XAK_A,189,M,B,0.115,0.018,0.846,0.136,0.432777777778 +4XAK_A,190,G,B,0.067,0.011,0.918,0.071,0.403222222222 +4XAK_A,191,F,B,0.074,0.006,0.962,0.032,0.367111111111 +4XAK_A,192,G,B,0.068,0.001,0.959,0.040,0.363 +4XAK_A,193,I,B,0.049,0.001,0.959,0.040,0.351555555556 +4XAK_A,194,T,B,0.083,0.001,0.959,0.040,0.353222222222 +4XAK_A,195,V,B,0.083,0.001,0.900,0.099,0.393666666667 +4XAK_A,196,Q,B,0.254,0.002,0.816,0.182,0.430222222222 +4XAK_A,197,Y,B,0.227,0.003,0.718,0.279,0.462555555556 +4XAK_A,198,G,B,0.199,0.005,0.336,0.660,0.49 +4XAK_A,199,T,E,0.392,0.019,0.141,0.840,0.510222222222 +4XAK_A,200,T,E,0.474,0.018,0.088,0.893,0.524222222222 +4XAK_A,201,N,E,0.565,0.018,0.088,0.893,0.537555555556 +4XAK_A,202,S,E,0.424,0.020,0.205,0.775,0.551222222222 +4XAK_A,203,V,B,0.224,0.066,0.296,0.638,0.558888888889 +4XAK_A,204,C,B,0.087,0.020,0.205,0.775,0.555444444444 +4XAK_A,205,P,E,0.35,0.056,0.142,0.802,0.537888888889 +4XAK_A,206,K,E,0.402,0.056,0.142,0.802,0.541888888889 +4XAK_A,207,L,B,0.283,0.064,0.216,0.721,0.479444444444 +4XAK_A,208,E,E,0.613,0.066,0.296,0.638,0.423777777778 +4XAK_A,209,F,E,0.337,0.018,0.088,0.893,0.376111111111 +4XAK_A,210,A,E,0.848,0.003,0.003,0.994,0.315666666667 +4WFF_A,1,R,E,0.768,0.003,0.003,0.994,0.183 +4WFF_A,2,S,E,0.556,0.176,0.004,0.820,0.223777777778 +4WFF_A,3,T,E,0.284,0.406,0.004,0.590,0.267444444444 +4WFF_A,4,T,E,0.388,0.802,0.014,0.185,0.288222222222 +4WFF_A,5,L,B,0.165,0.938,0.007,0.055,0.313888888889 +4WFF_A,6,L,B,0.171,0.975,0.003,0.022,0.309333333333 +4WFF_A,7,A,B,0.155,0.975,0.003,0.022,0.304222222222 +4WFF_A,8,L,B,0.14,0.988,0.000,0.012,0.290888888889 +4WFF_A,9,L,B,0.196,0.988,0.000,0.012,0.277444444444 +4WFF_A,10,A,B,0.212,0.988,0.000,0.012,0.266777777778 +4WFF_A,11,L,B,0.137,0.988,0.000,0.012,0.256555555556 +4WFF_A,12,V,B,0.19,0.988,0.000,0.012,0.236555555556 +4WFF_A,13,L,E,0.234,0.988,0.000,0.012,0.236555555556 +4WFF_A,14,L,B,0.219,0.988,0.000,0.012,0.248222222222 +4WFF_A,15,Y,B,0.204,0.988,0.000,0.012,0.256666666667 +4WFF_A,16,L,B,0.131,0.988,0.000,0.012,0.269888888889 +4WFF_A,17,V,E,0.28,0.988,0.000,0.012,0.290111111111 +4WFF_A,18,S,B,0.218,0.970,0.001,0.030,0.296555555556 +4WFF_A,19,G,B,0.144,0.970,0.001,0.030,0.287777777778 +4WFF_A,20,A,B,0.116,0.970,0.001,0.030,0.310333333333 +4WFF_A,21,L,B,0.218,0.988,0.000,0.012,0.333555555556 +4WFF_A,22,V,B,0.073,0.970,0.001,0.030,0.346222222222 +4WFF_A,23,F,B,0.039,0.970,0.001,0.030,0.367444444444 +4WFF_A,24,R,B,0.219,0.938,0.007,0.055,0.402 +4WFF_A,25,A,B,0.224,0.938,0.007,0.055,0.436888888889 +4WFF_A,26,L,B,0.083,0.717,0.014,0.269,0.459111111111 +4WFF_A,27,E,B,0.297,0.321,0.003,0.675,0.493444444444 +4WFF_A,28,Q,E,0.412,0.053,0.005,0.942,0.534222222222 +4WFF_A,29,P,E,0.618,0.176,0.004,0.820,0.545444444444 +4WFF_A,30,H,E,0.49,0.522,0.016,0.462,0.560444444444 +4WFF_A,31,E,E,0.37,0.923,0.002,0.076,0.596444444444 +4WFF_A,32,Q,E,0.476,0.970,0.001,0.030,0.605444444444 +4WFF_A,33,Q,E,0.515,0.970,0.001,0.030,0.604444444444 +4WFF_A,34,A,E,0.294,0.970,0.001,0.030,0.585222222222 +4WFF_A,35,Q,E,0.315,0.970,0.001,0.030,0.578777777778 +4WFF_A,36,R,E,0.541,0.970,0.001,0.030,0.574888888889 +4WFF_A,37,E,E,0.413,0.970,0.001,0.030,0.575444444444 +4WFF_A,38,L,B,0.092,0.970,0.001,0.030,0.571777777778 +4WFF_A,39,G,E,0.449,0.970,0.001,0.030,0.580111111111 +4WFF_A,40,E,E,0.584,0.970,0.001,0.030,0.573444444444 +4WFF_A,41,V,B,0.19,0.970,0.001,0.030,0.547333333333 +4WFF_A,42,R,B,0.16,0.970,0.001,0.030,0.535777777778 +4WFF_A,43,E,E,0.443,0.970,0.001,0.030,0.552 +4WFF_A,44,K,E,0.487,0.970,0.001,0.030,0.550111111111 +4WFF_A,45,F,B,0.071,0.970,0.001,0.030,0.541666666667 +4WFF_A,46,L,B,0.148,0.970,0.001,0.030,0.533 +4WFF_A,47,R,E,0.576,0.970,0.001,0.030,0.538 +4WFF_A,48,A,E,0.441,0.923,0.002,0.076,0.529222222222 +4WFF_A,49,H,B,0.134,0.782,0.003,0.216,0.523222222222 +4WFF_A,50,P,B,0.301,0.694,0.003,0.303,0.544111111111 +4WFF_A,51,C,E,0.421,0.600,0.003,0.397,0.551777777778 +4WFF_A,52,V,B,0.24,0.321,0.003,0.675,0.562222222222 +4WFF_A,53,S,B,0.26,0.181,0.016,0.803,0.56 +4WFF_A,54,D,E,0.386,0.923,0.002,0.076,0.567777777778 +4WFF_A,55,Q,E,0.554,0.970,0.001,0.030,0.566777777778 +4WFF_A,56,E,B,0.25,0.970,0.001,0.030,0.535111111111 +4WFF_A,57,L,B,0.074,0.970,0.001,0.030,0.515333333333 +4WFF_A,58,G,E,0.387,0.970,0.001,0.030,0.513333333333 +4WFF_A,59,L,E,0.392,0.970,0.001,0.030,0.497222222222 +4WFF_A,60,L,B,0.069,0.970,0.001,0.030,0.462111111111 +4WFF_A,61,I,B,0.086,0.970,0.001,0.030,0.434888888889 +4WFF_A,62,K,E,0.412,0.970,0.001,0.030,0.432333333333 +4WFF_A,63,E,B,0.251,0.970,0.001,0.030,0.423111111111 +4WFF_A,64,V,B,0.038,0.988,0.000,0.012,0.400888888889 +4WFF_A,65,A,B,0.176,0.970,0.001,0.030,0.425222222222 +4WFF_A,66,D,E,0.448,0.970,0.001,0.030,0.442666666667 +4WFF_A,67,A,B,0.111,0.970,0.001,0.030,0.451 +4WFF_A,68,L,B,0.112,0.923,0.002,0.076,0.461333333333 +4WFF_A,69,G,E,0.472,0.782,0.003,0.216,0.502777777778 +4WFF_A,70,G,E,0.419,0.600,0.003,0.397,0.525666666667 +4WFF_A,71,G,E,0.329,0.339,0.016,0.645,0.547666666667 +4WFF_A,72,A,B,0.241,0.113,0.043,0.844,0.584222222222 +4WFF_A,73,D,E,0.439,0.118,0.150,0.732,0.624333333333 +4WFF_A,74,P,E,0.41,0.064,0.216,0.721,0.636555555556 +4WFF_A,75,E,E,0.44,0.056,0.142,0.802,0.649333333333 +4WFF_A,76,T,E,0.498,0.052,0.084,0.864,0.656111111111 +4WFF_A,77,S,E,0.472,0.053,0.043,0.903,0.658888888889 +4WFF_A,78,H,E,0.46,0.053,0.043,0.903,0.646333333333 +4WFF_A,79,S,E,0.512,0.053,0.043,0.903,0.628111111111 +4WFF_A,80,A,E,0.455,0.115,0.016,0.868,0.601111111111 +4WFF_A,81,W,B,0.107,0.115,0.016,0.868,0.562666666667 +4WFF_A,82,D,E,0.407,0.522,0.016,0.462,0.518333333333 +4WFF_A,83,L,B,0.156,0.879,0.010,0.111,0.481111111111 +4WFF_A,84,G,B,0.157,0.802,0.014,0.185,0.45 +4WFF_A,85,S,B,0.269,0.879,0.010,0.111,0.412111111111 +4WFF_A,86,A,B,0.049,0.879,0.010,0.111,0.380666666667 +4WFF_A,87,F,B,0.086,0.831,0.044,0.125,0.353 +4WFF_A,88,F,B,0.18,0.779,0.100,0.120,0.326111111111 +4WFF_A,89,F,B,0.089,0.779,0.100,0.120,0.306777777778 +4WFF_A,90,S,B,0.046,0.779,0.100,0.120,0.289222222222 +4WFF_A,91,G,B,0.111,0.807,0.137,0.056,0.290111111111 +4WFF_A,92,T,B,0.056,0.725,0.163,0.112,0.308222222222 +4WFF_A,93,I,B,0.047,0.662,0.225,0.113,0.320222222222 +4WFF_A,94,I,B,0.057,0.578,0.229,0.194,0.340444444444 +4WFF_A,95,T,B,0.058,0.199,0.152,0.649,0.371666666667 +4WFF_A,96,T,B,0.176,0.113,0.087,0.800,0.407666666667 +4WFF_A,97,I,B,0.137,0.018,0.047,0.935,0.439222222222 +4WFF_A,98,G,B,0.197,0.018,0.047,0.935,0.461444444444 +4WFF_A,99,Y,B,0.23,0.018,0.019,0.964,0.492 +4WFF_A,100,G,E,0.485,0.005,0.015,0.979,0.510444444444 +4WFF_A,101,N,E,0.338,0.005,0.045,0.951,0.526 +4WFF_A,102,V,B,0.095,0.019,0.141,0.840,0.524777777778 +4WFF_A,103,A,B,0.237,0.004,0.138,0.858,0.524888888889 +4WFF_A,104,L,B,0.064,0.004,0.138,0.858,0.516888888889 +4WFF_A,105,R,E,0.295,0.018,0.088,0.893,0.498555555556 +4WFF_A,106,T,B,0.098,0.018,0.019,0.964,0.487888888889 +4WFF_A,107,D,E,0.352,0.406,0.004,0.590,0.479666666667 +4WFF_A,108,A,B,0.218,0.694,0.003,0.303,0.457777777778 +4WFF_A,109,G,B,0.091,0.694,0.003,0.303,0.433555555556 +4WFF_A,110,R,B,0.151,0.923,0.002,0.076,0.394666666667 +4WFF_A,111,L,B,0.108,0.938,0.007,0.055,0.372111111111 +4WFF_A,112,F,B,0.142,0.938,0.007,0.055,0.357888888889 +4WFF_A,113,C,B,0.156,0.975,0.003,0.022,0.333444444444 +4WFF_A,114,I,B,0.094,0.975,0.003,0.022,0.317444444444 +4WFF_A,115,F,B,0.224,0.975,0.003,0.022,0.299333333333 +4WFF_A,116,Y,B,0.223,0.975,0.003,0.022,0.290555555556 +4WFF_A,117,A,B,0.149,0.988,0.000,0.012,0.284555555556 +4WFF_A,118,L,B,0.226,0.970,0.001,0.030,0.299777777778 +4WFF_A,119,V,E,0.304,0.970,0.001,0.030,0.308777777778 +4WFF_A,120,G,B,0.254,0.923,0.002,0.076,0.316888888889 +4WFF_A,121,I,B,0.171,0.923,0.002,0.076,0.310777777778 +4WFF_A,122,P,B,0.248,0.970,0.001,0.030,0.327555555556 +4WFF_A,123,L,E,0.292,0.988,0.000,0.012,0.331 +4WFF_A,124,F,B,0.204,0.988,0.000,0.012,0.331555555556 +4WFF_A,125,G,B,0.201,0.988,0.000,0.012,0.332555555556 +4WFF_A,126,I,B,0.207,0.975,0.003,0.022,0.345111111111 +4WFF_A,127,L,B,0.199,0.975,0.003,0.022,0.350222222222 +4WFF_A,128,L,B,0.198,0.970,0.001,0.030,0.362 +4WFF_A,129,A,B,0.233,0.970,0.001,0.030,0.387666666667 +4WFF_A,130,G,E,0.346,0.970,0.001,0.030,0.422888888889 +4WFF_A,131,V,B,0.193,0.970,0.001,0.030,0.435888888889 +4WFF_A,132,G,B,0.173,0.923,0.002,0.076,0.455444444444 +4WFF_A,133,D,E,0.39,0.970,0.001,0.030,0.474444444444 +4WFF_A,134,R,B,0.291,0.970,0.001,0.030,0.489555555556 +4WFF_A,135,L,B,0.14,0.970,0.001,0.030,0.498222222222 +4WFF_A,136,G,E,0.346,0.938,0.007,0.055,0.518 +4WFF_A,137,S,E,0.497,0.938,0.007,0.055,0.526666666667 +4WFF_A,138,S,B,0.26,0.858,0.002,0.139,0.518777777778 +4WFF_A,139,L,B,0.238,0.802,0.014,0.185,0.519 +4WFF_A,140,R,E,0.531,0.879,0.010,0.111,0.517888888889 +4WFF_A,141,H,E,0.454,0.879,0.010,0.111,0.520111111111 +4WFF_A,142,G,B,0.215,0.879,0.010,0.111,0.525666666667 +4WFF_A,143,I,E,0.327,0.879,0.010,0.111,0.540333333333 +4WFF_A,144,G,E,0.538,0.879,0.010,0.111,0.546555555556 +4WFF_A,145,H,E,0.361,0.879,0.010,0.111,0.543888888889 +4WFF_A,146,I,E,0.304,0.802,0.014,0.185,0.557222222222 +4WFF_A,147,E,E,0.549,0.717,0.014,0.269,0.567 +4WFF_A,148,A,E,0.403,0.622,0.015,0.363,0.571666666667 +4WFF_A,149,I,E,0.313,0.430,0.016,0.555,0.592222222222 +4WFF_A,150,F,E,0.415,0.354,0.048,0.598,0.610888888889 +4WFF_A,151,L,E,0.459,0.354,0.048,0.598,0.627444444444 +4WFF_A,152,K,E,0.433,0.354,0.048,0.598,0.626555555556 +4WFF_A,153,W,E,0.424,0.268,0.043,0.689,0.632 +4WFF_A,154,H,E,0.429,0.184,0.043,0.773,0.638222222222 +4WFF_A,155,V,E,0.426,0.268,0.043,0.689,0.639888888889 +4WFF_A,156,P,E,0.484,0.184,0.043,0.773,0.644888888889 +4WFF_A,157,P,E,0.401,0.257,0.016,0.727,0.663666666667 +4WFF_A,158,E,E,0.446,0.268,0.043,0.689,0.651333333333 +4WFF_A,159,L,E,0.43,0.268,0.043,0.689,0.650111111111 +4WFF_A,160,V,E,0.38,0.278,0.093,0.628,0.647666666667 +4WFF_A,161,R,E,0.4,0.191,0.086,0.723,0.645333333333 +4WFF_A,162,V,E,0.419,0.199,0.152,0.649,0.642777777778 +4WFF_A,163,L,E,0.406,0.199,0.152,0.649,0.630444444444 +4WFF_A,164,S,E,0.341,0.113,0.087,0.800,0.617222222222 +4WFF_A,165,A,E,0.367,0.184,0.043,0.773,0.605 +4WFF_A,166,M,E,0.303,0.191,0.086,0.723,0.568444444444 +4WFF_A,167,L,B,0.246,0.191,0.086,0.723,0.566333333333 +4WFF_A,168,F,B,0.164,0.199,0.152,0.649,0.546555555556 +4WFF_A,169,L,B,0.15,0.216,0.235,0.548,0.522111111111 +4WFF_A,170,L,B,0.172,0.135,0.317,0.548,0.511444444444 +4WFF_A,171,I,E,0.365,0.125,0.227,0.648,0.494111111111 +4WFF_A,172,G,B,0.128,0.118,0.150,0.732,0.478666666667 +4WFF_A,173,C,B,0.225,0.191,0.086,0.723,0.452777777778 +4WFF_A,174,L,B,0.132,0.278,0.093,0.628,0.413555555556 +4WFF_A,175,L,B,0.176,0.538,0.173,0.289,0.385555555556 +4WFF_A,176,F,B,0.226,0.662,0.225,0.113,0.350222222222 +4WFF_A,177,V,B,0.187,0.662,0.225,0.113,0.326333333333 +4WFF_A,178,L,B,0.17,0.725,0.163,0.112,0.316 +4WFF_A,179,T,B,0.197,0.831,0.044,0.125,0.296222222222 +4WFF_A,180,P,B,0.166,0.802,0.014,0.185,0.292888888889 +4WFF_A,181,T,B,0.233,0.879,0.010,0.111,0.293111111111 +4WFF_A,182,F,B,0.158,0.879,0.010,0.111,0.311222222222 +4WFF_A,183,V,B,0.104,0.879,0.010,0.111,0.344888888889 +4WFF_A,184,F,B,0.128,0.879,0.010,0.111,0.388666666667 +4WFF_A,185,C,B,0.249,0.802,0.014,0.185,0.431444444444 +4WFF_A,186,Y,E,0.298,0.717,0.014,0.269,0.456666666667 +4WFF_A,187,M,B,0.292,0.561,0.047,0.393,0.483222222222 +4WFF_A,188,E,E,0.455,0.268,0.043,0.689,0.498222222222 +4WFF_A,189,D,E,0.676,0.058,0.017,0.925,0.503444444444 +4WFF_A,190,W,B,0.108,0.053,0.043,0.903,0.508888888889 +4WFF_A,191,S,E,0.37,0.113,0.087,0.800,0.492111111111 +4WFF_A,192,K,B,0.142,0.321,0.252,0.427,0.478666666667 +4WFF_A,193,L,B,0.113,0.321,0.252,0.427,0.434555555556 +4WFF_A,194,E,B,0.233,0.231,0.330,0.439,0.392444444444 +4WFF_A,195,A,B,0.032,0.159,0.516,0.325,0.359222222222 +4WFF_A,196,I,B,0.057,0.172,0.690,0.138,0.325222222222 +4WFF_A,197,Y,B,0.053,0.172,0.690,0.138,0.304333333333 +4WFF_A,198,F,B,0.045,0.172,0.690,0.138,0.277111111111 +4WFF_A,199,V,B,0.023,0.157,0.773,0.069,0.253111111111 +4WFF_A,200,V,B,0.036,0.072,0.855,0.073,0.255333333333 +4WFF_A,201,T,B,0.031,0.085,0.775,0.140,0.258222222222 +4WFF_A,202,L,B,0.043,0.087,0.683,0.230,0.273444444444 +4WFF_A,203,T,B,0.073,0.079,0.592,0.329,0.295444444444 +4WFF_A,204,T,B,0.092,0.074,0.484,0.442,0.332888888889 +4WFF_A,205,V,B,0.053,0.069,0.386,0.545,0.366666666667 +4WFF_A,206,G,B,0.139,0.125,0.227,0.648,0.395 +4WFF_A,207,F,B,0.162,0.118,0.150,0.732,0.430666666667 +4WFF_A,208,G,B,0.229,0.056,0.142,0.802,0.460333333333 +4WFF_A,209,D,B,0.17,0.056,0.142,0.802,0.479555555556 +4WFF_A,210,Y,B,0.182,0.066,0.296,0.638,0.499888888889 +4WFF_A,211,V,B,0.191,0.069,0.386,0.545,0.524777777778 +4WFF_A,212,A,B,0.155,0.021,0.279,0.699,0.549 +4WFF_A,213,G,E,0.348,0.019,0.141,0.840,0.569 +4WFF_A,214,A,E,0.44,0.019,0.141,0.840,0.589666666667 +4WFF_A,215,D,E,0.399,0.018,0.088,0.893,0.606333333333 +4WFF_A,216,P,E,0.455,0.053,0.043,0.903,0.614666666667 +4WFF_A,217,R,E,0.617,0.053,0.043,0.903,0.628333333333 +4WFF_A,218,Q,E,0.5,0.052,0.084,0.864,0.639888888889 +4WFF_A,219,D,E,0.545,0.113,0.087,0.800,0.633444444444 +4WFF_A,220,S,E,0.311,0.113,0.043,0.844,0.621333333333 +4WFF_A,221,P,E,0.324,0.455,0.046,0.498,0.598888888889 +4WFF_A,222,A,B,0.232,0.622,0.015,0.363,0.567777777778 +4WFF_A,223,Y,B,0.164,0.802,0.014,0.185,0.528111111111 +4WFF_A,224,Q,B,0.201,0.938,0.007,0.055,0.501333333333 +4WFF_A,225,P,B,0.151,0.938,0.007,0.055,0.471111111111 +4WFF_A,226,L,B,0.163,0.950,0.028,0.022,0.435222222222 +4WFF_A,227,V,B,0.204,0.975,0.003,0.022,0.397888888889 +4WFF_A,228,W,B,0.232,0.975,0.003,0.022,0.369777777778 +4WFF_A,229,F,B,0.223,0.975,0.003,0.022,0.339666666667 +4WFF_A,230,W,E,0.23,0.992,0.000,0.007,0.318444444444 +4WFF_A,231,I,B,0.203,0.988,0.000,0.012,0.301666666667 +4WFF_A,232,L,E,0.217,0.988,0.000,0.012,0.303777777778 +4WFF_A,233,L,E,0.29,0.970,0.001,0.030,0.311444444444 +4WFF_A,234,G,B,0.288,0.970,0.001,0.030,0.305222222222 +4WFF_A,235,L,B,0.23,0.970,0.001,0.030,0.298444444444 +4WFF_A,236,A,B,0.21,0.970,0.001,0.030,0.306444444444 +4WFF_A,237,Y,B,0.21,0.970,0.001,0.030,0.310666666667 +4WFF_A,238,F,B,0.192,0.988,0.000,0.012,0.33 +4WFF_A,239,A,B,0.231,0.988,0.000,0.012,0.347555555556 +4WFF_A,240,S,B,0.2,0.970,0.001,0.030,0.369777777778 +4WFF_A,241,V,B,0.123,0.970,0.001,0.030,0.358222222222 +4WFF_A,242,L,B,0.204,0.970,0.001,0.030,0.344444444444 +4WFF_A,243,T,B,0.296,0.988,0.000,0.012,0.369222222222 +4WFF_A,244,T,B,0.228,0.988,0.000,0.012,0.403888888889 +4WFF_A,245,I,B,0.069,0.988,0.000,0.012,0.401222222222 +4WFF_A,246,G,B,0.171,0.988,0.000,0.012,0.424777777778 +4WFF_A,247,N,E,0.549,0.970,0.001,0.030,0.434333333333 +4WFF_A,248,W,B,0.235,0.938,0.007,0.055,0.427666666667 +4WFF_A,249,L,B,0.082,0.879,0.010,0.111,0.373555555556 +4WFF_A,250,R,E,0.559,0.802,0.014,0.185,0.340333333333 +4WFF_A,251,V,E,0.547,0.522,0.016,0.462,0.300555555556 +4WFF_A,252,V,E,0.456,0.053,0.005,0.942,0.246 +4WFF_B,1,R,E,0.768,0.003,0.003,0.994,0.178333333333 +4WFF_B,2,S,E,0.495,0.181,0.016,0.803,0.219555555556 +4WFF_B,3,T,E,0.235,0.430,0.016,0.555,0.260666666667 +4WFF_B,4,T,E,0.364,0.802,0.014,0.185,0.282666666667 +4WFF_B,5,L,B,0.16,0.938,0.007,0.055,0.308222222222 +4WFF_B,6,L,B,0.169,0.975,0.003,0.022,0.306444444444 +4WFF_B,7,A,B,0.17,0.970,0.001,0.030,0.305111111111 +4WFF_B,8,L,B,0.157,0.988,0.000,0.012,0.290777777778 +4WFF_B,9,L,B,0.169,0.988,0.000,0.012,0.278555555556 +4WFF_B,10,A,B,0.229,0.988,0.000,0.012,0.270555555556 +4WFF_B,11,L,B,0.137,0.988,0.000,0.012,0.261 +4WFF_B,12,V,B,0.181,0.988,0.000,0.012,0.244777777778 +4WFF_B,13,L,E,0.221,0.988,0.000,0.012,0.242111111111 +4WFF_B,14,L,B,0.241,0.988,0.000,0.012,0.256444444444 +4WFF_B,15,Y,B,0.222,0.988,0.000,0.012,0.264666666667 +4WFF_B,16,L,B,0.135,0.988,0.000,0.012,0.279222222222 +4WFF_B,17,V,E,0.297,0.988,0.000,0.012,0.302888888889 +4WFF_B,18,S,B,0.253,0.970,0.001,0.030,0.310555555556 +4WFF_B,19,G,B,0.182,0.970,0.001,0.030,0.299888888889 +4WFF_B,20,A,B,0.13,0.970,0.001,0.030,0.323666666667 +4WFF_B,21,L,B,0.217,0.988,0.000,0.012,0.344444444444 +4WFF_B,22,V,B,0.082,0.988,0.000,0.012,0.359333333333 +4WFF_B,23,F,B,0.048,0.970,0.001,0.030,0.381111111111 +4WFF_B,24,R,B,0.244,0.970,0.001,0.030,0.418111111111 +4WFF_B,25,A,B,0.223,0.938,0.007,0.055,0.449888888889 +4WFF_B,26,L,B,0.081,0.694,0.003,0.303,0.469 +4WFF_B,27,E,E,0.344,0.321,0.003,0.675,0.501333333333 +4WFF_B,28,Q,E,0.42,0.053,0.005,0.942,0.541888888889 +4WFF_B,29,P,E,0.648,0.109,0.005,0.886,0.552888888889 +4WFF_B,30,H,E,0.494,0.339,0.016,0.645,0.571888888889 +4WFF_B,31,E,E,0.4,0.938,0.007,0.055,0.605111111111 +4WFF_B,32,Q,E,0.483,0.975,0.003,0.022,0.614111111111 +4WFF_B,33,Q,E,0.523,0.970,0.001,0.030,0.610777777778 +4WFF_B,34,A,B,0.259,0.970,0.001,0.030,0.583444444444 +4WFF_B,35,Q,E,0.286,0.970,0.001,0.030,0.577777777778 +4WFF_B,36,R,E,0.554,0.970,0.001,0.030,0.573222222222 +4WFF_B,37,E,E,0.464,0.970,0.001,0.030,0.574111111111 +4WFF_B,38,L,B,0.074,0.970,0.001,0.030,0.569222222222 +4WFF_B,39,G,E,0.423,0.970,0.001,0.030,0.575666666667 +4WFF_B,40,E,E,0.573,0.970,0.001,0.030,0.572666666667 +4WFF_B,41,V,B,0.208,0.970,0.001,0.030,0.540444444444 +4WFF_B,42,R,B,0.114,0.970,0.001,0.030,0.510333333333 +4WFF_B,43,E,E,0.393,0.970,0.001,0.030,0.539111111111 +4WFF_B,44,K,E,0.476,0.970,0.001,0.030,0.538666666667 +4WFF_B,45,F,B,0.058,0.970,0.001,0.030,0.529111111111 +4WFF_B,46,L,B,0.086,0.970,0.001,0.030,0.520222222222 +4WFF_B,47,R,E,0.526,0.923,0.002,0.076,0.520222222222 +4WFF_B,48,A,E,0.416,0.923,0.002,0.076,0.511555555556 +4WFF_B,49,H,B,0.169,0.694,0.003,0.303,0.511222222222 +4WFF_B,50,P,B,0.27,0.600,0.003,0.397,0.537777777778 +4WFF_B,51,C,E,0.397,0.321,0.003,0.675,0.563444444444 +4WFF_B,52,V,B,0.198,0.115,0.016,0.868,0.572888888889 +4WFF_B,53,S,E,0.357,0.058,0.017,0.925,0.567555555556 +4WFF_B,54,D,E,0.459,0.923,0.002,0.076,0.576888888889 +4WFF_B,55,Q,E,0.667,0.970,0.001,0.030,0.575222222222 +4WFF_B,56,E,E,0.281,0.970,0.001,0.030,0.547777777778 +4WFF_B,57,L,B,0.081,0.970,0.001,0.030,0.526555555556 +4WFF_B,58,G,E,0.393,0.970,0.001,0.030,0.517222222222 +4WFF_B,59,L,E,0.39,0.970,0.001,0.030,0.502222222222 +4WFF_B,60,L,B,0.067,0.970,0.001,0.030,0.467111111111 +4WFF_B,61,I,B,0.071,0.970,0.001,0.030,0.437111111111 +4WFF_B,62,K,E,0.385,0.970,0.001,0.030,0.439444444444 +4WFF_B,63,E,E,0.306,0.970,0.001,0.030,0.435 +4WFF_B,64,V,B,0.057,0.970,0.001,0.030,0.416333333333 +4WFF_B,65,A,B,0.147,0.970,0.001,0.030,0.430888888889 +4WFF_B,66,D,E,0.399,0.970,0.001,0.030,0.445111111111 +4WFF_B,67,A,B,0.185,0.970,0.001,0.030,0.444111111111 +4WFF_B,68,L,B,0.133,0.923,0.002,0.076,0.443666666667 +4WFF_B,69,G,E,0.321,0.938,0.007,0.055,0.476 +4WFF_B,70,G,E,0.378,0.802,0.014,0.185,0.495111111111 +4WFF_B,71,G,B,0.165,0.717,0.014,0.269,0.514555555556 +4WFF_B,72,A,B,0.135,0.561,0.047,0.393,0.530333333333 +4WFF_B,73,D,E,0.301,0.386,0.097,0.517,0.570777777778 +4WFF_B,74,P,E,0.379,0.278,0.093,0.628,0.606777777778 +4WFF_B,75,E,E,0.595,0.191,0.086,0.723,0.624888888889 +4WFF_B,76,T,E,0.436,0.118,0.150,0.732,0.644555555556 +4WFF_B,77,Q,E,0.402,0.052,0.084,0.864,0.667777777778 +4WFF_B,78,S,E,0.531,0.053,0.043,0.903,0.675888888889 +4WFF_B,79,S,E,0.617,0.058,0.017,0.925,0.673666666667 +4WFF_B,80,H,E,0.448,0.113,0.043,0.844,0.657222222222 +4WFF_B,81,S,E,0.38,0.113,0.043,0.844,0.639333333333 +4WFF_B,82,A,E,0.376,0.268,0.043,0.689,0.606888888889 +4WFF_B,83,W,B,0.164,0.354,0.048,0.598,0.568777777778 +4WFF_B,84,D,E,0.446,0.660,0.049,0.291,0.536666666667 +4WFF_B,85,L,B,0.177,0.831,0.044,0.125,0.493666666667 +4WFF_B,86,G,B,0.152,0.751,0.050,0.199,0.459888888889 +4WFF_B,87,S,B,0.24,0.779,0.100,0.120,0.419111111111 +4WFF_B,88,A,B,0.121,0.725,0.163,0.112,0.378666666667 +4WFF_B,89,F,B,0.074,0.662,0.225,0.113,0.345666666667 +4WFF_B,90,F,B,0.137,0.680,0.265,0.055,0.318555555556 +4WFF_B,91,F,B,0.112,0.680,0.265,0.055,0.296666666667 +4WFF_B,92,S,B,0.055,0.746,0.197,0.057,0.279 +4WFF_B,93,G,B,0.126,0.746,0.197,0.057,0.261888888889 +4WFF_B,94,T,B,0.069,0.662,0.225,0.113,0.273777777778 +4WFF_B,95,I,B,0.062,0.649,0.163,0.188,0.288555555556 +4WFF_B,96,I,B,0.079,0.649,0.163,0.188,0.314444444444 +4WFF_B,97,T,B,0.057,0.538,0.173,0.289,0.346666666667 +4WFF_B,98,T,B,0.138,0.428,0.171,0.402,0.390555555556 +4WFF_B,99,I,B,0.215,0.199,0.152,0.649,0.426 +4WFF_B,100,G,E,0.291,0.199,0.152,0.649,0.454333333333 +4WFF_B,101,Y,B,0.167,0.113,0.087,0.800,0.490666666667 +4WFF_B,102,G,E,0.443,0.018,0.019,0.964,0.524444444444 +4WFF_B,103,N,E,0.348,0.053,0.043,0.903,0.552555555556 +4WFF_B,104,V,B,0.13,0.056,0.142,0.802,0.556666666667 +4WFF_B,105,A,B,0.198,0.019,0.141,0.840,0.558666666667 +4WFF_B,106,L,B,0.073,0.020,0.205,0.775,0.551444444444 +4WFF_B,107,R,E,0.303,0.019,0.141,0.840,0.53 +4WFF_B,108,T,B,0.143,0.053,0.043,0.903,0.513777777778 +4WFF_B,109,D,E,0.352,0.339,0.016,0.645,0.502333333333 +4WFF_B,110,A,B,0.253,0.502,0.002,0.495,0.475333333333 +4WFF_B,111,G,B,0.141,0.600,0.003,0.397,0.447333333333 +4WFF_B,112,R,B,0.171,0.802,0.014,0.185,0.408444444444 +4WFF_B,113,L,B,0.136,0.870,0.077,0.053,0.377 +4WFF_B,114,F,B,0.135,0.870,0.077,0.053,0.353222222222 +4WFF_B,115,C,B,0.124,0.918,0.063,0.019,0.327 +4WFF_B,116,I,B,0.116,0.950,0.028,0.022,0.301222222222 +4WFF_B,117,F,B,0.214,0.975,0.003,0.022,0.282333333333 +4WFF_B,118,Y,B,0.242,0.975,0.003,0.022,0.268 +4WFF_B,119,A,B,0.154,0.970,0.001,0.030,0.262888888889 +4WFF_B,120,L,B,0.228,0.970,0.001,0.030,0.269888888889 +4WFF_B,121,V,B,0.261,0.970,0.001,0.030,0.272888888889 +4WFF_B,122,G,B,0.197,0.923,0.002,0.076,0.279777777778 +4WFF_B,123,I,B,0.126,0.923,0.002,0.076,0.274222222222 +4WFF_B,124,P,B,0.176,0.923,0.002,0.076,0.284888888889 +4WFF_B,125,L,B,0.223,0.923,0.002,0.076,0.293444444444 +4WFF_B,126,F,B,0.195,0.970,0.001,0.030,0.298222222222 +4WFF_B,127,G,B,0.123,0.970,0.001,0.030,0.306111111111 +4WFF_B,128,I,B,0.175,0.975,0.003,0.022,0.322222222222 +4WFF_B,129,L,B,0.236,0.975,0.003,0.022,0.330888888889 +4WFF_B,130,L,B,0.192,0.938,0.007,0.055,0.348111111111 +4WFF_B,131,A,B,0.246,0.923,0.002,0.076,0.376333333333 +4WFF_B,132,G,E,0.389,0.858,0.002,0.139,0.418333333333 +4WFF_B,133,V,B,0.292,0.694,0.003,0.303,0.438555555556 +4WFF_B,134,G,B,0.235,0.694,0.003,0.303,0.452555555556 +4WFF_B,135,D,E,0.327,0.782,0.003,0.216,0.472222222222 +4WFF_B,136,R,B,0.244,0.879,0.010,0.111,0.485777777778 +4WFF_B,137,L,B,0.174,0.879,0.010,0.111,0.488666666667 +4WFF_B,138,G,B,0.278,0.802,0.014,0.185,0.506777777778 +4WFF_B,139,S,E,0.381,0.831,0.044,0.125,0.513 +4WFF_B,140,S,B,0.271,0.660,0.049,0.291,0.506555555556 +4WFF_B,141,L,B,0.219,0.605,0.105,0.290,0.503222222222 +4WFF_B,142,R,E,0.404,0.561,0.047,0.393,0.503888888889 +4WFF_B,143,H,E,0.396,0.622,0.015,0.363,0.519777777778 +4WFF_B,144,G,E,0.363,0.622,0.015,0.363,0.528444444444 +4WFF_B,145,I,E,0.426,0.622,0.015,0.363,0.548777777778 +4WFF_B,146,G,E,0.471,0.522,0.016,0.462,0.562444444444 +4WFF_B,147,H,E,0.363,0.561,0.047,0.393,0.572222222222 +4WFF_B,148,I,E,0.412,0.455,0.046,0.498,0.591333333333 +4WFF_B,149,E,E,0.414,0.339,0.016,0.645,0.599 +4WFF_B,150,A,E,0.4,0.354,0.048,0.598,0.605555555556 +4WFF_B,151,I,E,0.413,0.268,0.043,0.689,0.624888888889 +4WFF_B,152,F,E,0.424,0.354,0.048,0.598,0.634111111111 +4WFF_B,153,L,E,0.391,0.354,0.048,0.598,0.645333333333 +4WFF_B,154,K,E,0.39,0.268,0.043,0.689,0.637333333333 +4WFF_B,155,W,E,0.407,0.278,0.093,0.628,0.638777777778 +4WFF_B,156,H,E,0.384,0.191,0.086,0.723,0.637888888889 +4WFF_B,157,V,E,0.353,0.191,0.086,0.723,0.635666666667 +4WFF_B,158,P,E,0.398,0.184,0.043,0.773,0.643888888889 +4WFF_B,159,P,E,0.481,0.268,0.043,0.689,0.661111111111 +4WFF_B,160,E,E,0.399,0.268,0.043,0.689,0.646555555556 +4WFF_B,161,L,E,0.421,0.268,0.043,0.689,0.647555555556 +4WFF_B,162,V,E,0.398,0.268,0.043,0.689,0.649555555556 +4WFF_B,163,R,E,0.422,0.184,0.043,0.773,0.652555555556 +4WFF_B,164,V,E,0.406,0.191,0.086,0.723,0.656333333333 +4WFF_B,165,L,E,0.394,0.191,0.086,0.723,0.656444444444 +4WFF_B,166,S,E,0.413,0.184,0.043,0.773,0.645888888889 +4WFF_B,167,A,E,0.41,0.184,0.043,0.773,0.636555555556 +4WFF_B,168,M,E,0.395,0.184,0.043,0.773,0.601333333333 +4WFF_B,169,L,E,0.345,0.113,0.043,0.844,0.602 +4WFF_B,170,F,B,0.276,0.113,0.087,0.800,0.583111111111 +4WFF_B,171,L,B,0.203,0.064,0.216,0.721,0.559222222222 +4WFF_B,172,L,B,0.251,0.069,0.386,0.545,0.552555555556 +4WFF_B,173,I,E,0.308,0.021,0.279,0.699,0.547222222222 +4WFF_B,174,G,B,0.221,0.056,0.142,0.802,0.536 +4WFF_B,175,C,B,0.223,0.113,0.087,0.800,0.531111111111 +4WFF_B,176,L,E,0.306,0.191,0.086,0.723,0.528555555556 +4WFF_B,177,L,E,0.304,0.191,0.086,0.723,0.533777777778 +4WFF_B,178,F,B,0.209,0.191,0.086,0.723,0.512555555556 +4WFF_B,179,V,B,0.175,0.191,0.086,0.723,0.511555555556 +4WFF_B,180,L,E,0.326,0.199,0.152,0.649,0.508111111111 +4WFF_B,181,T,B,0.129,0.199,0.152,0.649,0.488555555556 +4WFF_B,182,P,B,0.122,0.199,0.152,0.649,0.475555555556 +4WFF_B,183,T,B,0.205,0.199,0.152,0.649,0.467666666667 +4WFF_B,184,F,B,0.091,0.321,0.252,0.427,0.467111111111 +4WFF_B,185,V,B,0.087,0.231,0.330,0.439,0.472444444444 +4WFF_B,186,F,B,0.111,0.231,0.330,0.439,0.484 +4WFF_B,187,C,B,0.26,0.231,0.330,0.439,0.509666666667 +4WFF_B,188,Y,E,0.328,0.191,0.086,0.723,0.516111111111 +4WFF_B,189,M,E,0.376,0.354,0.048,0.598,0.524333333333 +4WFF_B,190,E,E,0.509,0.257,0.016,0.727,0.536 +4WFF_B,191,D,E,0.541,0.246,0.004,0.750,0.522666666667 +4WFF_B,192,W,B,0.185,0.339,0.016,0.645,0.515555555556 +4WFF_B,193,S,E,0.26,0.455,0.046,0.498,0.488888888889 +4WFF_B,194,K,B,0.172,0.605,0.105,0.290,0.455666666667 +4WFF_B,195,L,B,0.053,0.649,0.163,0.188,0.418444444444 +4WFF_B,196,E,B,0.129,0.701,0.107,0.192,0.378111111111 +4WFF_B,197,A,B,0.037,0.725,0.163,0.112,0.332666666667 +4WFF_B,198,I,B,0.063,0.746,0.197,0.057,0.295111111111 +4WFF_B,199,Y,B,0.107,0.807,0.137,0.056,0.262888888889 +4WFF_B,200,F,B,0.071,0.725,0.163,0.112,0.244333333333 +4WFF_B,201,V,B,0.064,0.725,0.163,0.112,0.215888888889 +4WFF_B,202,I,B,0.078,0.662,0.225,0.113,0.215888888889 +4WFF_B,203,V,B,0.066,0.594,0.285,0.121,0.221555555556 +4WFF_B,204,T,B,0.052,0.594,0.285,0.121,0.231555555556 +4WFF_B,205,L,B,0.051,0.578,0.229,0.194,0.248888888889 +4WFF_B,206,T,B,0.085,0.453,0.248,0.299,0.284444444444 +4WFF_B,207,T,B,0.088,0.321,0.252,0.427,0.328666666667 +4WFF_B,208,V,B,0.056,0.216,0.235,0.548,0.371333333333 +4WFF_B,209,G,B,0.131,0.199,0.152,0.649,0.406777777778 +4WFF_B,210,F,B,0.153,0.118,0.150,0.732,0.445222222222 +4WFF_B,211,G,B,0.214,0.056,0.142,0.802,0.468555555556 +4WFF_B,212,D,B,0.157,0.064,0.216,0.721,0.489777777778 +4WFF_B,213,Y,B,0.175,0.069,0.386,0.545,0.506888888889 +4WFF_B,214,V,B,0.172,0.021,0.451,0.528,0.530222222222 +4WFF_B,215,A,B,0.14,0.022,0.359,0.619,0.554666666667 +4WFF_B,216,G,E,0.334,0.020,0.205,0.775,0.573222222222 +4WFF_B,217,A,E,0.373,0.019,0.141,0.840,0.589444444444 +4WFF_B,218,D,E,0.442,0.052,0.084,0.864,0.604555555556 +4WFF_B,219,P,E,0.464,0.053,0.043,0.903,0.617111111111 +4WFF_B,220,R,E,0.565,0.113,0.087,0.800,0.636111111111 +4WFF_B,221,Q,E,0.443,0.113,0.087,0.800,0.649888888889 +4WFF_B,222,D,E,0.448,0.191,0.086,0.723,0.645444444444 +4WFF_B,223,S,E,0.326,0.184,0.043,0.773,0.630666666667 +4WFF_B,224,P,E,0.321,0.522,0.016,0.462,0.605444444444 +4WFF_B,225,A,B,0.261,0.694,0.003,0.303,0.572777777778 +4WFF_B,226,Y,B,0.193,0.782,0.003,0.216,0.534888888889 +4WFF_B,227,Q,B,0.212,0.938,0.007,0.055,0.507777777778 +4WFF_B,228,P,B,0.163,0.938,0.007,0.055,0.474777777778 +4WFF_B,229,L,B,0.167,0.950,0.028,0.022,0.434777777778 +4WFF_B,230,V,B,0.188,0.975,0.003,0.022,0.393555555556 +4WFF_B,231,W,B,0.202,0.985,0.006,0.009,0.365444444444 +4WFF_B,232,F,E,0.24,0.975,0.003,0.022,0.338111111111 +4WFF_B,233,W,E,0.226,0.975,0.003,0.022,0.316777777778 +4WFF_B,234,I,B,0.182,0.975,0.003,0.022,0.299666666667 +4WFF_B,235,L,B,0.205,0.988,0.000,0.012,0.302444444444 +4WFF_B,236,L,E,0.292,0.970,0.001,0.030,0.310111111111 +4WFF_B,237,G,B,0.281,0.970,0.001,0.030,0.304111111111 +4WFF_B,238,L,B,0.212,0.970,0.001,0.030,0.296444444444 +4WFF_B,239,A,B,0.221,0.970,0.001,0.030,0.302 +4WFF_B,240,Y,B,0.211,0.970,0.001,0.030,0.306555555556 +4WFF_B,241,F,B,0.22,0.988,0.000,0.012,0.319777777778 +4WFF_B,242,A,B,0.223,0.988,0.000,0.012,0.334888888889 +4WFF_B,243,S,B,0.219,0.970,0.001,0.030,0.352222222222 +4WFF_B,244,V,B,0.17,0.970,0.001,0.030,0.351111111111 +4WFF_B,245,L,B,0.237,0.970,0.001,0.030,0.336444444444 +4WFF_B,246,T,B,0.263,0.988,0.000,0.012,0.354555555556 +4WFF_B,247,T,B,0.283,0.988,0.000,0.012,0.387 +4WFF_B,248,I,B,0.12,0.988,0.000,0.012,0.391111111111 +4WFF_B,249,G,B,0.153,0.970,0.001,0.030,0.405888888889 +4WFF_B,250,N,E,0.575,0.923,0.002,0.076,0.367444444444 +4WFF_B,251,W,E,0.283,0.858,0.002,0.139,0.324 +4WFF_B,252,L,B,0.104,0.694,0.003,0.303,0.275777777778 +4WFF_B,253,R,E,0.739,0.053,0.005,0.942,0.232444444444 +4Z5R_A,1,L,E,0.652,0.003,0.003,0.994,0.259111111111 +4Z5R_A,2,G,E,0.552,0.058,0.017,0.925,0.315111111111 +4Z5R_A,3,S,E,0.418,0.246,0.004,0.750,0.367777777778 +4Z5R_A,4,R,E,0.416,0.858,0.002,0.139,0.429333333333 +4Z5R_A,5,R,E,0.556,0.858,0.002,0.139,0.478666666667 +4Z5R_A,6,T,B,0.095,0.879,0.010,0.111,0.468222222222 +4Z5R_A,7,L,B,0.107,0.879,0.010,0.111,0.478666666667 +4Z5R_A,8,M,E,0.538,0.970,0.001,0.030,0.479777777778 +4Z5R_A,9,L,B,0.148,0.970,0.001,0.030,0.454333333333 +4Z5R_A,10,L,B,0.053,0.970,0.001,0.030,0.466777777778 +4Z5R_A,11,A,E,0.502,0.923,0.002,0.076,0.480666666667 +4Z5R_A,12,Q,E,0.567,0.858,0.002,0.139,0.498666666667 +4Z5R_A,13,M,B,0.081,0.600,0.003,0.397,0.508555555556 +4Z5R_A,14,R,E,0.491,0.246,0.004,0.750,0.523333333333 +4Z5R_A,15,K,E,0.655,0.053,0.005,0.942,0.560666666667 +4Z5R_A,16,I,E,0.472,0.016,0.005,0.979,0.567444444444 +4Z5R_A,17,S,E,0.325,0.005,0.015,0.979,0.569444444444 +4Z5R_A,18,L,E,0.403,0.005,0.015,0.979,0.599777777778 +4Z5R_A,19,F,E,0.445,0.018,0.019,0.964,0.589111111111 +4Z5R_A,20,S,E,0.333,0.053,0.005,0.942,0.580444444444 +4Z5R_A,21,C,B,0.098,0.053,0.005,0.942,0.579555555556 +4Z5R_A,22,L,E,0.324,0.257,0.016,0.727,0.577555555556 +4Z5R_A,23,K,E,0.621,0.181,0.016,0.803,0.578111111111 +4Z5R_A,24,D,E,0.352,0.115,0.016,0.868,0.569888888889 +4Z5R_A,25,R,E,0.517,0.053,0.043,0.903,0.577888888889 +4Z5R_A,26,H,E,0.457,0.053,0.043,0.903,0.575888888889 +4Z5R_A,27,D,E,0.522,0.018,0.088,0.893,0.567444444444 +4Z5R_A,28,F,B,0.051,0.018,0.088,0.893,0.560777777778 +4Z5R_A,29,G,E,0.526,0.018,0.047,0.935,0.560555555556 +4Z5R_A,30,F,B,0.11,0.018,0.019,0.964,0.549888888889 +4Z5R_A,31,P,B,0.144,0.321,0.003,0.675,0.542666666667 +4Z5R_A,32,Q,E,0.404,0.694,0.003,0.303,0.553222222222 +4Z5R_A,33,E,E,0.528,0.622,0.015,0.363,0.557888888889 +4Z5R_A,34,E,B,0.131,0.622,0.015,0.363,0.561555555556 +4Z5R_A,35,F,B,0.213,0.430,0.016,0.555,0.579333333333 +4Z5R_A,36,G,E,0.533,0.176,0.004,0.820,0.596222222222 +4Z5R_A,37,N,E,0.651,0.115,0.016,0.868,0.596111111111 +4Z5R_A,38,Q,E,0.545,0.181,0.016,0.803,0.594444444444 +4Z5R_A,39,F,B,0.213,0.181,0.016,0.803,0.594111111111 +4Z5R_A,40,Q,E,0.496,0.522,0.016,0.462,0.582666666667 +4Z5R_A,41,K,E,0.421,0.923,0.002,0.076,0.544777777778 +4Z5R_A,42,A,E,0.356,0.970,0.001,0.030,0.527111111111 +4Z5R_A,43,E,B,0.237,0.970,0.001,0.030,0.485333333333 +4Z5R_A,44,T,B,0.086,0.988,0.000,0.012,0.443333333333 +4Z5R_A,45,I,B,0.066,0.988,0.000,0.012,0.414222222222 +4Z5R_A,46,P,B,0.216,0.992,0.000,0.007,0.392444444444 +4Z5R_A,47,V,B,0.033,0.988,0.000,0.012,0.361666666667 +4Z5R_A,48,L,B,0.023,0.988,0.000,0.012,0.337555555556 +4Z5R_A,49,H,B,0.106,0.988,0.000,0.012,0.335555555556 +4Z5R_A,50,E,B,0.207,0.988,0.000,0.012,0.350888888889 +4Z5R_A,51,M,B,0.031,0.988,0.000,0.012,0.338777777778 +4Z5R_A,52,I,B,0.03,0.988,0.000,0.012,0.358444444444 +4Z5R_A,53,Q,E,0.271,0.988,0.000,0.012,0.394444444444 +4Z5R_A,54,Q,B,0.175,0.988,0.000,0.012,0.384444444444 +4Z5R_A,55,I,B,0.025,0.988,0.000,0.012,0.385333333333 +4Z5R_A,56,F,B,0.091,0.988,0.000,0.012,0.416777777778 +4Z5R_A,57,N,E,0.343,0.970,0.001,0.030,0.448333333333 +4Z5R_A,58,L,B,0.065,0.970,0.001,0.030,0.470444444444 +4Z5R_A,59,F,B,0.06,0.858,0.002,0.139,0.502222222222 +4Z5R_A,60,S,E,0.336,0.600,0.003,0.397,0.549444444444 +4Z5R_A,61,T,E,0.497,0.246,0.004,0.750,0.575222222222 +4Z5R_A,62,K,E,0.517,0.109,0.005,0.886,0.588222222222 +4Z5R_A,63,D,E,0.481,0.016,0.005,0.979,0.617444444444 +4Z5R_A,64,S,E,0.445,0.016,0.005,0.979,0.638555555556 +4Z5R_A,65,S,E,0.411,0.053,0.005,0.942,0.640111111111 +4Z5R_A,66,A,E,0.464,0.246,0.004,0.750,0.639 +4Z5R_A,67,A,E,0.483,0.406,0.004,0.590,0.629444444444 +4Z5R_A,68,W,B,0.185,0.600,0.003,0.397,0.603 +4Z5R_A,69,D,E,0.348,0.622,0.015,0.363,0.564777777778 +4Z5R_A,70,E,E,0.545,0.923,0.002,0.076,0.540888888889 +4Z5R_A,71,T,E,0.548,0.970,0.001,0.030,0.527111111111 +4Z5R_A,72,L,B,0.199,0.970,0.001,0.030,0.488555555556 +4Z5R_A,73,L,B,0.099,0.988,0.000,0.012,0.481666666667 +4Z5R_A,74,D,E,0.469,0.988,0.000,0.012,0.469666666667 +4Z5R_A,75,K,E,0.502,0.988,0.000,0.012,0.451111111111 +4Z5R_A,76,F,B,0.038,0.988,0.000,0.012,0.419888888889 +4Z5R_A,77,Y,B,0.139,0.970,0.001,0.030,0.428888888889 +4Z5R_A,78,T,E,0.427,0.970,0.001,0.030,0.443111111111 +4Z5R_A,79,E,B,0.224,0.970,0.001,0.030,0.446111111111 +4Z5R_A,80,L,B,0.031,0.970,0.001,0.030,0.427777777778 +4Z5R_A,81,Y,B,0.259,0.970,0.001,0.030,0.460777777778 +4Z5R_A,82,Q,E,0.41,0.970,0.001,0.030,0.463666666667 +4Z5R_A,83,Q,B,0.11,0.970,0.001,0.030,0.453444444444 +4Z5R_A,84,L,B,0.057,0.923,0.002,0.076,0.478 +4Z5R_A,85,N,E,0.549,0.923,0.002,0.076,0.504333333333 +4Z5R_A,86,D,E,0.359,0.923,0.002,0.076,0.473444444444 +4Z5R_A,87,L,B,0.056,0.923,0.002,0.076,0.469666666667 +4Z5R_A,88,E,E,0.513,0.923,0.002,0.076,0.470222222222 +4Z5R_A,89,A,E,0.528,0.858,0.002,0.139,0.485777777778 +4Z5R_A,90,C,B,0.07,0.858,0.002,0.139,0.484555555556 +4Z5R_A,91,V,B,0.208,0.694,0.003,0.303,0.497888888889 +4Z5R_A,92,I,E,0.557,0.600,0.003,0.397,0.520555555556 +4Z5R_A,93,Q,E,0.554,0.502,0.002,0.495,0.514888888889 +4Z5R_A,94,G,E,0.533,0.502,0.002,0.495,0.521888888889 +4Z5R_A,95,M,E,0.375,0.321,0.003,0.675,0.543222222222 +4Z5R_A,96,K,E,0.643,0.339,0.016,0.645,0.551111111111 +4Z5R_A,97,E,E,0.577,0.339,0.016,0.645,0.557777777778 +4Z5R_A,98,D,E,0.599,0.339,0.016,0.645,0.554 +4Z5R_A,99,S,E,0.286,0.622,0.015,0.363,0.527333333333 +4Z5R_A,100,I,E,0.438,0.938,0.007,0.055,0.520222222222 +4Z5R_A,101,L,E,0.385,0.938,0.007,0.055,0.524777777778 +4Z5R_A,102,A,E,0.351,0.970,0.001,0.030,0.521111111111 +4Z5R_A,103,V,B,0.036,0.988,0.000,0.012,0.498444444444 +4Z5R_A,104,R,E,0.354,0.988,0.000,0.012,0.502666666667 +4Z5R_A,105,K,E,0.556,0.970,0.001,0.030,0.506333333333 +4Z5R_A,106,Y,B,0.136,0.970,0.001,0.030,0.478666666667 +4Z5R_A,107,F,B,0.054,0.970,0.001,0.030,0.482444444444 +4Z5R_A,108,Q,E,0.441,0.970,0.001,0.030,0.514555555556 +4Z5R_A,109,R,E,0.319,0.970,0.001,0.030,0.501 +4Z5R_A,110,I,B,0.027,0.970,0.001,0.030,0.467222222222 +4Z5R_A,111,T,B,0.248,0.970,0.001,0.030,0.458111111111 +4Z5R_A,112,L,E,0.495,0.970,0.001,0.030,0.480555555556 +4Z5R_A,113,Y,B,0.134,0.970,0.001,0.030,0.485888888889 +4Z5R_A,114,L,B,0.049,0.923,0.002,0.076,0.477111111111 +4Z5R_A,115,K,E,0.529,0.858,0.002,0.139,0.498333333333 +4Z5R_A,116,E,E,0.739,0.502,0.002,0.495,0.491555555556 +4Z5R_A,117,K,E,0.45,0.109,0.005,0.886,0.480111111111 +4Z5R_A,118,K,E,0.704,0.016,0.005,0.979,0.479777777778 +4Z5R_A,119,Y,B,0.203,0.016,0.005,0.979,0.484888888889 +4Z5R_A,120,S,B,0.209,0.109,0.005,0.886,0.476555555556 +4Z5R_A,121,P,E,0.397,0.622,0.015,0.363,0.462666666667 +4Z5R_A,122,C,B,0.175,0.717,0.014,0.269,0.442 +4Z5R_A,123,A,B,0.033,0.938,0.007,0.055,0.409444444444 +4Z5R_A,124,W,B,0.099,0.975,0.003,0.022,0.398666666667 +4Z5R_A,125,E,E,0.29,0.975,0.003,0.022,0.390444444444 +4Z5R_A,126,V,B,0.177,0.975,0.003,0.022,0.380888888889 +4Z5R_A,127,V,B,0.023,0.975,0.003,0.022,0.359555555556 +4Z5R_A,128,R,B,0.172,0.988,0.000,0.012,0.383666666667 +4Z5R_A,129,A,E,0.272,0.988,0.000,0.012,0.390444444444 +4Z5R_A,130,E,B,0.175,0.988,0.000,0.012,0.378666666667 +4Z5R_A,131,I,B,0.027,0.988,0.000,0.012,0.363666666667 +4Z5R_A,132,M,E,0.285,0.988,0.000,0.012,0.393777777778 +4Z5R_A,133,R,E,0.359,0.988,0.000,0.012,0.403333333333 +4Z5R_A,134,S,B,0.062,0.988,0.000,0.012,0.394333333333 +4Z5R_A,135,F,B,0.05,0.970,0.001,0.030,0.412666666667 +4Z5R_A,136,S,E,0.334,0.970,0.001,0.030,0.435777777778 +4Z5R_A,137,L,B,0.185,0.970,0.001,0.030,0.421333333333 +4Z5R_A,138,S,B,0.046,0.988,0.000,0.012,0.423 +4Z5R_A,139,T,E,0.327,0.970,0.001,0.030,0.439 +4Z5R_A,140,N,E,0.427,0.970,0.001,0.030,0.461666666667 +4Z5R_A,141,L,B,0.128,0.923,0.002,0.076,0.443222222222 +4Z5R_A,142,Q,E,0.34,0.858,0.002,0.139,0.388333333333 +4Z5R_A,143,E,E,0.664,0.694,0.003,0.303,0.356777777778 +4Z5R_A,144,S,E,0.419,0.600,0.003,0.397,0.295111111111 +4Z5R_A,145,L,E,0.541,0.053,0.005,0.942,0.243555555556 +
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/online-epifinder-epitope-detail.tsv Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,3 @@ +N Id Epitope Start End N-Glyc N-Glyc-Count N-Glyc-Motifs Length MW(kDa) I.P Hydropathy All Matches Cover Avg Cover BepiPred2 Emini Parker Chou Fosman Karplus Schulz Kolaskar test_proteom_count test_proteom_acc test_proteom_count test_proteom_id +1 4WFF_A FLKWHVPPELVRVLSA 149 165 N 0 - 16 1.89 8.75 0.54 0.06 0.58 0.64 0.78 -1.78 0.83 0.96 1.11 2 4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation,4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 2 4WFF_B(100.00,100.00),4WFF_A(100.00,100.00) +2 4WFF_B AIFLKWHVPPELVRVLSAML 149 169 N 0 - 20 2.32 8.80 1.03 0.05 0.54 0.64 0.67 -2.18 0.80 0.95 1.11 2 4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation,4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 2 4WFF_B(100.00,100.00),4WFF_A(100.00,100.00)
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/online-epifinder-epitopes-fasta.fasta Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,4 @@ +>1-FLKWHVPPELVRVLSA +FLKWHVPPELVRVLSA +>2-AIFLKWHVPPELVRVLSAML +AIFLKWHVPPELVRVLSAML
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/online-epifinder-parameters.txt Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,28 @@ + +---- Running Parameters ---- +BepiPred-2.0 Threshold : 0.6 +Min epitope length : 10 +Max epitope length : 30 + +---- Softwares Threshold ---- +Emini : 0.8 +Parker : 0.8 +Chou Fosman : 0.8 +Karplus Schulz : 0.8 +Kolaskar : 0.8 + +---- Proteomes ---- +Alias File +test_proteom /usr/local/bioinfo/stingrayGalaxy/tools/stingray/epifinder/test-data/proteom.fasta + +---- Blast ---- +Identity : 90.0 +Cover : 90.0 +Word size : 4 +Task blastp-short: blastp-short + +---- Stats ---- +Processed proteins : 6 +NGlycosylated proteins : 0 +Identified epitopes : 2 +N-glycosylated epitopes: 0
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/online-epifinder-protein-summary.tsv Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,7 @@ +Id Epitopes N-Glyc +4WFF_B 1 0 +5BVP_A 0 0 +4XAK_A 0 0 +4WFF_A 1 0 +5C0N_A 0 0 +4Z5R_A 0 0
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/online-epifinder-scores.tsv Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,1141 @@ +Id Position Residue Bepipred2 Emini Parker Chou Fosman Karplus Schulz Kolaskar MW IP Hydropathy +4WFF_B 1 R 0.18 0.00 0.00 0.00 0.00 0.00 174.20 9.75 -4.50 +4WFF_B 2 S 0.22 0.00 0.00 0.00 0.00 0.00 105.09 5.24 -0.80 +4WFF_B 3 T 0.26 1.27 0.00 0.00 0.00 0.00 119.12 5.19 -0.70 +4WFF_B 4 T 0.28 0.66 0.69 0.88 1.03 1.04 119.12 5.19 -0.70 +4WFF_B 5 L 0.31 0.40 -1.23 0.83 0.99 1.09 131.17 5.52 3.80 +4WFF_B 6 L 0.31 0.23 -3.47 0.71 0.95 1.13 131.17 5.52 3.80 +4WFF_B 7 A 0.31 0.16 -3.91 0.66 0.93 1.15 89.09 5.57 1.80 +4WFF_B 8 L 0.29 0.16 -5.97 0.61 0.91 1.20 131.17 5.52 3.80 +4WFF_B 9 L 0.28 0.15 -5.19 0.60 0.91 1.22 131.17 5.52 3.80 +4WFF_B 10 A 0.27 0.12 -5.19 0.60 0.91 1.22 89.09 5.57 1.80 +4WFF_B 11 L 0.26 0.12 -6.80 0.59 0.91 1.24 131.17 5.52 3.80 +4WFF_B 12 V 0.24 0.23 -5.76 0.67 0.91 1.23 117.15 5.49 4.20 +4WFF_B 13 L 0.24 0.18 -5.76 0.67 0.91 1.23 131.17 5.52 3.80 +4WFF_B 14 L 0.26 0.17 -6.59 0.64 0.90 1.28 131.17 5.52 3.80 +4WFF_B 15 Y 0.26 0.30 -4.34 0.76 0.91 1.24 181.19 5.52 -1.30 +4WFF_B 16 L 0.28 0.36 -3.00 0.91 0.93 1.17 131.17 5.52 3.80 +4WFF_B 17 V 0.30 0.44 -1.39 0.92 0.95 1.14 117.15 5.49 4.20 +4WFF_B 18 S 0.31 0.23 -1.39 0.92 0.97 1.14 105.09 5.24 -0.80 +4WFF_B 19 G 0.30 0.21 -1.64 0.83 0.98 1.17 75.07 5.52 -0.40 +4WFF_B 20 A 0.32 0.24 -1.64 0.83 0.96 1.15 89.09 5.57 1.80 +4WFF_B 21 L 0.34 0.36 -0.51 0.90 0.94 1.08 131.17 5.52 3.80 +4WFF_B 22 V 0.36 0.36 -1.14 0.79 0.93 1.09 117.15 5.49 4.20 +4WFF_B 23 F 0.38 0.30 -3.27 0.65 0.92 1.14 165.19 5.52 2.80 +4WFF_B 24 R 0.42 0.62 -2.46 0.66 0.93 1.11 174.20 9.75 -4.50 +4WFF_B 25 A 0.45 1.45 -0.29 0.72 0.96 1.08 89.09 5.57 1.80 +4WFF_B 26 L 0.47 2.59 0.54 0.86 0.99 1.03 131.17 5.52 3.80 +4WFF_B 27 E 0.50 1.80 2.16 0.91 1.03 1.03 147.13 4.00 -3.50 +4WFF_B 28 Q 0.54 3.09 2.67 0.88 1.06 1.03 146.15 5.52 -3.50 +4WFF_B 29 P 0.55 6.48 3.23 0.93 1.07 1.02 115.13 5.96 -1.60 +4WFF_B 30 H 0.57 6.48 5.40 0.98 1.06 0.99 155.16 6.74 -3.20 +4WFF_B 31 E 0.61 3.78 4.59 0.97 1.06 1.02 147.13 4.00 -3.50 +4WFF_B 32 Q 0.61 4.23 4.59 0.97 1.06 1.02 146.15 5.52 -3.50 +4WFF_B 33 Q 0.61 6.09 4.89 0.89 1.05 0.99 146.15 5.52 -3.50 +4WFF_B 34 A 0.58 6.09 5.70 0.86 1.05 0.95 89.09 5.57 1.80 +4WFF_B 35 Q 0.58 2.90 3.27 0.84 1.04 1.01 146.15 5.52 -3.50 +4WFF_B 36 R 0.57 1.66 3.23 0.92 1.03 0.99 174.20 9.75 -4.50 +4WFF_B 37 E 0.57 2.84 3.49 0.89 1.02 0.97 147.13 4.00 -3.50 +4WFF_B 38 L 0.57 1.22 2.66 0.87 1.02 1.01 131.17 5.52 3.80 +4WFF_B 39 G 0.58 1.22 2.40 0.86 1.02 0.99 75.07 5.52 -0.40 +4WFF_B 40 E 0.57 1.22 2.91 0.83 1.02 0.99 147.13 4.00 -3.50 +4WFF_B 41 V 0.54 2.95 2.61 0.87 1.03 1.00 117.15 5.49 4.20 +4WFF_B 42 R 0.51 2.58 2.61 0.87 1.03 0.98 174.20 9.75 -4.50 +4WFF_B 43 E 0.54 1.23 0.49 0.73 1.03 1.03 147.13 4.00 -3.50 +4WFF_B 44 K 0.54 3.25 -0.03 0.76 1.01 1.04 146.19 8.75 -3.90 +4WFF_B 45 F 0.53 1.68 0.80 0.79 0.98 0.99 165.19 5.52 2.80 +4WFF_B 46 L 0.52 1.32 0.50 0.79 0.96 1.02 131.17 5.52 3.80 +4WFF_B 47 R 0.52 1.02 -0.31 0.90 0.94 1.05 174.20 9.75 -4.50 +4WFF_B 48 A 0.51 0.63 -0.93 0.92 0.93 1.12 89.09 5.57 1.80 +4WFF_B 49 H 0.51 0.57 -0.14 0.91 0.93 1.16 155.16 6.74 -3.20 +4WFF_B 50 P 0.54 0.39 2.10 1.03 0.93 1.13 115.13 5.96 -1.60 +4WFF_B 51 C 0.56 0.64 2.93 1.10 0.94 1.13 121.15 5.52 2.50 +4WFF_B 52 V 0.57 0.82 3.49 1.15 0.97 1.12 117.15 5.49 4.20 +4WFF_B 53 S 0.57 0.91 4.30 1.12 1.01 1.09 105.09 5.24 -0.80 +4WFF_B 54 D 0.58 1.41 2.69 0.98 1.03 1.11 133.10 3.80 -3.50 +4WFF_B 55 Q 0.58 1.88 3.30 1.04 1.05 1.04 146.15 5.52 -3.50 +4WFF_B 56 E 0.55 1.15 2.51 1.05 1.03 1.02 147.13 4.00 -3.50 +4WFF_B 57 L 0.53 0.57 0.27 0.93 1.00 1.05 131.17 5.52 3.80 +4WFF_B 58 G 0.52 0.23 -2.30 0.79 0.97 1.09 75.07 5.52 -0.40 +4WFF_B 59 L 0.50 0.27 -2.34 0.79 0.95 1.08 131.17 5.52 3.80 +4WFF_B 60 L 0.47 0.56 -2.34 0.79 0.95 1.08 131.17 5.52 3.80 +4WFF_B 61 I 0.44 0.42 -1.56 0.78 0.96 1.10 131.17 5.52 4.50 +4WFF_B 62 K 0.44 0.51 -2.07 0.65 0.98 1.13 146.19 8.75 -3.90 +4WFF_B 63 E 0.44 1.04 0.67 0.78 0.98 1.07 147.13 4.00 -3.50 +4WFF_B 64 V 0.42 1.50 2.29 0.79 0.97 1.04 117.15 5.49 4.20 +4WFF_B 65 A 0.43 0.62 2.11 0.80 0.96 1.06 89.09 5.57 1.80 +4WFF_B 66 D 0.45 0.35 2.11 0.88 0.95 1.05 133.10 3.80 -3.50 +4WFF_B 67 A 0.44 0.47 1.81 1.00 0.97 1.05 89.09 5.57 1.80 +4WFF_B 68 L 0.44 0.46 3.16 1.15 1.00 0.98 131.17 5.52 3.80 +4WFF_B 69 G 0.48 0.28 3.16 1.15 1.03 0.98 75.07 5.52 -0.40 +4WFF_B 70 G 0.50 0.46 3.16 1.15 1.05 0.98 75.07 5.52 -0.40 +4WFF_B 71 G 0.51 0.87 3.16 1.27 1.06 0.98 75.07 5.52 -0.40 +4WFF_B 72 A 0.53 1.51 5.59 1.29 1.07 0.92 89.09 5.57 1.80 +4WFF_B 73 D 0.57 2.21 5.51 1.21 1.07 0.93 133.10 3.80 -3.50 +4WFF_B 74 P 0.61 3.87 5.56 1.13 1.08 0.95 115.13 5.96 -1.60 +4WFF_B 75 E 0.62 5.13 5.67 1.11 1.09 0.97 147.13 4.00 -3.50 +4WFF_B 76 T 0.64 4.11 6.30 1.22 1.10 0.96 119.12 5.19 -0.70 +4WFF_B 77 Q 0.67 3.62 5.17 1.14 1.11 1.00 146.15 5.52 -3.50 +4WFF_B 78 S 0.68 2.80 5.80 1.13 1.09 0.99 105.09 5.24 -0.80 +4WFF_B 79 S 0.67 1.96 4.99 1.12 1.05 1.02 105.09 5.24 -0.80 +4WFF_B 80 H 0.66 1.19 2.81 1.12 1.01 1.02 155.16 6.74 -3.20 +4WFF_B 81 S 0.64 1.48 3.39 1.19 0.97 0.99 105.09 5.24 -0.80 +4WFF_B 82 A 0.61 0.91 1.14 1.07 0.95 1.03 89.09 5.57 1.80 +4WFF_B 83 W 0.57 0.66 1.03 1.09 0.94 1.01 204.23 5.52 -0.90 +4WFF_B 84 D 0.54 0.66 1.66 1.16 0.96 1.00 133.10 3.80 -3.50 +4WFF_B 85 L 0.49 0.66 1.03 1.05 0.98 1.00 131.17 5.52 3.80 +4WFF_B 86 G 0.46 0.55 -0.59 1.04 0.99 1.01 75.07 5.52 -0.40 +4WFF_B 87 S 0.42 0.28 -0.47 0.99 0.99 1.04 105.09 5.24 -0.80 +4WFF_B 88 A 0.38 0.30 -3.21 0.86 0.97 1.07 89.09 5.57 1.80 +4WFF_B 89 F 0.35 0.40 -0.97 0.98 0.95 1.03 165.19 5.52 2.80 +4WFF_B 90 F 0.32 0.30 -0.97 0.98 0.96 1.03 165.19 5.52 2.80 +4WFF_B 91 F 0.30 0.43 -1.16 0.92 0.98 1.02 165.19 5.52 2.80 +4WFF_B 92 S 0.28 0.34 -2.60 0.89 1.01 1.03 105.09 5.24 -0.80 +4WFF_B 93 G 0.26 0.28 -2.43 0.87 1.02 1.04 75.07 5.52 -0.40 +4WFF_B 94 T 0.27 0.46 -0.37 0.92 1.01 1.01 119.12 5.19 -0.70 +4WFF_B 95 I 0.29 0.50 1.69 0.97 0.99 0.99 131.17 5.52 4.50 +4WFF_B 96 I 0.31 0.35 -0.39 0.84 0.98 1.01 131.17 5.52 4.50 +4WFF_B 97 T 0.35 0.24 -0.39 0.84 0.99 1.01 119.12 5.19 -0.70 +4WFF_B 98 T 0.39 0.54 -1.40 0.86 0.99 1.04 119.12 5.19 -0.70 +4WFF_B 99 I 0.43 0.77 0.56 1.02 0.99 1.00 131.17 5.52 4.50 +4WFF_B 100 G 0.45 0.85 2.70 1.17 0.99 0.95 75.07 5.52 -0.40 +4WFF_B 101 Y 0.49 0.44 1.43 1.11 0.98 1.02 181.19 5.52 -1.30 +4WFF_B 102 G 0.52 0.63 0.99 1.06 0.98 1.04 75.07 5.52 -0.40 +4WFF_B 103 N 0.55 0.53 0.81 1.08 0.97 1.05 132.12 5.52 -3.50 +4WFF_B 104 V 0.56 0.66 0.60 0.99 0.96 1.05 117.15 5.49 4.20 +4WFF_B 105 A 0.56 0.96 1.61 0.97 0.96 1.02 89.09 5.57 1.80 +4WFF_B 106 L 0.55 1.00 2.23 0.95 0.98 1.02 131.17 5.52 3.80 +4WFF_B 107 R 0.53 1.36 1.53 0.83 1.01 1.06 174.20 9.75 -4.50 +4WFF_B 108 T 0.51 1.33 2.87 0.98 1.04 0.99 119.12 5.19 -0.70 +4WFF_B 109 D 0.50 3.16 3.17 1.02 1.05 0.96 133.10 3.80 -3.50 +4WFF_B 110 A 0.48 1.33 3.17 1.02 1.05 0.96 89.09 5.57 1.80 +4WFF_B 111 G 0.45 0.80 1.26 0.97 1.03 0.99 75.07 5.52 -0.40 +4WFF_B 112 R 0.41 0.26 0.71 1.00 1.00 1.06 174.20 9.75 -4.50 +4WFF_B 113 L 0.38 0.18 -1.86 0.86 0.97 1.10 131.17 5.52 3.80 +4WFF_B 114 F 0.35 0.16 -3.47 0.85 0.94 1.11 165.19 5.52 2.80 +4WFF_B 115 C 0.33 0.12 -4.56 0.79 0.92 1.15 121.15 5.52 2.50 +4WFF_B 116 I 0.30 0.15 -4.86 0.75 0.90 1.17 131.17 5.52 4.50 +4WFF_B 117 F 0.28 0.15 -4.86 0.75 0.89 1.17 165.19 5.52 2.80 +4WFF_B 118 Y 0.27 0.20 -4.07 0.74 0.89 1.22 181.19 5.52 -1.30 +4WFF_B 119 A 0.26 0.28 -3.46 0.79 0.89 1.14 89.09 5.57 1.80 +4WFF_B 120 L 0.27 0.23 -3.46 0.79 0.91 1.14 131.17 5.52 3.80 +4WFF_B 121 V 0.27 0.23 -1.84 0.92 0.92 1.14 117.15 5.49 4.20 +4WFF_B 122 G 0.28 0.19 -2.89 0.84 0.94 1.15 75.07 5.52 -0.40 +4WFF_B 123 I 0.27 0.19 -4.50 0.83 0.95 1.15 131.17 5.52 4.50 +4WFF_B 124 P 0.28 0.26 -2.37 0.97 0.95 1.10 115.13 5.96 -1.60 +4WFF_B 125 L 0.29 0.18 -2.99 0.97 0.94 1.07 131.17 5.52 3.80 +4WFF_B 126 F 0.30 0.22 -5.11 0.83 0.93 1.12 165.19 5.52 2.80 +4WFF_B 127 G 0.31 0.12 -5.29 0.85 0.92 1.13 75.07 5.52 -0.40 +4WFF_B 128 I 0.32 0.14 -5.29 0.72 0.92 1.13 131.17 5.52 4.50 +4WFF_B 129 L 0.33 0.16 -3.16 0.86 0.92 1.08 131.17 5.52 3.80 +4WFF_B 130 L 0.35 0.12 -2.37 0.85 0.93 1.12 131.17 5.52 3.80 +4WFF_B 131 A 0.38 0.17 -2.37 0.85 0.94 1.12 89.09 5.57 1.80 +4WFF_B 132 G 0.42 0.35 0.20 0.99 0.96 1.08 75.07 5.52 -0.40 +4WFF_B 133 V 0.44 0.82 2.11 1.04 0.98 1.03 117.15 5.49 4.20 +4WFF_B 134 G 0.45 0.67 2.11 1.04 1.00 1.03 75.07 5.52 -0.40 +4WFF_B 135 D 0.47 0.67 2.63 1.17 1.01 1.00 133.10 3.80 -3.50 +4WFF_B 136 R 0.49 1.21 2.74 1.15 1.03 1.02 174.20 9.75 -4.50 +4WFF_B 137 L 0.49 1.64 4.20 1.28 1.04 0.97 131.17 5.52 3.80 +4WFF_B 138 G 0.51 0.81 2.07 1.14 1.05 1.02 75.07 5.52 -0.40 +4WFF_B 139 S 0.51 0.81 1.24 1.07 1.05 1.02 105.09 5.24 -0.80 +4WFF_B 140 S 0.51 1.34 0.94 1.07 1.03 1.05 105.09 5.24 -0.80 +4WFF_B 141 L 0.50 1.34 3.07 1.21 1.00 1.00 131.17 5.52 3.80 +4WFF_B 142 R 0.50 0.70 1.11 1.05 0.97 1.04 174.20 9.75 -4.50 +4WFF_B 143 H 0.52 0.52 1.00 1.07 0.96 1.02 155.16 6.74 -3.20 +4WFF_B 144 G 0.53 0.85 0.37 1.00 0.95 1.03 75.07 5.52 -0.40 +4WFF_B 145 I 0.55 0.31 0.54 0.99 0.95 1.02 131.17 5.52 4.50 +4WFF_B 146 G 0.56 0.39 1.06 0.96 0.94 1.02 75.07 5.52 -0.40 +4WFF_B 147 H 0.57 0.40 1.06 0.92 0.94 1.01 155.16 6.74 -3.20 +4WFF_B 148 I 0.59 0.40 -0.90 0.76 0.93 1.05 131.17 5.52 4.50 +4WFF_B 149 E 0.60 0.35 -1.07 0.78 0.92 1.04 147.13 4.00 -3.50 +4WFF_B 150 A 0.61 0.21 -3.20 0.64 0.92 1.10 89.09 5.57 1.80 +4WFF_B 151 I 0.62 0.60 -2.69 0.65 0.93 1.07 131.17 5.52 4.50 +4WFF_B 152 F 0.63 0.36 -2.97 0.72 0.94 1.03 165.19 5.52 2.80 +4WFF_B 153 L 0.65 0.49 -3.79 0.75 0.95 1.07 131.17 5.52 3.80 +4WFF_B 154 K 0.64 0.52 -4.61 0.73 0.95 1.11 146.19 8.75 -3.90 +4WFF_B 155 W 0.64 0.93 -3.17 0.88 0.96 1.10 204.23 5.52 -0.90 +4WFF_B 156 H 0.64 1.74 -1.56 1.01 0.96 1.10 155.16 6.74 -3.20 +4WFF_B 157 V 0.64 1.51 0.87 1.03 0.98 1.04 117.15 5.49 4.20 +4WFF_B 158 P 0.64 1.18 -1.26 0.97 1.00 1.09 115.13 5.96 -1.60 +4WFF_B 159 P 0.66 0.64 -0.36 0.90 1.01 1.16 115.13 5.96 -1.60 +4WFF_B 160 E 0.65 1.70 -0.06 0.90 1.00 1.12 147.13 4.00 -3.50 +4WFF_B 161 L 0.65 0.82 -0.06 0.90 0.98 1.12 131.17 5.52 3.80 +4WFF_B 162 V 0.65 0.44 -1.67 0.77 0.95 1.15 117.15 5.49 4.20 +4WFF_B 163 R 0.65 0.34 -1.04 0.76 0.94 1.14 174.20 9.75 -4.50 +4WFF_B 164 V 0.66 0.41 -1.86 0.75 0.93 1.17 117.15 5.49 4.20 +4WFF_B 165 L 0.66 0.55 -1.14 0.75 0.93 1.11 131.17 5.52 3.80 +4WFF_B 166 S 0.65 0.23 -1.93 0.76 0.92 1.09 105.09 5.24 -0.80 +4WFF_B 167 A 0.64 0.27 -3.84 0.71 0.91 1.13 89.09 5.57 1.80 +4WFF_B 168 M 0.60 0.27 -4.63 0.72 0.90 1.11 149.21 5.28 1.90 +4WFF_B 169 L 0.60 0.17 -4.63 0.72 0.90 1.11 131.17 5.52 3.80 +4WFF_B 170 F 0.58 0.12 -6.70 0.59 0.90 1.13 165.19 5.52 2.80 +4WFF_B 171 L 0.56 0.12 -6.19 0.71 0.91 1.10 131.17 5.52 3.80 +4WFF_B 172 L 0.55 0.07 -5.39 0.80 0.91 1.18 131.17 5.52 3.80 +4WFF_B 173 I 0.55 0.07 -5.39 0.80 0.91 1.18 131.17 5.52 4.50 +4WFF_B 174 G 0.54 0.07 -5.39 0.80 0.91 1.21 75.07 5.52 -0.40 +4WFF_B 175 C 0.53 0.07 -5.39 0.80 0.91 1.18 121.15 5.52 2.50 +4WFF_B 176 L 0.53 0.08 -4.60 0.79 0.91 1.20 131.17 5.52 3.80 +4WFF_B 177 L 0.53 0.07 -4.77 0.80 0.92 1.22 131.17 5.52 3.80 +4WFF_B 178 F 0.51 0.18 -4.84 0.72 0.93 1.22 165.19 5.52 2.80 +4WFF_B 179 V 0.51 0.33 -4.74 0.76 0.95 1.17 117.15 5.49 4.20 +4WFF_B 180 L 0.51 0.58 -2.69 0.82 0.98 1.12 131.17 5.52 3.80 +4WFF_B 181 T 0.49 0.58 -2.69 0.82 1.00 1.10 119.12 5.19 -0.70 +4WFF_B 182 P 0.48 0.58 -1.90 0.80 1.01 1.14 115.13 5.96 -1.60 +4WFF_B 183 T 0.47 0.61 -2.69 0.82 0.99 1.10 119.12 5.19 -0.70 +4WFF_B 184 F 0.47 0.23 -1.17 0.90 0.97 1.12 165.19 5.52 2.80 +4WFF_B 185 V 0.47 0.23 -2.19 0.93 0.94 1.16 117.15 5.49 4.20 +4WFF_B 186 F 0.48 0.16 -3.09 0.80 0.91 1.12 165.19 5.52 2.80 +4WFF_B 187 C 0.51 0.32 -2.71 0.77 0.90 1.12 121.15 5.52 2.50 +4WFF_B 188 Y 0.52 0.71 0.03 0.89 0.91 1.08 181.19 5.52 -1.30 +4WFF_B 189 M 0.52 0.87 -0.87 0.96 0.93 1.01 149.21 5.28 1.90 +4WFF_B 190 E 0.54 2.16 1.37 1.07 0.97 1.00 147.13 4.00 -3.50 +4WFF_B 191 D 0.52 2.76 1.99 1.05 1.00 0.93 133.10 3.80 -3.50 +4WFF_B 192 W 0.52 2.30 0.94 0.97 1.01 0.95 204.23 5.52 -0.90 +4WFF_B 193 S 0.49 2.30 2.66 0.99 1.02 0.95 105.09 5.24 -0.80 +4WFF_B 194 K 0.46 1.39 1.84 0.98 1.01 0.98 146.19 8.75 -3.90 +4WFF_B 195 L 0.42 0.93 -0.73 0.84 0.98 1.02 131.17 5.52 3.80 +4WFF_B 196 E 0.38 1.08 0.43 0.86 0.95 1.06 147.13 4.00 -3.50 +4WFF_B 197 A 0.33 0.47 -1.81 0.74 0.93 1.07 89.09 5.57 1.80 +4WFF_B 198 I 0.30 0.42 -3.16 0.67 0.90 1.14 131.17 5.52 4.50 +4WFF_B 199 Y 0.26 0.17 -2.99 0.65 0.89 1.12 181.19 5.52 -1.30 +4WFF_B 200 F 0.24 0.13 -4.63 0.62 0.89 1.20 165.19 5.52 2.80 +4WFF_B 201 V 0.22 0.26 -4.19 0.66 0.90 1.18 117.15 5.49 4.20 +4WFF_B 202 I 0.22 0.14 -4.36 0.68 0.91 1.19 131.17 5.52 4.50 +4WFF_B 203 V 0.22 0.23 -3.34 0.65 0.93 1.15 117.15 5.49 4.20 +4WFF_B 204 T 0.23 0.44 -1.29 0.71 0.95 1.13 119.12 5.19 -0.70 +4WFF_B 205 L 0.25 0.47 -1.29 0.71 0.98 1.13 131.17 5.52 3.80 +4WFF_B 206 T 0.28 0.62 0.67 0.86 1.00 1.09 119.12 5.19 -0.70 +4WFF_B 207 T 0.33 0.37 -0.11 0.88 1.00 1.05 119.12 5.19 -0.70 +4WFF_B 208 V 0.37 0.45 -0.04 0.96 0.99 1.04 117.15 5.49 4.20 +4WFF_B 209 G 0.41 0.52 2.70 1.09 0.98 0.99 75.07 5.52 -0.40 +4WFF_B 210 F 0.45 0.56 1.69 1.11 0.98 1.02 165.19 5.52 2.80 +4WFF_B 211 G 0.47 0.56 0.41 1.05 0.99 1.09 75.07 5.52 -0.40 +4WFF_B 212 D 0.49 0.58 1.24 1.07 0.99 1.04 133.10 3.80 -3.50 +4WFF_B 213 Y 0.51 0.66 1.24 1.07 0.97 1.04 181.19 5.52 -1.30 +4WFF_B 214 V 0.53 0.67 2.86 1.08 0.96 1.04 117.15 5.49 4.20 +4WFF_B 215 A 0.55 0.67 3.47 1.06 0.96 1.04 89.09 5.57 1.80 +4WFF_B 216 G 0.57 0.66 2.34 1.07 0.98 1.07 75.07 5.52 -0.40 +4WFF_B 217 A 0.59 1.75 3.21 1.04 1.01 1.03 89.09 5.57 1.80 +4WFF_B 218 D 0.60 3.00 4.60 1.11 1.04 0.97 133.10 3.80 -3.50 +4WFF_B 219 P 0.62 5.06 5.73 1.23 1.06 0.95 115.13 5.96 -1.60 +4WFF_B 220 R 0.64 6.71 5.84 1.21 1.08 0.97 174.20 9.75 -4.50 +4WFF_B 221 Q 0.65 6.21 5.84 1.33 1.09 0.97 146.15 5.52 -3.50 +4WFF_B 222 D 0.65 4.06 4.71 1.22 1.09 0.99 133.10 3.80 -3.50 +4WFF_B 223 S 0.63 3.25 4.14 1.16 1.08 1.01 105.09 5.24 -0.80 +4WFF_B 224 P 0.61 3.25 4.40 1.17 1.05 1.03 115.13 5.96 -1.60 +4WFF_B 225 A 0.57 3.01 3.84 1.24 1.02 1.04 89.09 5.57 1.80 +4WFF_B 226 Y 0.53 1.85 1.10 1.12 1.01 1.09 181.19 5.52 -1.30 +4WFF_B 227 Q 0.51 0.89 -0.36 0.99 1.00 1.14 146.15 5.52 -3.50 +4WFF_B 228 P 0.47 0.92 -2.09 0.91 0.98 1.12 115.13 5.96 -1.60 +4WFF_B 229 L 0.43 0.51 -3.70 0.90 0.96 1.12 131.17 5.52 3.80 +4WFF_B 230 V 0.39 0.31 -4.86 0.87 0.92 1.08 117.15 5.49 4.20 +4WFF_B 231 W 0.37 0.14 -6.86 0.80 0.89 1.10 204.23 5.52 -0.90 +4WFF_B 232 F 0.34 0.14 -8.47 0.67 0.87 1.13 165.19 5.52 2.80 +4WFF_B 233 W 0.32 0.16 -8.47 0.67 0.87 1.13 204.23 5.52 -0.90 +4WFF_B 234 I 0.30 0.15 -7.13 0.82 0.88 1.06 131.17 5.52 4.50 +4WFF_B 235 L 0.30 0.14 -7.01 0.77 0.91 1.11 131.17 5.52 3.80 +4WFF_B 236 L 0.31 0.13 -5.40 0.77 0.92 1.10 131.17 5.52 3.80 +4WFF_B 237 G 0.30 0.30 -4.24 0.80 0.92 1.14 75.07 5.52 -0.40 +4WFF_B 238 L 0.30 0.32 -4.41 0.82 0.92 1.13 131.17 5.52 3.80 +4WFF_B 239 A 0.30 0.39 -2.80 0.83 0.91 1.11 89.09 5.57 1.80 +4WFF_B 240 Y 0.31 0.52 -0.56 0.95 0.90 1.07 181.19 5.52 -1.30 +4WFF_B 241 F 0.32 0.47 -1.90 0.80 0.91 1.15 165.19 5.52 2.80 +4WFF_B 242 A 0.33 0.38 -1.90 0.80 0.92 1.15 89.09 5.57 1.80 +4WFF_B 243 S 0.35 0.35 -1.46 0.84 0.93 1.12 105.09 5.24 -0.80 +4WFF_B 244 V 0.35 0.59 -0.44 0.81 0.96 1.09 117.15 5.49 4.20 +4WFF_B 245 L 0.34 0.41 -0.27 0.80 0.98 1.10 131.17 5.52 3.80 +4WFF_B 246 T 0.35 0.30 0.24 0.92 1.00 1.07 119.12 5.19 -0.70 +4WFF_B 247 T 0.39 0.66 0.31 0.94 1.02 1.04 119.12 5.19 -0.70 +4WFF_B 248 I 0.39 0.84 -0.59 1.01 1.02 0.97 131.17 5.52 4.50 +4WFF_B 249 G 0.41 0.48 -0.59 1.01 1.01 0.97 75.07 5.52 -0.40 +4WFF_B 250 N 0.37 0.65 -0.73 1.01 0.00 0.96 132.12 5.52 -3.50 +4WFF_B 251 W 0.32 0.00 0.00 0.00 0.00 0.00 204.23 5.52 -0.90 +4WFF_B 252 L 0.28 0.00 0.00 0.00 0.00 0.00 131.17 5.52 3.80 +4WFF_B 253 R 0.23 0.00 0.00 0.00 0.00 0.00 174.20 9.75 -4.50 +5BVP_A 1 V 0.22 0.00 0.00 0.00 0.00 0.00 117.15 5.49 4.20 +5BVP_A 2 R 0.27 0.00 0.00 0.00 0.00 0.00 174.20 9.75 -4.50 +5BVP_A 3 S 0.30 0.23 0.00 0.00 0.00 0.00 105.09 5.24 -0.80 +5BVP_A 4 L 0.33 0.45 1.63 1.03 0.98 1.09 131.17 5.52 3.80 +5BVP_A 5 N 0.39 0.19 0.84 1.04 0.97 1.07 132.12 5.52 -3.50 +5BVP_A 6 C 0.41 0.28 0.84 1.04 0.96 1.07 121.15 5.52 2.50 +5BVP_A 7 T 0.42 0.56 1.34 1.04 0.96 1.05 119.12 5.19 -0.70 +5BVP_A 8 L 0.42 0.47 3.59 1.16 0.99 1.01 131.17 5.52 3.80 +5BVP_A 9 R 0.45 1.50 3.44 1.08 1.03 1.05 174.20 9.75 -4.50 +5BVP_A 10 D 0.46 1.80 4.10 1.05 1.07 0.99 133.10 3.80 -3.50 +5BVP_A 11 S 0.46 4.37 4.17 1.06 1.11 0.99 105.09 5.24 -0.80 +5BVP_A 12 Q 0.46 2.99 6.41 1.18 1.12 0.96 146.15 5.52 -3.50 +5BVP_A 13 Q 0.46 1.48 4.50 1.13 1.12 1.01 146.15 5.52 -3.50 +5BVP_A 14 K 0.43 0.82 2.54 0.99 1.08 1.09 146.19 8.75 -3.90 +5BVP_A 15 S 0.42 0.47 1.01 0.87 1.03 1.06 105.09 5.24 -0.80 +5BVP_A 16 L 0.42 0.36 1.09 0.93 0.99 1.06 131.17 5.52 3.80 +5BVP_A 17 V 0.42 0.18 1.04 1.02 0.97 1.04 117.15 5.49 4.20 +5BVP_A 18 M 0.41 0.21 0.53 1.09 0.98 1.06 149.21 5.28 1.90 +5BVP_A 19 S 0.41 0.39 -0.67 1.05 1.01 1.08 105.09 5.24 -0.80 +5BVP_A 20 G 0.39 0.92 1.76 1.07 1.03 1.02 75.07 5.52 -0.40 +5BVP_A 21 P 0.41 0.76 0.97 1.08 1.03 1.01 115.13 5.96 -1.60 +5BVP_A 22 Y 0.42 1.14 2.39 1.14 1.01 1.02 181.19 5.52 -1.30 +5BVP_A 23 E 0.42 1.16 1.76 1.03 0.99 1.03 147.13 4.00 -3.50 +5BVP_A 24 L 0.42 0.62 -0.37 0.89 0.98 1.08 131.17 5.52 3.80 +5BVP_A 25 K 0.41 0.54 -0.37 0.81 0.97 1.09 146.19 8.75 -3.90 +5BVP_A 26 A 0.42 0.26 -1.41 0.73 0.96 1.10 89.09 5.57 1.80 +5BVP_A 27 L 0.44 0.54 -1.67 0.77 0.95 1.12 131.17 5.52 3.80 +5BVP_A 28 H 0.45 0.27 0.46 0.91 0.96 1.07 155.16 6.74 -3.20 +5BVP_A 29 L 0.49 0.46 0.50 0.90 0.99 1.08 131.17 5.52 3.80 +5BVP_A 30 Q 0.51 0.92 1.63 1.02 1.03 1.05 146.15 5.52 -3.50 +5BVP_A 31 G 0.55 0.67 2.34 1.02 1.07 0.99 75.07 5.52 -0.40 +5BVP_A 32 Q 0.57 1.41 3.16 0.99 1.08 0.96 146.15 5.52 -3.50 +5BVP_A 33 D 0.59 1.41 5.33 1.04 1.08 0.92 133.10 3.80 -3.50 +5BVP_A 34 M 0.59 2.47 5.33 1.04 1.06 0.92 149.21 5.28 1.90 +5BVP_A 35 E 0.57 1.06 3.99 0.89 1.05 1.00 147.13 4.00 -3.50 +5BVP_A 36 Q 0.53 0.47 2.60 0.82 1.04 1.05 146.15 5.52 -3.50 +5BVP_A 37 Q 0.51 0.41 -0.14 0.70 1.01 1.08 146.15 5.52 -3.50 +5BVP_A 38 V 0.46 0.32 1.39 0.82 0.98 1.11 117.15 5.49 4.20 +5BVP_A 39 V 0.45 0.18 -0.33 0.80 0.95 1.10 117.15 5.49 4.20 +5BVP_A 40 F 0.43 0.14 -0.26 0.86 0.93 1.10 165.19 5.52 2.80 +5BVP_A 41 S 0.41 0.16 -2.43 0.81 0.92 1.11 105.09 5.24 -0.80 +5BVP_A 42 M 0.40 0.16 -2.43 0.81 0.93 1.11 149.21 5.28 1.90 +5BVP_A 43 S 0.43 0.33 -1.04 0.88 0.93 1.06 105.09 5.24 -0.80 +5BVP_A 44 F 0.45 0.24 1.09 1.01 0.95 1.03 165.19 5.52 2.80 +5BVP_A 45 V 0.50 0.43 1.27 0.92 0.98 1.01 117.15 5.49 4.20 +5BVP_A 46 Q 0.52 0.55 2.99 0.94 1.02 1.01 146.15 5.52 -3.50 +5BVP_A 47 G 0.55 0.85 2.99 0.94 1.07 1.01 75.07 5.52 -0.40 +5BVP_A 48 E 0.56 1.84 5.30 1.07 1.10 0.97 147.13 4.00 -3.50 +5BVP_A 49 E 0.58 1.78 7.26 1.21 1.11 0.89 147.13 4.00 -3.50 +5BVP_A 50 S 0.59 3.59 7.21 1.21 1.11 0.88 105.09 5.24 -0.80 +5BVP_A 51 N 0.56 1.45 5.26 1.06 1.10 0.92 132.12 5.52 -3.50 +5BVP_A 52 D 0.53 1.30 4.44 1.17 1.07 0.95 133.10 3.80 -3.50 +5BVP_A 53 K 0.49 0.72 2.80 1.14 1.04 1.03 146.19 8.75 -3.90 +5BVP_A 54 I 0.45 0.45 2.17 1.03 1.00 1.03 131.17 5.52 4.50 +5BVP_A 55 P 0.42 0.22 -0.14 0.89 0.97 1.10 115.13 5.96 -1.60 +5BVP_A 56 V 0.39 0.11 -0.76 0.90 0.94 1.10 117.15 5.49 4.20 +5BVP_A 57 A 0.39 0.13 -2.89 0.84 0.93 1.15 89.09 5.57 1.80 +5BVP_A 58 L 0.39 0.17 -0.93 0.92 0.94 1.12 131.17 5.52 3.80 +5BVP_A 59 G 0.39 0.39 -0.11 0.81 0.97 1.09 75.07 5.52 -0.40 +5BVP_A 60 L 0.41 0.78 1.23 0.88 1.00 1.02 131.17 5.52 3.80 +5BVP_A 61 K 0.43 1.51 1.93 1.01 1.03 0.98 146.19 8.75 -3.90 +5BVP_A 62 E 0.44 1.26 1.93 1.01 1.05 0.98 147.13 4.00 -3.50 +5BVP_A 63 K 0.44 2.39 0.84 0.95 1.04 1.02 146.19 8.75 -3.90 +5BVP_A 64 N 0.43 0.99 0.84 0.95 1.01 1.02 132.12 5.52 -3.50 +5BVP_A 65 L 0.43 0.76 0.96 1.01 0.97 1.03 131.17 5.52 3.80 +5BVP_A 66 Y 0.43 0.20 0.04 1.07 0.93 1.11 181.19 5.52 -1.30 +5BVP_A 67 L 0.42 0.09 -1.30 1.00 0.92 1.18 131.17 5.52 3.80 +5BVP_A 68 S 0.42 0.09 -3.61 0.86 0.91 1.25 105.09 5.24 -0.80 +5BVP_A 69 C 0.42 0.12 -1.49 0.92 0.92 1.20 121.15 5.52 2.50 +5BVP_A 70 V 0.43 0.24 0.21 0.97 0.95 1.16 117.15 5.49 4.20 +5BVP_A 71 L 0.43 0.30 2.96 1.09 0.98 1.10 131.17 5.52 3.80 +5BVP_A 72 K 0.45 1.14 2.84 1.03 1.01 1.09 146.19 8.75 -3.90 +5BVP_A 73 D 0.47 2.37 2.94 1.08 1.03 1.04 133.10 3.80 -3.50 +5BVP_A 74 D 0.46 4.14 4.21 1.14 1.05 0.97 133.10 3.80 -3.50 +5BVP_A 75 K 0.46 1.71 4.21 1.14 1.05 0.97 146.19 8.75 -3.90 +5BVP_A 76 P 0.45 1.77 4.26 1.14 1.04 0.99 115.13 5.96 -1.60 +5BVP_A 77 T 0.46 0.87 1.51 1.02 1.01 1.04 119.12 5.19 -0.70 +5BVP_A 78 L 0.47 0.76 1.20 0.91 0.99 1.04 131.17 5.52 3.80 +5BVP_A 79 Q 0.48 0.66 1.31 0.97 0.98 1.05 146.15 5.52 -3.50 +5BVP_A 80 L 0.50 0.34 0.49 0.83 0.98 1.10 131.17 5.52 3.80 +5BVP_A 81 E 0.51 0.68 1.17 0.90 1.00 1.09 147.13 4.00 -3.50 +5BVP_A 82 S 0.52 0.61 2.79 1.03 1.02 1.06 105.09 5.24 -0.80 +5BVP_A 83 V 0.56 1.48 2.74 1.04 1.04 1.05 117.15 5.49 4.20 +5BVP_A 84 D 0.56 1.37 5.06 1.17 1.05 0.98 133.10 3.80 -3.50 +5BVP_A 85 P 0.58 1.61 3.67 1.23 1.05 1.03 115.13 5.96 -1.60 +5BVP_A 86 K 0.58 3.35 3.04 1.24 1.05 1.03 146.19 8.75 -3.90 +5BVP_A 87 N 0.58 4.01 4.39 1.32 1.04 0.97 132.12 5.52 -3.50 +5BVP_A 88 Y 0.57 5.18 3.77 1.25 1.04 0.98 181.19 5.52 -1.30 +5BVP_A 89 P 0.55 5.18 4.29 1.18 1.05 0.96 115.13 5.96 -1.60 +5BVP_A 90 K 0.54 3.19 2.87 1.12 1.06 0.95 146.19 8.75 -3.90 +5BVP_A 91 K 0.53 3.52 2.99 1.00 1.06 0.96 146.19 8.75 -3.90 +5BVP_A 92 K 0.52 4.56 4.07 0.99 1.06 0.92 146.19 8.75 -3.90 +5BVP_A 93 M 0.51 4.46 4.37 0.90 1.04 0.90 149.21 5.28 1.90 +5BVP_A 94 E 0.49 1.93 2.24 0.85 1.03 0.92 147.13 4.00 -3.50 +5BVP_A 95 K 0.47 0.72 0.90 0.77 1.02 0.98 146.19 8.75 -3.90 +5BVP_A 96 R 0.46 0.63 -1.23 0.71 0.99 1.01 174.20 9.75 -4.50 +5BVP_A 97 F 0.45 0.58 0.37 0.85 0.97 1.00 165.19 5.52 2.80 +5BVP_A 98 V 0.46 0.58 0.07 0.89 0.96 1.01 117.15 5.49 4.20 +5BVP_A 99 F 0.48 0.21 -1.89 0.81 0.96 1.04 165.19 5.52 2.80 +5BVP_A 100 N 0.49 0.42 -1.37 0.78 0.98 1.04 132.12 5.52 -3.50 +5BVP_A 101 K 0.49 0.39 -1.20 0.76 1.00 1.05 146.19 8.75 -3.90 +5BVP_A 102 I 0.51 0.73 0.33 0.92 1.00 0.96 131.17 5.52 4.50 +5BVP_A 103 E 0.54 0.73 2.64 1.05 1.00 0.92 147.13 4.00 -3.50 +5BVP_A 104 I 0.55 0.73 2.46 0.97 1.01 0.94 131.17 5.52 4.50 +5BVP_A 105 N 0.56 0.86 0.33 0.91 1.02 0.98 132.12 5.52 -3.50 +5BVP_A 106 N 0.54 0.86 2.59 0.95 1.03 0.94 132.12 5.52 -3.50 +5BVP_A 107 K 0.54 1.06 0.16 0.93 1.02 0.98 146.19 8.75 -3.90 +5BVP_A 108 L 0.52 1.15 2.41 0.97 1.00 0.93 131.17 5.52 3.80 +5BVP_A 109 E 0.50 0.95 2.34 0.95 0.99 0.97 147.13 4.00 -3.50 +5BVP_A 110 F 0.50 0.48 1.64 0.82 0.99 1.01 165.19 5.52 2.80 +5BVP_A 111 E 0.49 1.01 1.69 0.82 0.99 1.02 147.13 4.00 -3.50 +5BVP_A 112 S 0.47 0.51 1.69 0.82 0.99 1.00 105.09 5.24 -0.80 +5BVP_A 113 A 0.47 0.90 0.87 0.93 0.99 1.03 89.09 5.57 1.80 +5BVP_A 114 Q 0.44 0.84 3.19 1.07 0.99 0.98 146.15 5.52 -3.50 +5BVP_A 115 F 0.45 0.66 0.64 1.10 0.98 0.99 165.19 5.52 2.80 +5BVP_A 116 P 0.42 1.02 -0.56 1.06 0.98 1.01 115.13 5.96 -1.60 +5BVP_A 117 N 0.40 0.41 -2.00 1.03 0.96 1.02 132.12 5.52 -3.50 +5BVP_A 118 W 0.39 0.64 -1.93 1.10 0.95 1.02 204.23 5.52 -0.90 +5BVP_A 119 Y 0.38 0.60 0.13 1.15 0.94 1.00 181.19 5.52 -1.30 +5BVP_A 120 I 0.39 0.50 0.76 1.14 0.96 0.99 131.17 5.52 4.50 +5BVP_A 121 S 0.40 0.82 0.61 1.05 1.00 1.02 105.09 5.24 -0.80 +5BVP_A 122 T 0.41 0.53 2.34 1.01 1.04 1.05 119.12 5.19 -0.70 +5BVP_A 123 S 0.43 1.31 3.73 0.95 1.07 1.00 105.09 5.24 -0.80 +5BVP_A 124 Q 0.45 1.57 5.87 1.11 1.06 0.95 146.15 5.52 -3.50 +5BVP_A 125 A 0.47 1.07 4.34 0.99 1.05 0.92 89.09 5.57 1.80 +5BVP_A 126 E 0.48 1.24 3.90 1.07 1.02 0.94 147.13 4.00 -3.50 +5BVP_A 127 N 0.49 0.53 2.44 0.94 0.99 1.00 132.12 5.52 -3.50 +5BVP_A 128 M 0.47 0.46 0.27 0.88 0.97 1.01 149.21 5.28 1.90 +5BVP_A 129 P 0.45 0.22 -1.34 0.87 0.95 1.03 115.13 5.96 -1.60 +5BVP_A 130 V 0.45 0.13 -1.64 0.99 0.94 1.04 117.15 5.49 4.20 +5BVP_A 131 F 0.45 0.13 -1.83 0.99 0.96 1.05 165.19 5.52 2.80 +5BVP_A 132 L 0.45 0.09 -0.41 1.13 1.00 1.06 131.17 5.52 3.80 +5BVP_A 133 G 0.47 0.11 0.10 1.13 1.04 1.03 75.07 5.52 -0.40 +5BVP_A 134 G 0.48 0.23 1.49 1.20 1.09 0.98 75.07 5.52 -0.40 +5BVP_A 135 G 0.51 0.46 4.23 1.32 1.12 0.95 75.07 5.52 -0.40 +5BVP_A 136 G 0.52 0.33 4.40 1.31 1.12 0.93 75.07 5.52 -0.40 +5BVP_A 137 Q 0.55 0.48 4.33 1.22 1.11 0.94 146.15 5.52 -3.50 +5BVP_A 138 D 0.55 0.80 4.94 1.21 1.09 0.94 133.10 3.80 -3.50 +5BVP_A 139 I 0.53 0.70 2.81 1.07 1.06 0.97 131.17 5.52 4.50 +5BVP_A 140 T 0.51 0.59 2.74 0.98 1.04 0.97 119.12 5.19 -0.70 +5BVP_A 141 D 0.50 0.35 1.29 0.93 1.01 0.95 133.10 3.80 -3.50 +5BVP_A 142 F 0.49 0.86 0.71 0.86 0.98 0.97 165.19 5.52 2.80 +5BVP_A 143 T 0.48 0.52 0.54 0.88 0.95 0.96 119.12 5.19 -0.70 +5BVP_A 144 M 0.48 0.23 -0.73 0.81 0.93 1.03 149.21 5.28 1.90 +5BVP_A 145 Q 0.47 0.35 -1.23 0.81 0.93 1.05 146.15 5.52 -3.50 +5BVP_A 146 F 0.41 0.33 1.01 0.93 0.00 1.04 165.19 5.52 2.80 +5BVP_A 147 V 0.37 0.00 0.00 0.00 0.00 0.00 117.15 5.49 4.20 +5BVP_A 148 S 0.33 0.00 0.00 0.00 0.00 0.00 105.09 5.24 -0.80 +5BVP_A 149 S 0.29 0.00 0.00 0.00 0.00 0.00 105.09 5.24 -0.80 +4XAK_A 1 V 0.26 0.00 0.00 0.00 0.00 0.00 117.15 5.49 4.20 +4XAK_A 2 E 0.31 0.00 0.00 0.00 0.00 0.00 147.13 4.00 -3.50 +4XAK_A 3 C 0.37 0.34 0.00 0.00 0.00 0.00 121.15 5.52 2.50 +4XAK_A 4 D 0.43 0.71 2.13 1.06 0.96 1.10 133.10 3.80 -3.50 +4XAK_A 5 F 0.49 0.34 1.34 1.08 0.98 1.08 165.19 5.52 2.80 +4XAK_A 6 S 0.50 0.52 -1.09 1.05 1.00 1.13 105.09 5.24 -0.80 +4XAK_A 7 P 0.51 0.42 -0.36 1.09 1.01 1.08 115.13 5.96 -1.60 +4XAK_A 8 L 0.53 0.48 -0.97 1.10 1.02 1.08 131.17 5.52 3.80 +4XAK_A 9 L 0.55 0.52 1.09 1.15 1.03 1.05 131.17 5.52 3.80 +4XAK_A 10 S 0.56 0.52 0.46 1.17 1.04 1.06 105.09 5.24 -0.80 +4XAK_A 11 G 0.57 0.97 0.46 1.17 1.06 1.06 75.07 5.52 -0.40 +4XAK_A 12 T 0.57 2.03 2.63 1.22 1.07 1.03 119.12 5.19 -0.70 +4XAK_A 13 P 0.58 1.12 3.41 1.21 1.06 1.05 115.13 5.96 -1.60 +4XAK_A 14 P 0.58 1.78 2.21 1.17 1.03 1.07 115.13 5.96 -1.60 +4XAK_A 15 Q 0.58 1.98 2.40 1.17 1.00 1.05 146.15 5.52 -3.50 +4XAK_A 16 V 0.57 1.11 0.34 1.12 0.97 1.08 117.15 5.49 4.20 +4XAK_A 17 Y 0.57 1.44 0.86 1.04 0.96 1.06 181.19 5.52 -1.30 +4XAK_A 18 N 0.55 1.62 1.16 0.96 0.96 1.03 132.12 5.52 -3.50 +4XAK_A 19 F 0.55 1.80 -1.01 0.91 0.97 1.07 165.19 5.52 2.80 +4XAK_A 20 K 0.53 0.85 -1.01 0.91 0.99 1.07 146.19 8.75 -3.90 +4XAK_A 21 R 0.53 0.46 -2.06 0.83 0.99 1.06 174.20 9.75 -4.50 +4XAK_A 22 L 0.53 0.77 -2.31 0.74 0.98 1.08 131.17 5.52 3.80 +4XAK_A 23 V 0.50 0.62 0.00 0.88 0.97 1.03 117.15 5.49 4.20 +4XAK_A 24 F 0.51 0.17 -0.61 0.91 0.97 1.10 165.19 5.52 2.80 +4XAK_A 25 T 0.51 0.33 -0.21 0.99 0.97 1.09 119.12 5.19 -0.70 +4XAK_A 26 N 0.51 0.69 0.83 1.07 0.98 1.07 132.12 5.52 -3.50 +4XAK_A 27 C 0.51 1.29 2.36 1.22 0.97 0.99 121.15 5.52 2.50 +4XAK_A 28 N 0.52 0.74 2.36 1.22 0.96 1.01 132.12 5.52 -3.50 +4XAK_A 29 Y 0.54 0.66 2.36 1.22 0.96 1.01 181.19 5.52 -1.30 +4XAK_A 30 N 0.52 2.47 2.17 1.14 0.97 1.03 132.12 5.52 -3.50 +4XAK_A 31 L 0.52 1.27 0.66 1.06 0.99 1.01 131.17 5.52 3.80 +4XAK_A 32 T 0.53 0.67 -1.66 0.92 1.00 1.08 119.12 5.19 -0.70 +4XAK_A 33 K 0.53 0.56 -0.46 0.96 1.00 1.05 146.19 8.75 -3.90 +4XAK_A 34 L 0.51 0.56 -2.77 0.82 0.99 1.12 131.17 5.52 3.80 +4XAK_A 35 L 0.52 0.33 -2.77 0.82 0.97 1.10 131.17 5.52 3.80 +4XAK_A 36 S 0.51 0.22 -2.59 0.89 0.95 1.11 105.09 5.24 -0.80 +4XAK_A 37 L 0.51 0.20 -3.93 0.82 0.94 1.18 131.17 5.52 3.80 +4XAK_A 38 F 0.51 0.39 -1.61 0.96 0.94 1.11 165.19 5.52 2.80 +4XAK_A 39 S 0.52 0.49 1.13 1.08 0.96 1.06 105.09 5.24 -0.80 +4XAK_A 40 V 0.53 0.51 -1.11 0.96 0.98 1.07 117.15 5.49 4.20 +4XAK_A 41 N 0.52 0.85 0.94 1.02 0.99 1.02 132.12 5.52 -3.50 +4XAK_A 42 D 0.51 0.34 2.46 1.10 0.99 1.06 133.10 3.80 -3.50 +4XAK_A 43 F 0.52 0.62 2.46 1.10 0.98 1.06 165.19 5.52 2.80 +4XAK_A 44 T 0.51 0.66 3.84 1.17 0.98 1.01 119.12 5.19 -0.70 +4XAK_A 45 C 0.52 0.28 1.70 1.01 0.99 1.07 121.15 5.52 2.50 +4XAK_A 46 S 0.51 0.43 1.20 1.01 1.00 1.09 105.09 5.24 -0.80 +4XAK_A 47 Q 0.50 0.46 2.81 1.14 1.02 1.08 146.15 5.52 -3.50 +4XAK_A 48 I 0.51 0.87 2.37 1.10 1.03 1.10 131.17 5.52 4.50 +4XAK_A 49 S 0.49 0.66 2.47 1.02 1.02 1.05 105.09 5.24 -0.80 +4XAK_A 50 P 0.50 0.27 0.40 0.88 1.00 1.07 115.13 5.96 -1.60 +4XAK_A 51 A 0.51 0.38 -0.16 0.84 0.97 1.08 89.09 5.57 1.80 +4XAK_A 52 A 0.50 0.38 1.91 0.98 0.95 1.06 89.09 5.57 1.80 +4XAK_A 53 I 0.50 0.40 1.99 0.99 0.94 1.03 131.17 5.52 4.50 +4XAK_A 54 A 0.48 0.21 1.89 0.95 0.95 1.08 89.09 5.57 1.80 +4XAK_A 55 S 0.47 0.33 1.31 1.02 0.96 1.09 105.09 5.24 -0.80 +4XAK_A 56 N 0.46 0.63 1.94 1.13 0.97 1.08 132.12 5.52 -3.50 +4XAK_A 57 C 0.43 0.83 4.01 1.26 0.97 1.06 121.15 5.52 2.50 +4XAK_A 58 Y 0.44 0.51 2.40 1.25 0.98 1.09 181.19 5.52 -1.30 +4XAK_A 59 S 0.42 0.22 0.33 1.12 0.98 1.11 105.09 5.24 -0.80 +4XAK_A 60 S 0.41 0.34 -1.99 0.98 0.98 1.18 105.09 5.24 -0.80 +4XAK_A 61 L 0.40 0.37 -0.76 1.02 0.97 1.10 131.17 5.52 3.80 +4XAK_A 62 I 0.40 0.43 -0.76 1.02 0.95 1.10 131.17 5.52 4.50 +4XAK_A 63 L 0.41 0.28 -3.00 0.90 0.94 1.11 131.17 5.52 3.80 +4XAK_A 64 D 0.41 0.45 -3.00 0.90 0.93 1.11 133.10 3.80 -3.50 +4XAK_A 65 Y 0.43 1.00 -1.96 0.98 0.93 1.10 181.19 5.52 -1.30 +4XAK_A 66 F 0.47 1.88 -0.51 1.13 0.93 1.09 165.19 5.52 2.80 +4XAK_A 67 S 0.49 0.93 -0.51 1.13 0.93 1.09 105.09 5.24 -0.80 +4XAK_A 68 Y 0.53 0.80 -1.01 1.12 0.94 1.11 181.19 5.52 -1.30 +4XAK_A 69 P 0.55 0.91 -1.34 1.04 0.94 1.06 115.13 5.96 -1.60 +4XAK_A 70 L 0.57 1.36 0.79 1.10 0.95 1.04 131.17 5.52 3.80 +4XAK_A 71 S 0.59 1.16 0.79 1.10 0.97 1.04 105.09 5.24 -0.80 +4XAK_A 72 M 0.58 1.25 2.49 1.15 1.01 0.99 149.21 5.28 1.90 +4XAK_A 73 K 0.61 1.25 0.87 1.02 1.04 1.02 146.19 8.75 -3.90 +4XAK_A 74 S 0.62 1.25 3.11 1.14 1.05 0.99 105.09 5.24 -0.80 +4XAK_A 75 D 0.62 0.94 1.66 1.00 1.04 1.04 133.10 3.80 -3.50 +4XAK_A 76 L 0.62 0.63 3.19 1.12 1.02 1.07 131.17 5.52 3.80 +4XAK_A 77 S 0.62 0.63 3.30 1.18 1.00 1.08 105.09 5.24 -0.80 +4XAK_A 78 V 0.61 0.38 2.67 1.07 1.00 1.09 117.15 5.49 4.20 +4XAK_A 79 S 0.60 0.46 2.06 1.09 1.01 1.09 105.09 5.24 -0.80 +4XAK_A 80 S 0.59 0.53 3.67 1.22 1.03 1.06 105.09 5.24 -0.80 +4XAK_A 81 A 0.61 0.50 1.60 1.08 1.04 1.08 89.09 5.57 1.80 +4XAK_A 82 G 0.60 0.50 3.06 1.21 1.05 1.03 75.07 5.52 -0.40 +4XAK_A 83 P 0.60 0.64 2.99 1.15 1.05 1.03 115.13 5.96 -1.60 +4XAK_A 84 I 0.60 0.55 0.74 1.03 1.03 1.04 131.17 5.52 4.50 +4XAK_A 85 S 0.58 0.90 1.44 1.16 1.02 1.00 105.09 5.24 -0.80 +4XAK_A 86 Q 0.58 0.91 0.36 1.10 1.00 1.04 146.15 5.52 -3.50 +4XAK_A 87 F 0.58 2.59 0.87 1.03 0.98 1.02 165.19 5.52 2.80 +4XAK_A 88 N 0.60 3.35 2.87 1.10 0.99 1.00 132.12 5.52 -3.50 +4XAK_A 89 Y 0.62 2.59 2.87 1.10 1.01 1.00 181.19 5.52 -1.30 +4XAK_A 90 K 0.62 2.59 0.70 1.05 1.03 1.01 146.19 8.75 -3.90 +4XAK_A 91 Q 0.60 2.16 2.94 1.16 1.05 1.00 146.15 5.52 -3.50 +4XAK_A 92 S 0.59 2.22 2.94 1.16 1.05 1.00 105.09 5.24 -0.80 +4XAK_A 93 F 0.57 1.71 3.51 1.22 1.04 0.99 165.19 5.52 2.80 +4XAK_A 94 S 0.54 1.43 3.44 1.21 1.05 0.98 105.09 5.24 -0.80 +4XAK_A 95 N 0.50 0.57 2.79 1.24 1.04 1.04 132.12 5.52 -3.50 +4XAK_A 96 P 0.46 0.54 0.54 1.12 1.03 1.07 115.13 5.96 -1.60 +4XAK_A 97 T 0.42 0.28 0.71 1.10 1.00 1.08 119.12 5.19 -0.70 +4XAK_A 98 C 0.36 0.15 -1.53 0.98 0.96 1.12 121.15 5.52 2.50 +4XAK_A 99 L 0.33 0.10 -2.23 0.85 0.93 1.16 131.17 5.52 3.80 +4XAK_A 100 I 0.31 0.10 -1.79 0.77 0.92 1.14 131.17 5.52 4.50 +4XAK_A 101 L 0.32 0.13 -3.06 0.71 0.92 1.20 131.17 5.52 3.80 +4XAK_A 102 A 0.34 0.25 -2.96 0.76 0.93 1.15 89.09 5.57 1.80 +4XAK_A 103 T 0.37 0.48 -1.34 0.81 0.94 1.13 119.12 5.19 -0.70 +4XAK_A 104 V 0.40 0.94 0.80 0.96 0.95 1.08 117.15 5.49 4.20 +4XAK_A 105 P 0.44 0.76 0.80 0.96 0.95 1.08 115.13 5.96 -1.60 +4XAK_A 106 H 0.46 0.76 1.24 1.01 0.96 1.06 155.16 6.74 -3.20 +4XAK_A 107 N 0.48 1.49 1.24 1.01 0.97 1.06 132.12 5.52 -3.50 +4XAK_A 108 L 0.50 0.67 0.63 1.00 0.99 1.02 131.17 5.52 3.80 +4XAK_A 109 T 0.53 0.72 1.07 0.92 1.01 1.00 119.12 5.19 -0.70 +4XAK_A 110 T 0.54 0.89 1.59 0.93 1.03 0.98 119.12 5.19 -0.70 +4XAK_A 111 I 0.55 1.67 0.89 0.92 1.04 1.02 131.17 5.52 4.50 +4XAK_A 112 T 0.55 0.95 0.89 0.92 1.05 1.02 119.12 5.19 -0.70 +4XAK_A 113 K 0.56 1.32 0.96 0.93 1.05 1.02 146.19 8.75 -3.90 +4XAK_A 114 P 0.56 2.95 -0.06 0.96 1.04 1.06 115.13 5.96 -1.60 +4XAK_A 115 L 0.57 2.74 2.01 1.09 1.02 1.04 131.17 5.52 3.80 +4XAK_A 116 K 0.59 2.15 1.00 1.12 1.00 1.07 146.19 8.75 -3.90 +4XAK_A 117 Y 0.60 0.97 -0.96 1.04 0.97 1.10 181.19 5.52 -1.30 +4XAK_A 118 S 0.61 1.90 -0.26 1.05 0.95 1.06 105.09 5.24 -0.80 +4XAK_A 119 Y 0.60 1.90 1.87 1.11 0.95 1.02 181.19 5.52 -1.30 +4XAK_A 120 I 0.59 0.65 1.26 1.13 0.96 1.09 131.17 5.52 4.50 +4XAK_A 121 N 0.59 0.65 2.46 1.18 0.98 1.06 132.12 5.52 -3.50 +4XAK_A 122 K 0.59 0.81 2.13 1.11 1.00 1.05 146.19 8.75 -3.90 +4XAK_A 123 C 0.60 1.00 1.09 1.03 1.01 1.04 121.15 5.52 2.50 +4XAK_A 124 S 0.60 0.51 0.91 1.05 1.01 1.05 105.09 5.24 -0.80 +4XAK_A 125 R 0.61 0.34 0.84 1.03 1.00 1.08 174.20 9.75 -4.50 +4XAK_A 126 F 0.62 1.07 1.46 1.09 0.99 1.07 165.19 5.52 2.80 +4XAK_A 127 L 0.62 1.34 2.69 1.13 1.00 1.00 131.17 5.52 3.80 +4XAK_A 128 S 0.63 1.34 2.36 1.06 1.01 0.98 105.09 5.24 -0.80 +4XAK_A 129 D 0.63 2.23 2.50 1.06 1.02 0.98 133.10 3.80 -3.50 +4XAK_A 130 D 0.62 4.68 4.93 1.08 1.04 0.95 133.10 3.80 -3.50 +4XAK_A 131 R 0.61 2.59 5.71 1.07 1.04 0.97 174.20 9.75 -4.50 +4XAK_A 132 T 0.59 2.40 5.09 1.08 1.04 0.97 119.12 5.19 -0.70 +4XAK_A 133 E 0.58 2.49 4.51 1.02 1.04 0.99 147.13 4.00 -3.50 +4XAK_A 134 V 0.56 1.05 1.77 0.89 1.03 1.05 117.15 5.49 4.20 +4XAK_A 135 P 0.53 0.54 0.64 0.83 1.02 1.12 115.13 5.96 -1.60 +4XAK_A 136 Q 0.51 0.50 0.90 0.91 1.00 1.10 146.15 5.52 -3.50 +4XAK_A 137 L 0.51 0.68 0.09 0.90 0.99 1.13 131.17 5.52 3.80 +4XAK_A 138 V 0.52 0.71 1.61 1.05 0.98 1.05 117.15 5.49 4.20 +4XAK_A 139 N 0.52 0.71 2.17 0.98 0.98 1.04 132.12 5.52 -3.50 +4XAK_A 140 A 0.52 1.35 1.04 1.00 0.99 1.06 89.09 5.57 1.80 +4XAK_A 141 N 0.52 2.43 3.29 1.12 1.00 1.03 132.12 5.52 -3.50 +4XAK_A 142 Q 0.52 2.34 4.11 1.26 1.01 0.98 146.15 5.52 -3.50 +4XAK_A 143 Y 0.53 1.24 3.31 1.21 1.01 1.07 181.19 5.52 -1.30 +4XAK_A 144 S 0.54 0.57 2.49 1.19 1.00 1.12 105.09 5.24 -0.80 +4XAK_A 145 P 0.54 0.44 2.41 1.17 0.99 1.15 115.13 5.96 -1.60 +4XAK_A 146 C 0.54 0.20 0.41 1.10 0.96 1.17 121.15 5.52 2.50 +4XAK_A 147 V 0.54 0.11 0.16 1.01 0.94 1.20 117.15 5.49 4.20 +4XAK_A 148 S 0.54 0.11 -0.47 1.02 0.93 1.21 105.09 5.24 -0.80 +4XAK_A 149 I 0.55 0.27 0.16 1.01 0.95 1.20 131.17 5.52 4.50 +4XAK_A 150 V 0.55 0.53 0.70 0.97 0.99 1.13 117.15 5.49 4.20 +4XAK_A 151 P 0.58 0.30 0.70 0.97 1.02 1.13 115.13 5.96 -1.60 +4XAK_A 152 S 0.57 0.44 -1.66 0.91 1.04 1.11 105.09 5.24 -0.80 +4XAK_A 153 T 0.58 1.03 0.60 0.94 1.03 1.07 119.12 5.19 -0.70 +4XAK_A 154 V 0.58 1.12 2.56 1.08 1.01 1.00 117.15 5.49 4.20 +4XAK_A 155 W 0.57 0.83 3.07 1.09 1.00 0.97 204.23 5.52 -0.90 +4XAK_A 156 E 0.57 0.95 3.57 1.09 1.02 0.95 147.13 4.00 -3.50 +4XAK_A 157 D 0.57 2.02 2.56 1.12 1.03 0.98 133.10 3.80 -3.50 +4XAK_A 158 G 0.57 3.00 2.81 1.21 1.04 0.95 75.07 5.52 -0.40 +4XAK_A 159 D 0.58 3.40 4.84 1.21 1.04 0.95 133.10 3.80 -3.50 +4XAK_A 160 Y 0.58 4.07 4.54 1.25 1.02 0.96 181.19 5.52 -1.30 +4XAK_A 161 Y 0.59 7.12 3.97 1.18 1.01 0.98 181.19 5.52 -1.30 +4XAK_A 162 R 0.59 3.52 1.84 1.04 1.01 1.04 174.20 9.75 -4.50 +4XAK_A 163 K 0.60 3.01 1.34 1.03 1.02 1.06 146.19 8.75 -3.90 +4XAK_A 164 Q 0.62 2.97 1.91 1.09 1.03 1.04 146.15 5.52 -3.50 +4XAK_A 165 L 0.62 1.25 0.87 1.01 1.03 1.06 131.17 5.52 3.80 +4XAK_A 166 S 0.62 1.08 1.39 0.98 1.03 1.05 105.09 5.24 -0.80 +4XAK_A 167 P 0.62 0.62 1.39 1.06 1.04 1.05 115.13 5.96 -1.60 +4XAK_A 168 L 0.60 0.74 1.34 1.14 1.04 1.02 131.17 5.52 3.80 +4XAK_A 169 E 0.58 0.55 3.47 1.28 1.06 0.97 147.13 4.00 -3.50 +4XAK_A 170 G 0.57 0.37 1.11 1.21 1.07 0.95 75.07 5.52 -0.40 +4XAK_A 171 G 0.53 0.37 -0.50 1.08 1.06 0.98 75.07 5.52 -0.40 +4XAK_A 172 G 0.51 0.16 0.29 1.07 1.03 1.00 75.07 5.52 -0.40 +4XAK_A 173 W 0.49 0.16 -0.53 1.06 0.98 1.03 204.23 5.52 -0.90 +4XAK_A 174 L 0.47 0.22 -0.41 1.04 0.96 1.05 131.17 5.52 3.80 +4XAK_A 175 V 0.48 0.22 -0.41 1.04 0.96 1.05 117.15 5.49 4.20 +4XAK_A 176 A 0.47 0.28 -0.30 1.02 0.99 1.07 89.09 5.57 1.80 +4XAK_A 177 S 0.48 0.49 1.87 1.02 1.04 1.07 105.09 5.24 -0.80 +4XAK_A 178 G 0.48 0.49 2.66 1.01 1.07 1.09 75.07 5.52 -0.40 +4XAK_A 179 S 0.48 0.49 3.49 1.03 1.07 1.05 105.09 5.24 -0.80 +4XAK_A 180 T 0.51 0.36 2.59 1.02 1.03 1.01 119.12 5.19 -0.70 +4XAK_A 181 V 0.53 0.53 2.40 0.95 0.99 1.00 117.15 5.49 4.20 +4XAK_A 182 A 0.54 0.69 2.70 0.84 0.96 0.99 89.09 5.57 1.80 +4XAK_A 183 M 0.54 0.82 2.63 0.77 0.96 0.99 149.21 5.28 1.90 +4XAK_A 184 T 0.54 0.91 0.57 0.72 0.99 1.04 119.12 5.19 -0.70 +4XAK_A 185 E 0.54 1.57 1.96 0.79 1.00 0.99 147.13 4.00 -3.50 +4XAK_A 186 Q 0.51 1.57 1.06 0.78 1.00 0.96 146.15 5.52 -3.50 +4XAK_A 187 L 0.49 1.07 2.47 0.92 0.98 0.96 131.17 5.52 3.80 +4XAK_A 188 Q 0.46 0.54 0.41 0.86 0.95 0.99 146.15 5.52 -3.50 +4XAK_A 189 M 0.43 0.31 0.11 0.98 0.93 0.99 149.21 5.28 1.90 +4XAK_A 190 G 0.40 0.26 -1.89 0.91 0.93 1.01 75.07 5.52 -0.40 +4XAK_A 191 F 0.37 0.22 0.17 0.96 0.94 0.96 165.19 5.52 2.80 +4XAK_A 192 G 0.36 0.16 -1.21 0.89 0.95 1.02 75.07 5.52 -0.40 +4XAK_A 193 I 0.35 0.29 0.24 0.95 0.95 1.04 131.17 5.52 4.50 +4XAK_A 194 T 0.35 0.52 -0.84 0.89 0.95 1.08 119.12 5.19 -0.70 +4XAK_A 195 V 0.39 0.52 1.29 1.02 0.95 1.05 117.15 5.49 4.20 +4XAK_A 196 Q 0.43 1.06 1.21 0.94 0.96 1.06 146.15 5.52 -3.50 +4XAK_A 197 Y 0.46 1.06 3.10 1.01 0.98 1.02 181.19 5.52 -1.30 +4XAK_A 198 G 0.49 2.30 3.36 1.09 1.02 1.00 75.07 5.52 -0.40 +4XAK_A 199 T 0.51 1.78 4.81 1.23 1.05 0.95 119.12 5.19 -0.70 +4XAK_A 200 T 0.52 0.84 3.43 1.16 1.06 1.00 119.12 5.19 -0.70 +4XAK_A 201 N 0.54 0.46 3.90 1.17 1.05 1.04 132.12 5.52 -3.50 +4XAK_A 202 S 0.55 0.49 3.39 1.16 1.02 1.07 105.09 5.24 -0.80 +4XAK_A 203 V 0.56 0.68 3.46 1.17 1.00 1.07 117.15 5.49 4.20 +4XAK_A 204 C 0.56 0.35 1.40 1.11 0.99 1.12 121.15 5.52 2.50 +4XAK_A 205 P 0.54 0.45 1.51 1.00 1.00 1.13 115.13 5.96 -1.60 +4XAK_A 206 K 0.54 0.52 -0.73 0.88 1.00 1.14 146.19 8.75 -3.90 +4XAK_A 207 L 0.48 0.99 0.10 0.90 0.00 1.09 131.17 5.52 3.80 +4XAK_A 208 E 0.42 0.00 0.00 0.00 0.00 0.00 147.13 4.00 -3.50 +4XAK_A 209 F 0.38 0.00 0.00 0.00 0.00 0.00 165.19 5.52 2.80 +4XAK_A 210 A 0.32 0.00 0.00 0.00 0.00 0.00 89.09 5.57 1.80 +4WFF_A 1 R 0.18 0.00 0.00 0.00 0.00 0.00 174.20 9.75 -4.50 +4WFF_A 2 S 0.22 0.00 0.00 0.00 0.00 0.00 105.09 5.24 -0.80 +4WFF_A 3 T 0.27 1.31 0.00 0.00 0.00 0.00 119.12 5.19 -0.70 +4WFF_A 4 T 0.29 0.67 0.69 0.88 1.03 1.04 119.12 5.19 -0.70 +4WFF_A 5 L 0.31 0.42 -1.23 0.83 0.99 1.09 131.17 5.52 3.80 +4WFF_A 6 L 0.31 0.24 -3.47 0.71 0.95 1.13 131.17 5.52 3.80 +4WFF_A 7 A 0.30 0.17 -3.91 0.66 0.93 1.15 89.09 5.57 1.80 +4WFF_A 8 L 0.29 0.17 -5.97 0.61 0.91 1.20 131.17 5.52 3.80 +4WFF_A 9 L 0.28 0.15 -5.19 0.60 0.91 1.22 131.17 5.52 3.80 +4WFF_A 10 A 0.27 0.12 -5.19 0.60 0.91 1.22 89.09 5.57 1.80 +4WFF_A 11 L 0.26 0.12 -6.80 0.59 0.91 1.24 131.17 5.52 3.80 +4WFF_A 12 V 0.24 0.23 -5.76 0.67 0.91 1.23 117.15 5.49 4.20 +4WFF_A 13 L 0.24 0.19 -5.76 0.67 0.91 1.23 131.17 5.52 3.80 +4WFF_A 14 L 0.25 0.17 -6.59 0.64 0.90 1.28 131.17 5.52 3.80 +4WFF_A 15 Y 0.26 0.31 -4.34 0.76 0.91 1.24 181.19 5.52 -1.30 +4WFF_A 16 L 0.27 0.37 -3.00 0.91 0.93 1.17 131.17 5.52 3.80 +4WFF_A 17 V 0.29 0.45 -1.39 0.92 0.95 1.14 117.15 5.49 4.20 +4WFF_A 18 S 0.30 0.24 -1.39 0.92 0.97 1.14 105.09 5.24 -0.80 +4WFF_A 19 G 0.29 0.21 -1.64 0.83 0.98 1.17 75.07 5.52 -0.40 +4WFF_A 20 A 0.31 0.25 -1.64 0.83 0.96 1.15 89.09 5.57 1.80 +4WFF_A 21 L 0.33 0.37 -0.51 0.90 0.94 1.08 131.17 5.52 3.80 +4WFF_A 22 V 0.35 0.37 -1.14 0.79 0.93 1.09 117.15 5.49 4.20 +4WFF_A 23 F 0.37 0.30 -3.27 0.65 0.92 1.14 165.19 5.52 2.80 +4WFF_A 24 R 0.40 0.64 -2.46 0.66 0.93 1.11 174.20 9.75 -4.50 +4WFF_A 25 A 0.44 1.49 -0.29 0.72 0.96 1.08 89.09 5.57 1.80 +4WFF_A 26 L 0.46 2.66 0.54 0.86 0.99 1.03 131.17 5.52 3.80 +4WFF_A 27 E 0.49 1.85 2.16 0.91 1.03 1.03 147.13 4.00 -3.50 +4WFF_A 28 Q 0.53 3.17 2.67 0.88 1.06 1.03 146.15 5.52 -3.50 +4WFF_A 29 P 0.55 6.66 3.23 0.93 1.07 1.02 115.13 5.96 -1.60 +4WFF_A 30 H 0.56 6.66 5.40 0.98 1.06 0.99 155.16 6.74 -3.20 +4WFF_A 31 E 0.60 3.88 4.59 0.97 1.06 1.02 147.13 4.00 -3.50 +4WFF_A 32 Q 0.61 4.35 4.59 0.97 1.06 1.02 146.15 5.52 -3.50 +4WFF_A 33 Q 0.60 6.26 4.89 0.89 1.05 0.99 146.15 5.52 -3.50 +4WFF_A 34 A 0.59 6.26 5.70 0.86 1.05 0.95 89.09 5.57 1.80 +4WFF_A 35 Q 0.58 2.98 3.27 0.84 1.04 1.01 146.15 5.52 -3.50 +4WFF_A 36 R 0.57 1.70 3.23 0.92 1.03 0.99 174.20 9.75 -4.50 +4WFF_A 37 E 0.58 2.92 3.49 0.89 1.02 0.97 147.13 4.00 -3.50 +4WFF_A 38 L 0.57 1.25 2.66 0.87 1.02 1.01 131.17 5.52 3.80 +4WFF_A 39 G 0.58 1.25 2.40 0.86 1.02 0.99 75.07 5.52 -0.40 +4WFF_A 40 E 0.57 1.25 2.91 0.83 1.02 0.99 147.13 4.00 -3.50 +4WFF_A 41 V 0.55 3.04 2.61 0.87 1.03 1.00 117.15 5.49 4.20 +4WFF_A 42 R 0.54 2.66 2.61 0.87 1.03 0.98 174.20 9.75 -4.50 +4WFF_A 43 E 0.55 1.27 0.49 0.73 1.03 1.03 147.13 4.00 -3.50 +4WFF_A 44 K 0.55 3.34 -0.03 0.76 1.01 1.04 146.19 8.75 -3.90 +4WFF_A 45 F 0.54 1.72 0.80 0.79 0.98 0.99 165.19 5.52 2.80 +4WFF_A 46 L 0.53 1.35 0.50 0.79 0.96 1.02 131.17 5.52 3.80 +4WFF_A 47 R 0.54 1.05 -0.31 0.90 0.94 1.05 174.20 9.75 -4.50 +4WFF_A 48 A 0.53 0.65 -0.93 0.92 0.93 1.12 89.09 5.57 1.80 +4WFF_A 49 H 0.52 0.58 -0.14 0.91 0.93 1.16 155.16 6.74 -3.20 +4WFF_A 50 P 0.54 0.40 2.10 1.03 0.93 1.13 115.13 5.96 -1.60 +4WFF_A 51 C 0.55 0.66 2.93 1.10 0.94 1.13 121.15 5.52 2.50 +4WFF_A 52 V 0.56 0.84 3.49 1.15 0.97 1.12 117.15 5.49 4.20 +4WFF_A 53 S 0.56 0.94 4.30 1.12 1.01 1.09 105.09 5.24 -0.80 +4WFF_A 54 D 0.57 1.45 2.69 0.98 1.03 1.11 133.10 3.80 -3.50 +4WFF_A 55 Q 0.57 1.93 3.30 1.04 1.05 1.04 146.15 5.52 -3.50 +4WFF_A 56 E 0.54 1.19 2.51 1.05 1.03 1.02 147.13 4.00 -3.50 +4WFF_A 57 L 0.52 0.59 0.27 0.93 1.00 1.05 131.17 5.52 3.80 +4WFF_A 58 G 0.51 0.24 -2.30 0.79 0.97 1.09 75.07 5.52 -0.40 +4WFF_A 59 L 0.50 0.27 -2.34 0.79 0.95 1.08 131.17 5.52 3.80 +4WFF_A 60 L 0.46 0.57 -2.34 0.79 0.95 1.08 131.17 5.52 3.80 +4WFF_A 61 I 0.43 0.43 -1.56 0.78 0.96 1.10 131.17 5.52 4.50 +4WFF_A 62 K 0.43 0.53 -2.07 0.65 0.98 1.13 146.19 8.75 -3.90 +4WFF_A 63 E 0.42 1.07 0.67 0.78 0.98 1.07 147.13 4.00 -3.50 +4WFF_A 64 V 0.40 1.54 2.29 0.79 0.97 1.04 117.15 5.49 4.20 +4WFF_A 65 A 0.43 0.64 2.11 0.80 0.96 1.06 89.09 5.57 1.80 +4WFF_A 66 D 0.44 0.36 2.11 0.88 0.95 1.05 133.10 3.80 -3.50 +4WFF_A 67 A 0.45 0.48 1.81 1.00 0.97 1.05 89.09 5.57 1.80 +4WFF_A 68 L 0.46 0.47 3.16 1.15 1.00 0.98 131.17 5.52 3.80 +4WFF_A 69 G 0.50 0.29 3.16 1.15 1.03 0.98 75.07 5.52 -0.40 +4WFF_A 70 G 0.53 0.47 3.16 1.15 1.05 0.98 75.07 5.52 -0.40 +4WFF_A 71 G 0.55 0.89 3.16 1.27 1.06 0.98 75.07 5.52 -0.40 +4WFF_A 72 A 0.58 1.56 5.59 1.29 1.07 0.92 89.09 5.57 1.80 +4WFF_A 73 D 0.62 2.27 5.51 1.21 1.07 0.93 133.10 3.80 -3.50 +4WFF_A 74 P 0.64 3.07 5.63 1.19 1.07 0.95 115.13 5.96 -1.60 +4WFF_A 75 E 0.65 4.14 5.11 1.10 1.07 0.98 147.13 4.00 -3.50 +4WFF_A 76 T 0.66 3.32 5.74 1.21 1.05 0.97 119.12 5.19 -0.70 +4WFF_A 77 S 0.66 2.17 4.61 1.10 1.02 1.00 105.09 5.24 -0.80 +4WFF_A 78 H 0.65 1.32 2.89 1.02 0.99 0.98 155.16 6.74 -3.20 +4WFF_A 79 S 0.63 1.53 3.20 1.12 0.96 0.98 105.09 5.24 -0.80 +4WFF_A 80 A 0.60 0.94 1.14 1.07 0.95 1.03 89.09 5.57 1.80 +4WFF_A 81 W 0.56 0.68 1.03 1.09 0.94 1.01 204.23 5.52 -0.90 +4WFF_A 82 D 0.52 0.68 1.66 1.16 0.96 1.00 133.10 3.80 -3.50 +4WFF_A 83 L 0.48 0.68 1.03 1.05 0.98 1.00 131.17 5.52 3.80 +4WFF_A 84 G 0.45 0.56 -0.59 1.04 0.99 1.01 75.07 5.52 -0.40 +4WFF_A 85 S 0.41 0.29 -0.47 0.99 0.99 1.04 105.09 5.24 -0.80 +4WFF_A 86 A 0.38 0.31 -3.21 0.86 0.97 1.07 89.09 5.57 1.80 +4WFF_A 87 F 0.35 0.41 -0.97 0.98 0.95 1.03 165.19 5.52 2.80 +4WFF_A 88 F 0.33 0.31 -0.97 0.98 0.96 1.03 165.19 5.52 2.80 +4WFF_A 89 F 0.31 0.44 -1.16 0.92 0.98 1.02 165.19 5.52 2.80 +4WFF_A 90 S 0.29 0.35 -2.60 0.89 1.01 1.03 105.09 5.24 -0.80 +4WFF_A 91 G 0.29 0.29 -2.43 0.87 1.02 1.04 75.07 5.52 -0.40 +4WFF_A 92 T 0.31 0.48 -0.37 0.92 1.01 1.01 119.12 5.19 -0.70 +4WFF_A 93 I 0.32 0.51 1.69 0.97 0.99 0.99 131.17 5.52 4.50 +4WFF_A 94 I 0.34 0.36 -0.39 0.84 0.98 1.01 131.17 5.52 4.50 +4WFF_A 95 T 0.37 0.25 -0.39 0.84 0.99 1.01 119.12 5.19 -0.70 +4WFF_A 96 T 0.41 0.56 -1.40 0.86 0.99 1.04 119.12 5.19 -0.70 +4WFF_A 97 I 0.44 0.79 0.56 1.02 0.99 1.00 131.17 5.52 4.50 +4WFF_A 98 G 0.46 0.88 2.70 1.17 0.99 0.95 75.07 5.52 -0.40 +4WFF_A 99 Y 0.49 0.45 1.43 1.11 0.98 1.02 181.19 5.52 -1.30 +4WFF_A 100 G 0.51 0.65 0.99 1.06 0.98 1.04 75.07 5.52 -0.40 +4WFF_A 101 N 0.53 0.54 0.81 1.08 0.97 1.05 132.12 5.52 -3.50 +4WFF_A 102 V 0.52 0.68 0.60 0.99 0.96 1.05 117.15 5.49 4.20 +4WFF_A 103 A 0.52 0.99 1.61 0.97 0.96 1.02 89.09 5.57 1.80 +4WFF_A 104 L 0.52 1.03 2.23 0.95 0.98 1.02 131.17 5.52 3.80 +4WFF_A 105 R 0.50 1.40 1.53 0.83 1.01 1.06 174.20 9.75 -4.50 +4WFF_A 106 T 0.49 1.37 2.87 0.98 1.04 0.99 119.12 5.19 -0.70 +4WFF_A 107 D 0.48 3.25 3.17 1.02 1.05 0.96 133.10 3.80 -3.50 +4WFF_A 108 A 0.46 1.37 3.17 1.02 1.05 0.96 89.09 5.57 1.80 +4WFF_A 109 G 0.43 0.82 1.26 0.97 1.03 0.99 75.07 5.52 -0.40 +4WFF_A 110 R 0.39 0.26 0.71 1.00 1.00 1.06 174.20 9.75 -4.50 +4WFF_A 111 L 0.37 0.18 -1.86 0.86 0.97 1.10 131.17 5.52 3.80 +4WFF_A 112 F 0.36 0.16 -3.47 0.85 0.94 1.11 165.19 5.52 2.80 +4WFF_A 113 C 0.33 0.13 -4.56 0.79 0.92 1.15 121.15 5.52 2.50 +4WFF_A 114 I 0.32 0.16 -4.86 0.75 0.90 1.17 131.17 5.52 4.50 +4WFF_A 115 F 0.30 0.15 -4.86 0.75 0.89 1.17 165.19 5.52 2.80 +4WFF_A 116 Y 0.29 0.21 -4.07 0.74 0.89 1.22 181.19 5.52 -1.30 +4WFF_A 117 A 0.28 0.29 -3.46 0.79 0.89 1.14 89.09 5.57 1.80 +4WFF_A 118 L 0.30 0.24 -3.46 0.79 0.91 1.14 131.17 5.52 3.80 +4WFF_A 119 V 0.31 0.23 -1.84 0.92 0.92 1.14 117.15 5.49 4.20 +4WFF_A 120 G 0.32 0.19 -2.89 0.84 0.94 1.15 75.07 5.52 -0.40 +4WFF_A 121 I 0.31 0.20 -4.50 0.83 0.95 1.15 131.17 5.52 4.50 +4WFF_A 122 P 0.33 0.27 -2.37 0.97 0.95 1.10 115.13 5.96 -1.60 +4WFF_A 123 L 0.33 0.19 -2.99 0.97 0.94 1.07 131.17 5.52 3.80 +4WFF_A 124 F 0.33 0.22 -5.11 0.83 0.93 1.12 165.19 5.52 2.80 +4WFF_A 125 G 0.33 0.12 -5.29 0.85 0.92 1.13 75.07 5.52 -0.40 +4WFF_A 126 I 0.35 0.15 -5.29 0.72 0.92 1.13 131.17 5.52 4.50 +4WFF_A 127 L 0.35 0.17 -3.16 0.86 0.92 1.08 131.17 5.52 3.80 +4WFF_A 128 L 0.36 0.12 -2.37 0.85 0.93 1.12 131.17 5.52 3.80 +4WFF_A 129 A 0.39 0.18 -2.37 0.85 0.94 1.12 89.09 5.57 1.80 +4WFF_A 130 G 0.42 0.36 0.20 0.99 0.96 1.08 75.07 5.52 -0.40 +4WFF_A 131 V 0.44 0.85 2.11 1.04 0.98 1.03 117.15 5.49 4.20 +4WFF_A 132 G 0.46 0.69 2.11 1.04 1.00 1.03 75.07 5.52 -0.40 +4WFF_A 133 D 0.47 0.69 2.63 1.17 1.01 1.00 133.10 3.80 -3.50 +4WFF_A 134 R 0.49 1.25 2.74 1.15 1.03 1.02 174.20 9.75 -4.50 +4WFF_A 135 L 0.50 1.69 4.20 1.28 1.04 0.97 131.17 5.52 3.80 +4WFF_A 136 G 0.52 0.83 2.07 1.14 1.05 1.02 75.07 5.52 -0.40 +4WFF_A 137 S 0.53 0.83 1.24 1.07 1.05 1.02 105.09 5.24 -0.80 +4WFF_A 138 S 0.52 1.37 0.94 1.07 1.03 1.05 105.09 5.24 -0.80 +4WFF_A 139 L 0.52 1.37 3.07 1.21 1.00 1.00 131.17 5.52 3.80 +4WFF_A 140 R 0.52 0.72 1.11 1.05 0.97 1.04 174.20 9.75 -4.50 +4WFF_A 141 H 0.52 0.53 1.00 1.07 0.96 1.02 155.16 6.74 -3.20 +4WFF_A 142 G 0.53 0.88 0.37 1.00 0.95 1.03 75.07 5.52 -0.40 +4WFF_A 143 I 0.54 0.31 0.54 0.99 0.95 1.02 131.17 5.52 4.50 +4WFF_A 144 G 0.55 0.40 1.06 0.96 0.94 1.02 75.07 5.52 -0.40 +4WFF_A 145 H 0.54 0.41 1.06 0.92 0.94 1.01 155.16 6.74 -3.20 +4WFF_A 146 I 0.56 0.41 -0.90 0.76 0.93 1.05 131.17 5.52 4.50 +4WFF_A 147 E 0.57 0.36 -1.07 0.78 0.92 1.04 147.13 4.00 -3.50 +4WFF_A 148 A 0.57 0.22 -3.20 0.64 0.92 1.10 89.09 5.57 1.80 +4WFF_A 149 I 0.59 0.62 -2.69 0.65 0.93 1.07 131.17 5.52 4.50 +4WFF_A 150 F 0.61 0.37 -2.97 0.72 0.94 1.03 165.19 5.52 2.80 +4WFF_A 151 L 0.63 0.50 -3.79 0.75 0.95 1.07 131.17 5.52 3.80 +4WFF_A 152 K 0.63 0.53 -4.61 0.73 0.95 1.11 146.19 8.75 -3.90 +4WFF_A 153 W 0.63 0.95 -3.17 0.88 0.96 1.10 204.23 5.52 -0.90 +4WFF_A 154 H 0.64 1.79 -1.56 1.01 0.96 1.10 155.16 6.74 -3.20 +4WFF_A 155 V 0.64 1.55 0.87 1.03 0.98 1.04 117.15 5.49 4.20 +4WFF_A 156 P 0.64 1.21 -1.26 0.97 1.00 1.09 115.13 5.96 -1.60 +4WFF_A 157 P 0.66 0.66 -0.36 0.90 1.01 1.16 115.13 5.96 -1.60 +4WFF_A 158 E 0.65 1.75 -0.06 0.90 1.00 1.12 147.13 4.00 -3.50 +4WFF_A 159 L 0.65 0.84 -0.06 0.90 0.98 1.12 131.17 5.52 3.80 +4WFF_A 160 V 0.65 0.45 -1.67 0.77 0.95 1.15 117.15 5.49 4.20 +4WFF_A 161 R 0.65 0.35 -1.04 0.76 0.94 1.14 174.20 9.75 -4.50 +4WFF_A 162 V 0.64 0.42 -1.86 0.75 0.93 1.17 117.15 5.49 4.20 +4WFF_A 163 L 0.63 0.57 -1.14 0.75 0.93 1.11 131.17 5.52 3.80 +4WFF_A 164 S 0.62 0.24 -1.93 0.76 0.92 1.09 105.09 5.24 -0.80 +4WFF_A 165 A 0.61 0.28 -3.84 0.71 0.91 1.13 89.09 5.57 1.80 +4WFF_A 166 M 0.57 0.28 -4.63 0.72 0.90 1.11 149.21 5.28 1.90 +4WFF_A 167 L 0.57 0.17 -4.63 0.72 0.90 1.11 131.17 5.52 3.80 +4WFF_A 168 F 0.55 0.12 -6.70 0.59 0.90 1.13 165.19 5.52 2.80 +4WFF_A 169 L 0.52 0.12 -6.19 0.71 0.91 1.10 131.17 5.52 3.80 +4WFF_A 170 L 0.51 0.08 -5.39 0.80 0.91 1.18 131.17 5.52 3.80 +4WFF_A 171 I 0.49 0.07 -5.39 0.80 0.91 1.18 131.17 5.52 4.50 +4WFF_A 172 G 0.48 0.07 -5.39 0.80 0.91 1.21 75.07 5.52 -0.40 +4WFF_A 173 C 0.45 0.08 -5.39 0.80 0.91 1.18 121.15 5.52 2.50 +4WFF_A 174 L 0.41 0.08 -4.60 0.79 0.91 1.20 131.17 5.52 3.80 +4WFF_A 175 L 0.39 0.07 -4.77 0.80 0.92 1.22 131.17 5.52 3.80 +4WFF_A 176 F 0.35 0.18 -4.84 0.72 0.93 1.22 165.19 5.52 2.80 +4WFF_A 177 V 0.33 0.34 -4.74 0.76 0.95 1.17 117.15 5.49 4.20 +4WFF_A 178 L 0.32 0.60 -2.69 0.82 0.98 1.12 131.17 5.52 3.80 +4WFF_A 179 T 0.30 0.60 -2.69 0.82 1.00 1.10 119.12 5.19 -0.70 +4WFF_A 180 P 0.29 0.60 -1.90 0.80 1.01 1.14 115.13 5.96 -1.60 +4WFF_A 181 T 0.29 0.63 -2.69 0.82 0.99 1.10 119.12 5.19 -0.70 +4WFF_A 182 F 0.31 0.23 -1.17 0.90 0.97 1.12 165.19 5.52 2.80 +4WFF_A 183 V 0.34 0.24 -2.19 0.93 0.94 1.16 117.15 5.49 4.20 +4WFF_A 184 F 0.39 0.16 -3.09 0.80 0.91 1.12 165.19 5.52 2.80 +4WFF_A 185 C 0.43 0.33 -2.71 0.77 0.90 1.12 121.15 5.52 2.50 +4WFF_A 186 Y 0.46 0.73 0.03 0.89 0.91 1.08 181.19 5.52 -1.30 +4WFF_A 187 M 0.48 0.89 -0.87 0.96 0.93 1.01 149.21 5.28 1.90 +4WFF_A 188 E 0.50 2.22 1.37 1.07 0.97 1.00 147.13 4.00 -3.50 +4WFF_A 189 D 0.50 2.84 1.99 1.05 1.00 0.93 133.10 3.80 -3.50 +4WFF_A 190 W 0.51 2.36 0.94 0.97 1.01 0.95 204.23 5.52 -0.90 +4WFF_A 191 S 0.49 2.36 2.66 0.99 1.02 0.95 105.09 5.24 -0.80 +4WFF_A 192 K 0.48 1.43 1.84 0.98 1.01 0.98 146.19 8.75 -3.90 +4WFF_A 193 L 0.43 0.95 -0.73 0.84 0.98 1.02 131.17 5.52 3.80 +4WFF_A 194 E 0.39 1.12 0.43 0.86 0.95 1.06 147.13 4.00 -3.50 +4WFF_A 195 A 0.36 0.48 -1.81 0.74 0.93 1.07 89.09 5.57 1.80 +4WFF_A 196 I 0.33 0.43 -3.16 0.67 0.90 1.14 131.17 5.52 4.50 +4WFF_A 197 Y 0.30 0.19 -2.37 0.66 0.89 1.15 181.19 5.52 -1.30 +4WFF_A 198 F 0.28 0.27 -2.74 0.69 0.90 1.16 165.19 5.52 2.80 +4WFF_A 199 V 0.25 0.31 -4.36 0.68 0.91 1.19 117.15 5.49 4.20 +4WFF_A 200 V 0.26 0.29 -2.47 0.75 0.93 1.16 117.15 5.49 4.20 +4WFF_A 201 T 0.26 0.48 -1.46 0.72 0.96 1.12 119.12 5.19 -0.70 +4WFF_A 202 L 0.27 0.48 -0.67 0.71 0.98 1.16 131.17 5.52 3.80 +4WFF_A 203 T 0.30 0.64 0.67 0.86 1.00 1.09 119.12 5.19 -0.70 +4WFF_A 204 T 0.33 0.38 -0.11 0.88 1.00 1.05 119.12 5.19 -0.70 +4WFF_A 205 V 0.37 0.46 -0.04 0.96 0.99 1.04 117.15 5.49 4.20 +4WFF_A 206 G 0.40 0.53 2.70 1.09 0.98 0.99 75.07 5.52 -0.40 +4WFF_A 207 F 0.43 0.58 1.69 1.11 0.98 1.02 165.19 5.52 2.80 +4WFF_A 208 G 0.46 0.58 0.41 1.05 0.99 1.09 75.07 5.52 -0.40 +4WFF_A 209 D 0.48 0.59 1.24 1.07 0.99 1.04 133.10 3.80 -3.50 +4WFF_A 210 Y 0.50 0.68 1.24 1.07 0.97 1.04 181.19 5.52 -1.30 +4WFF_A 211 V 0.52 0.69 2.86 1.08 0.96 1.04 117.15 5.49 4.20 +4WFF_A 212 A 0.55 0.69 3.47 1.06 0.96 1.04 89.09 5.57 1.80 +4WFF_A 213 G 0.57 0.68 2.34 1.07 0.98 1.07 75.07 5.52 -0.40 +4WFF_A 214 A 0.59 1.80 3.21 1.04 1.01 1.03 89.09 5.57 1.80 +4WFF_A 215 D 0.61 3.08 4.60 1.11 1.04 0.97 133.10 3.80 -3.50 +4WFF_A 216 P 0.61 5.20 5.73 1.23 1.06 0.95 115.13 5.96 -1.60 +4WFF_A 217 R 0.63 6.90 5.84 1.21 1.08 0.97 174.20 9.75 -4.50 +4WFF_A 218 Q 0.64 6.39 5.84 1.33 1.09 0.97 146.15 5.52 -3.50 +4WFF_A 219 D 0.63 4.17 4.71 1.22 1.09 0.99 133.10 3.80 -3.50 +4WFF_A 220 S 0.62 3.34 4.14 1.16 1.08 1.01 105.09 5.24 -0.80 +4WFF_A 221 P 0.60 3.34 4.40 1.17 1.05 1.03 115.13 5.96 -1.60 +4WFF_A 222 A 0.57 3.09 3.84 1.24 1.02 1.04 89.09 5.57 1.80 +4WFF_A 223 Y 0.53 1.90 1.10 1.12 1.01 1.09 181.19 5.52 -1.30 +4WFF_A 224 Q 0.50 0.91 -0.36 0.99 1.00 1.14 146.15 5.52 -3.50 +4WFF_A 225 P 0.47 0.95 -2.09 0.91 0.98 1.12 115.13 5.96 -1.60 +4WFF_A 226 L 0.44 0.53 -3.70 0.90 0.96 1.12 131.17 5.52 3.80 +4WFF_A 227 V 0.40 0.32 -4.86 0.87 0.92 1.08 117.15 5.49 4.20 +4WFF_A 228 W 0.37 0.14 -6.86 0.80 0.89 1.10 204.23 5.52 -0.90 +4WFF_A 229 F 0.34 0.14 -8.47 0.67 0.87 1.13 165.19 5.52 2.80 +4WFF_A 230 W 0.32 0.16 -8.47 0.67 0.87 1.13 204.23 5.52 -0.90 +4WFF_A 231 I 0.30 0.15 -7.13 0.82 0.88 1.06 131.17 5.52 4.50 +4WFF_A 232 L 0.30 0.14 -7.01 0.77 0.91 1.11 131.17 5.52 3.80 +4WFF_A 233 L 0.31 0.14 -5.40 0.77 0.92 1.10 131.17 5.52 3.80 +4WFF_A 234 G 0.31 0.31 -4.24 0.80 0.92 1.14 75.07 5.52 -0.40 +4WFF_A 235 L 0.30 0.32 -4.41 0.82 0.92 1.13 131.17 5.52 3.80 +4WFF_A 236 A 0.31 0.40 -2.80 0.83 0.91 1.11 89.09 5.57 1.80 +4WFF_A 237 Y 0.31 0.54 -0.56 0.95 0.90 1.07 181.19 5.52 -1.30 +4WFF_A 238 F 0.33 0.48 -1.90 0.80 0.91 1.15 165.19 5.52 2.80 +4WFF_A 239 A 0.35 0.40 -1.90 0.80 0.92 1.15 89.09 5.57 1.80 +4WFF_A 240 S 0.37 0.36 -1.46 0.84 0.93 1.12 105.09 5.24 -0.80 +4WFF_A 241 V 0.36 0.61 -0.44 0.81 0.96 1.09 117.15 5.49 4.20 +4WFF_A 242 L 0.34 0.42 -0.27 0.80 0.98 1.10 131.17 5.52 3.80 +4WFF_A 243 T 0.37 0.31 0.24 0.92 1.00 1.07 119.12 5.19 -0.70 +4WFF_A 244 T 0.40 0.67 0.31 0.94 1.02 1.04 119.12 5.19 -0.70 +4WFF_A 245 I 0.40 0.86 -0.59 1.01 1.02 0.97 131.17 5.52 4.50 +4WFF_A 246 G 0.42 0.49 -0.59 1.01 1.01 0.97 75.07 5.52 -0.40 +4WFF_A 247 N 0.43 0.67 -0.73 1.01 0.99 0.96 132.12 5.52 -3.50 +4WFF_A 248 W 0.43 0.71 -2.00 0.94 0.96 1.03 204.23 5.52 -0.90 +4WFF_A 249 L 0.37 0.53 -1.39 0.95 0.00 1.06 131.17 5.52 3.80 +4WFF_A 250 R 0.34 0.00 0.00 0.00 0.00 0.00 174.20 9.75 -4.50 +4WFF_A 251 V 0.30 0.00 0.00 0.00 0.00 0.00 117.15 5.49 4.20 +4WFF_A 252 V 0.25 0.00 0.00 0.00 0.00 0.00 117.15 5.49 4.20 +5C0N_A 1 C 0.25 0.00 0.00 0.00 0.00 0.00 121.15 5.52 2.50 +5C0N_A 2 D 0.31 0.00 0.00 0.00 0.00 0.00 133.10 3.80 -3.50 +5C0N_A 3 A 0.35 0.12 0.00 0.00 0.00 0.00 89.09 5.57 1.80 +5C0N_A 4 F 0.42 0.32 1.64 0.99 0.95 1.09 165.19 5.52 2.80 +5C0N_A 5 V 0.47 0.20 0.01 0.96 0.96 1.01 117.15 5.49 4.20 +5C0N_A 6 G 0.48 0.40 -0.60 0.89 0.99 1.02 75.07 5.52 -0.40 +5C0N_A 7 T 0.49 0.38 -2.21 0.88 1.00 1.05 119.12 5.19 -0.70 +5C0N_A 8 W 0.51 0.38 -1.43 0.87 0.99 1.09 204.23 5.52 -0.90 +5C0N_A 9 K 0.52 0.52 0.03 1.00 1.00 1.04 146.19 8.75 -3.90 +5C0N_A 10 L 0.52 0.48 0.14 0.98 1.00 1.06 131.17 5.52 3.80 +5C0N_A 11 V 0.54 0.79 0.51 0.95 1.01 1.05 117.15 5.49 4.20 +5C0N_A 12 S 0.55 0.64 2.94 1.04 1.04 1.03 105.09 5.24 -0.80 +5C0N_A 13 S 0.56 0.67 0.81 0.98 1.05 1.05 105.09 5.24 -0.80 +5C0N_A 14 E 0.56 1.51 3.56 1.10 1.05 1.00 147.13 4.00 -3.50 +5C0N_A 15 N 0.57 1.88 5.51 1.24 1.05 0.92 132.12 5.52 -3.50 +5C0N_A 16 F 0.56 2.20 4.31 1.20 1.03 0.95 165.19 5.52 2.80 +5C0N_A 17 D 0.55 1.26 2.79 1.08 1.02 0.92 133.10 3.80 -3.50 +5C0N_A 18 D 0.55 1.56 2.49 1.12 1.01 0.93 133.10 3.80 -3.50 +5C0N_A 19 Y 0.54 3.13 2.60 1.00 0.99 0.94 181.19 5.52 -1.30 +5C0N_A 20 M 0.54 1.39 3.39 0.99 0.99 0.98 149.21 5.28 1.90 +5C0N_A 21 K 0.53 0.82 2.77 1.00 0.99 0.98 146.19 8.75 -3.90 +5C0N_A 22 E 0.53 0.39 0.81 0.86 0.99 1.06 147.13 4.00 -3.50 +5C0N_A 23 V 0.53 0.39 1.90 0.92 0.98 1.02 117.15 5.49 4.20 +5C0N_A 24 G 0.53 0.17 1.19 0.92 0.97 1.06 75.07 5.52 -0.40 +5C0N_A 25 V 0.54 0.10 0.67 0.87 0.95 1.07 117.15 5.49 4.20 +5C0N_A 26 G 0.54 0.19 0.30 0.91 0.95 1.08 75.07 5.52 -0.40 +5C0N_A 27 F 0.54 0.38 1.43 0.97 0.96 1.01 165.19 5.52 2.80 +5C0N_A 28 A 0.53 1.02 1.43 0.89 0.98 1.02 89.09 5.57 1.80 +5C0N_A 29 T 0.51 0.77 1.43 0.89 1.00 1.02 119.12 5.19 -0.70 +5C0N_A 30 R 0.52 0.89 0.91 0.76 1.01 1.04 174.20 9.75 -4.50 +5C0N_A 31 K 0.51 0.88 3.04 0.90 1.01 1.01 146.19 8.75 -3.90 +5C0N_A 32 V 0.50 0.60 2.14 0.89 0.98 0.98 117.15 5.49 4.20 +5C0N_A 33 A 0.50 0.31 1.70 0.85 0.95 1.00 89.09 5.57 1.80 +5C0N_A 34 G 0.50 0.31 1.91 0.86 0.94 1.01 75.07 5.52 -0.40 +5C0N_A 35 M 0.49 0.65 1.40 0.93 0.94 1.03 149.21 5.28 1.90 +5C0N_A 36 A 0.47 1.03 2.93 1.08 0.97 0.94 89.09 5.57 1.80 +5C0N_A 37 K 0.46 1.03 2.03 1.07 0.99 0.91 146.19 8.75 -3.90 +5C0N_A 38 P 0.45 0.73 0.07 0.92 0.99 0.95 115.13 5.96 -1.60 +5C0N_A 39 N 0.44 0.50 -0.47 0.90 0.97 0.99 132.12 5.52 -3.50 +5C0N_A 40 M 0.43 0.34 0.16 1.01 0.94 0.99 149.21 5.28 1.90 +5C0N_A 41 I 0.44 0.16 -1.19 0.94 0.92 1.05 131.17 5.52 4.50 +5C0N_A 42 I 0.43 0.16 -0.49 0.94 0.92 1.01 131.17 5.52 4.50 +5C0N_A 43 S 0.44 0.16 -0.67 0.94 0.94 1.02 105.09 5.24 -0.80 +5C0N_A 44 V 0.45 0.39 1.36 1.06 0.98 1.03 117.15 5.49 4.20 +5C0N_A 45 N 0.46 0.46 1.19 1.08 1.02 1.04 132.12 5.52 -3.50 +5C0N_A 46 G 0.45 0.25 1.80 1.09 1.04 1.08 75.07 5.52 -0.40 +5C0N_A 47 D 0.46 0.49 1.61 1.02 1.03 1.06 133.10 3.80 -3.50 +5C0N_A 48 L 0.46 0.21 1.00 1.01 1.00 1.03 131.17 5.52 3.80 +5C0N_A 49 V 0.46 0.42 0.60 0.93 0.98 1.04 117.15 5.49 4.20 +5C0N_A 50 T 0.45 0.34 0.71 0.91 0.98 1.06 119.12 5.19 -0.70 +5C0N_A 51 I 0.45 0.71 0.40 0.81 1.01 1.06 131.17 5.52 4.50 +5C0N_A 52 R 0.44 1.29 2.64 0.93 1.05 1.03 174.20 9.75 -4.50 +5C0N_A 53 S 0.45 1.29 3.91 0.99 1.09 0.96 105.09 5.24 -0.80 +5C0N_A 54 E 0.47 1.59 1.86 0.94 1.09 0.99 147.13 4.00 -3.50 +5C0N_A 55 S 0.48 1.62 3.81 1.02 1.09 0.95 105.09 5.24 -0.80 +5C0N_A 56 T 0.50 1.95 4.21 1.10 1.07 0.94 119.12 5.19 -0.70 +5C0N_A 57 F 0.51 1.62 4.03 1.04 1.05 0.93 165.19 5.52 2.80 +5C0N_A 58 K 0.51 2.10 4.03 1.04 1.06 0.93 146.19 8.75 -3.90 +5C0N_A 59 N 0.50 1.02 1.96 0.90 1.06 0.95 132.12 5.52 -3.50 +5C0N_A 60 T 0.49 1.58 2.14 0.97 1.05 0.96 119.12 5.19 -0.70 +5C0N_A 61 E 0.48 0.68 2.14 0.97 1.03 0.96 147.13 4.00 -3.50 +5C0N_A 62 I 0.48 0.85 2.14 0.97 1.00 0.96 131.17 5.52 4.50 +5C0N_A 63 S 0.47 0.49 -0.17 0.83 0.98 1.03 105.09 5.24 -0.80 +5C0N_A 64 F 0.46 0.28 -0.10 0.91 0.97 1.02 165.19 5.52 2.80 +5C0N_A 65 K 0.47 0.29 -1.74 0.88 0.97 1.10 146.19 8.75 -3.90 +5C0N_A 66 L 0.47 0.38 0.51 0.92 0.97 1.06 131.17 5.52 3.80 +5C0N_A 67 G 0.48 0.38 -1.73 0.80 0.96 1.07 75.07 5.52 -0.40 +5C0N_A 68 V 0.49 0.32 1.01 0.92 0.96 1.04 117.15 5.49 4.20 +5C0N_A 69 E 0.52 0.67 1.31 0.88 0.97 1.02 147.13 4.00 -3.50 +5C0N_A 70 F 0.53 0.47 1.49 0.87 0.98 1.01 165.19 5.52 2.80 +5C0N_A 71 D 0.53 0.92 1.41 0.78 1.00 1.01 133.10 3.80 -3.50 +5C0N_A 72 E 0.54 0.53 2.24 0.80 1.01 0.97 147.13 4.00 -3.50 +5C0N_A 73 I 0.55 1.03 2.56 0.91 1.01 0.97 131.17 5.52 4.50 +5C0N_A 74 T 0.56 1.03 5.30 1.03 1.01 0.94 119.12 5.19 -0.70 +5C0N_A 75 A 0.56 1.17 4.47 0.96 1.02 0.94 89.09 5.57 1.80 +5C0N_A 76 D 0.55 3.33 4.17 1.00 1.04 0.95 133.10 3.80 -3.50 +5C0N_A 77 D 0.53 1.71 4.79 1.00 1.04 0.98 133.10 3.80 -3.50 +5C0N_A 78 R 0.51 3.39 4.86 1.01 1.05 0.99 174.20 9.75 -4.50 +5C0N_A 79 K 0.49 2.72 5.49 1.12 1.05 0.98 146.19 8.75 -3.90 +5C0N_A 80 V 0.46 1.14 2.91 0.98 1.03 1.02 117.15 5.49 4.20 +5C0N_A 81 K 0.44 0.41 0.34 0.83 1.02 1.06 146.19 8.75 -3.90 +5C0N_A 82 S 0.43 0.29 0.49 0.84 0.99 1.07 105.09 5.24 -0.80 +5C0N_A 83 I 0.41 0.33 -1.64 0.78 0.96 1.11 131.17 5.52 4.50 +5C0N_A 84 I 0.41 0.27 0.31 0.91 0.95 1.04 131.17 5.52 4.50 +5C0N_A 85 T 0.42 0.20 0.31 0.99 0.97 1.03 119.12 5.19 -0.70 +5C0N_A 86 L 0.42 0.28 0.20 1.01 1.00 1.01 131.17 5.52 3.80 +5C0N_A 87 D 0.42 0.41 1.64 1.04 1.03 1.00 133.10 3.80 -3.50 +5C0N_A 88 G 0.43 0.23 1.47 1.05 1.04 1.01 75.07 5.52 -0.40 +5C0N_A 89 G 0.46 0.21 0.20 0.99 1.02 1.08 75.07 5.52 -0.40 +5C0N_A 90 A 0.46 0.22 2.37 1.04 0.99 1.05 89.09 5.57 1.80 +5C0N_A 91 L 0.47 0.16 0.41 0.91 0.96 1.12 131.17 5.52 3.80 +5C0N_A 92 V 0.48 0.29 0.46 0.82 0.94 1.14 117.15 5.49 4.20 +5C0N_A 93 Q 0.50 0.57 0.46 0.75 0.95 1.15 146.15 5.52 -3.50 +5C0N_A 94 V 0.50 0.73 -1.27 0.79 0.97 1.12 117.15 5.49 4.20 +5C0N_A 95 Q 0.52 1.63 1.47 0.91 1.00 1.07 146.15 5.52 -3.50 +5C0N_A 96 K 0.53 0.93 2.81 1.06 1.02 1.00 146.19 8.75 -3.90 +5C0N_A 97 W 0.54 2.51 2.77 1.07 1.04 0.98 204.23 5.52 -0.90 +5C0N_A 98 D 0.54 1.94 4.23 1.20 1.07 0.93 133.10 3.80 -3.50 +5C0N_A 99 G 0.55 1.40 4.11 1.20 1.09 0.92 75.07 5.52 -0.40 +5C0N_A 100 K 0.54 1.93 4.04 1.19 1.10 0.91 146.19 8.75 -3.90 +5C0N_A 101 S 0.54 0.81 4.33 1.12 1.10 0.95 105.09 5.24 -0.80 +5C0N_A 102 T 0.54 1.63 3.71 1.06 1.09 0.96 119.12 5.19 -0.70 +5C0N_A 103 T 0.53 1.60 3.50 0.97 1.07 0.96 119.12 5.19 -0.70 +5C0N_A 104 I 0.52 2.39 3.50 0.97 1.06 0.96 131.17 5.52 4.50 +5C0N_A 105 K 0.51 3.24 3.17 0.90 1.05 0.94 146.19 8.75 -3.90 +5C0N_A 106 R 0.51 3.75 3.86 0.97 1.05 0.93 174.20 9.75 -4.50 +5C0N_A 107 K 0.51 5.29 3.93 1.06 1.06 0.93 146.19 8.75 -3.90 +5C0N_A 108 R 0.51 4.42 6.50 1.20 1.06 0.89 174.20 9.75 -4.50 +5C0N_A 109 D 0.50 4.51 6.50 1.20 1.07 0.89 133.10 3.80 -3.50 +5C0N_A 110 G 0.49 1.86 4.59 1.15 1.07 0.94 75.07 5.52 -0.40 +5C0N_A 111 D 0.47 0.71 3.24 1.08 1.05 1.01 133.10 3.80 -3.50 +5C0N_A 112 K 0.45 0.31 2.11 1.01 1.02 1.08 146.19 8.75 -3.90 +5C0N_A 113 L 0.43 0.55 1.80 0.91 0.99 1.08 131.17 5.52 3.80 +5C0N_A 114 V 0.43 0.18 1.19 0.86 0.95 1.15 117.15 5.49 4.20 +5C0N_A 115 V 0.42 0.07 -0.77 0.72 0.93 1.23 117.15 5.49 4.20 +5C0N_A 116 E 0.42 0.08 -2.19 0.66 0.91 1.21 147.13 4.00 -3.50 +5C0N_A 117 C 0.40 0.21 -0.06 0.72 0.91 1.17 121.15 5.52 2.50 +5C0N_A 118 V 0.40 0.28 1.29 0.87 0.93 1.09 117.15 5.49 4.20 +5C0N_A 119 M 0.40 0.12 1.29 0.87 0.95 1.09 149.21 5.28 1.90 +5C0N_A 120 K 0.42 0.33 0.91 0.90 0.98 1.10 146.19 8.75 -3.90 +5C0N_A 121 G 0.42 0.59 1.64 0.94 1.02 1.05 75.07 5.52 -0.40 +5C0N_A 122 V 0.45 0.86 2.91 1.00 1.04 0.98 117.15 5.49 4.20 +5C0N_A 123 T 0.44 0.84 4.11 1.05 1.06 0.98 119.12 5.19 -0.70 +5C0N_A 124 S 0.44 0.63 2.77 0.98 1.06 1.05 105.09 5.24 -0.80 +5C0N_A 125 T 0.44 1.33 1.69 0.92 1.05 1.09 119.12 5.19 -0.70 +5C0N_A 126 R 0.45 1.59 3.33 0.95 1.02 1.01 174.20 9.75 -4.50 +5C0N_A 127 V 0.46 2.33 3.19 0.95 1.00 1.01 117.15 5.49 4.20 +5C0N_A 128 Y 0.41 1.63 2.56 0.84 0.00 1.02 181.19 5.52 -1.30 +5C0N_A 129 E 0.36 0.00 0.00 0.00 0.00 0.00 147.13 4.00 -3.50 +5C0N_A 130 R 0.31 0.00 0.00 0.00 0.00 0.00 174.20 9.75 -4.50 +5C0N_A 131 A 0.26 0.00 0.00 0.00 0.00 0.00 89.09 5.57 1.80 +4Z5R_A 1 L 0.26 0.00 0.00 0.00 0.00 0.00 131.17 5.52 3.80 +4Z5R_A 2 G 0.32 0.00 0.00 0.00 0.00 0.00 75.07 5.52 -0.40 +4Z5R_A 3 S 0.37 1.28 0.00 0.00 0.00 0.00 105.09 5.24 -0.80 +4Z5R_A 4 R 0.43 1.28 1.06 1.00 1.06 1.01 174.20 9.75 -4.50 +4Z5R_A 5 R 0.48 1.28 1.77 1.01 1.03 0.95 174.20 9.75 -4.50 +4Z5R_A 6 T 0.47 0.79 -0.36 0.87 1.00 1.00 119.12 5.19 -0.70 +4Z5R_A 7 L 0.48 0.33 -2.60 0.75 0.96 1.03 131.17 5.52 3.80 +4Z5R_A 8 M 0.48 0.17 -2.90 0.71 0.92 1.06 149.21 5.28 1.90 +4Z5R_A 9 L 0.45 0.21 -2.64 0.71 0.91 1.08 131.17 5.52 3.80 +4Z5R_A 10 L 0.47 0.25 -3.99 0.66 0.91 1.07 131.17 5.52 3.80 +4Z5R_A 11 A 0.48 0.49 -2.07 0.71 0.92 1.01 89.09 5.57 1.80 +4Z5R_A 12 Q 0.50 1.18 -0.66 0.77 0.94 1.03 146.15 5.52 -3.50 +4Z5R_A 13 M 0.51 1.01 -0.49 0.75 0.97 1.02 149.21 5.28 1.90 +4Z5R_A 14 R 0.52 1.33 1.76 0.87 0.99 0.98 174.20 9.75 -4.50 +4Z5R_A 15 K 0.56 0.64 0.14 0.86 1.00 1.01 146.19 8.75 -3.90 +4Z5R_A 16 I 0.57 0.56 -2.03 0.81 0.99 1.02 131.17 5.52 4.50 +4Z5R_A 17 S 0.57 0.38 -0.50 0.93 0.97 1.05 105.09 5.24 -0.80 +4Z5R_A 18 L 0.60 0.10 -0.90 0.96 0.95 1.12 131.17 5.52 3.80 +4Z5R_A 19 F 0.59 0.12 -3.03 0.90 0.93 1.17 165.19 5.52 2.80 +4Z5R_A 20 S 0.58 0.18 -1.07 0.98 0.93 1.14 105.09 5.24 -0.80 +4Z5R_A 21 C 0.58 0.36 -0.57 0.98 0.95 1.12 121.15 5.52 2.50 +4Z5R_A 22 L 0.58 0.82 1.34 1.03 0.97 1.06 131.17 5.52 3.80 +4Z5R_A 23 K 0.58 0.83 2.96 1.08 1.00 1.06 146.19 8.75 -3.90 +4Z5R_A 24 D 0.57 2.59 3.46 1.09 1.01 1.04 133.10 3.80 -3.50 +4Z5R_A 25 R 0.58 2.72 1.94 1.00 1.00 1.00 174.20 9.75 -4.50 +4Z5R_A 26 H 0.58 1.35 4.07 1.14 0.98 0.94 155.16 6.74 -3.20 +4Z5R_A 27 D 0.57 0.70 1.94 1.08 0.96 0.97 133.10 3.80 -3.50 +4Z5R_A 28 F 0.56 0.55 0.81 1.09 0.95 0.99 165.19 5.52 2.80 +4Z5R_A 29 G 0.56 0.70 1.07 1.10 0.97 1.02 75.07 5.52 -0.40 +4Z5R_A 30 F 0.55 0.73 1.89 1.07 1.00 0.98 165.19 5.52 2.80 +4Z5R_A 31 P 0.54 1.46 1.57 0.96 1.04 0.98 115.13 5.96 -1.60 +4Z5R_A 32 Q 0.55 1.27 1.57 0.96 1.06 0.98 146.15 5.52 -3.50 +4Z5R_A 33 E 0.56 1.46 1.57 0.96 1.06 0.98 147.13 4.00 -3.50 +4Z5R_A 34 E 0.56 1.52 3.89 1.10 1.05 0.93 147.13 4.00 -3.50 +4Z5R_A 35 F 0.58 1.52 4.44 1.02 1.04 0.92 165.19 5.52 2.80 +4Z5R_A 36 G 0.60 0.76 2.27 0.97 1.03 0.94 75.07 5.52 -0.40 +4Z5R_A 37 N 0.60 0.76 2.01 1.00 1.03 0.96 132.12 5.52 -3.50 +4Z5R_A 38 Q 0.59 1.75 1.71 1.04 1.03 0.97 146.15 5.52 -3.50 +4Z5R_A 39 F 0.59 1.79 3.33 1.05 1.02 0.97 165.19 5.52 2.80 +4Z5R_A 40 Q 0.58 1.92 3.63 0.93 1.03 0.96 146.15 5.52 -3.50 +4Z5R_A 41 K 0.54 1.60 3.37 0.85 1.03 0.98 146.19 8.75 -3.90 +4Z5R_A 42 A 0.53 1.30 1.37 0.77 1.04 1.00 89.09 5.57 1.80 +4Z5R_A 43 E 0.49 1.16 2.99 0.91 1.03 1.00 147.13 4.00 -3.50 +4Z5R_A 44 T 0.44 0.43 1.60 0.84 1.02 1.05 119.12 5.19 -0.70 +4Z5R_A 45 I 0.41 0.35 -0.53 0.78 0.99 1.10 131.17 5.52 4.50 +4Z5R_A 46 P 0.39 0.28 -0.53 0.82 0.97 1.10 115.13 5.96 -1.60 +4Z5R_A 47 V 0.36 0.33 -0.53 0.82 0.95 1.10 117.15 5.49 4.20 +4Z5R_A 48 L 0.34 0.47 -1.87 0.77 0.93 1.09 131.17 5.52 3.80 +4Z5R_A 49 H 0.34 0.21 -1.87 0.77 0.92 1.09 155.16 6.74 -3.20 +4Z5R_A 50 E 0.35 0.49 -1.31 0.69 0.92 1.08 147.13 4.00 -3.50 +4Z5R_A 51 M 0.34 1.04 0.07 0.76 0.93 1.03 149.21 5.28 1.90 +4Z5R_A 52 I 0.36 0.53 0.24 0.74 0.94 1.02 131.17 5.52 4.50 +4Z5R_A 53 Q 0.39 0.27 -1.37 0.69 0.95 1.01 146.15 5.52 -3.50 +4Z5R_A 54 Q 0.38 0.43 -1.49 0.81 0.95 1.00 146.15 5.52 -3.50 +4Z5R_A 55 I 0.39 0.51 -2.20 0.81 0.95 1.06 131.17 5.52 4.50 +4Z5R_A 56 F 0.42 0.26 -2.37 0.83 0.94 1.06 165.19 5.52 2.80 +4Z5R_A 57 N 0.45 0.20 -2.30 0.89 0.94 1.06 132.12 5.52 -3.50 +4Z5R_A 58 L 0.47 0.41 -2.41 0.89 0.95 1.04 131.17 5.52 3.80 +4Z5R_A 59 F 0.50 0.94 -0.46 0.96 0.98 1.01 165.19 5.52 2.80 +4Z5R_A 60 S 0.55 0.98 2.29 1.09 1.01 0.98 105.09 5.24 -0.80 +4Z5R_A 61 T 0.58 1.59 2.21 1.07 1.05 1.01 119.12 5.19 -0.70 +4Z5R_A 62 K 0.59 2.46 4.46 1.19 1.07 0.98 146.19 8.75 -3.90 +4Z5R_A 63 D 0.62 1.85 6.07 1.20 1.07 0.97 133.10 3.80 -3.50 +4Z5R_A 64 S 0.64 1.30 5.44 1.09 1.06 0.98 105.09 5.24 -0.80 +4Z5R_A 65 S 0.64 0.68 3.27 1.09 1.02 0.98 105.09 5.24 -0.80 +4Z5R_A 66 A 0.64 0.68 3.89 1.15 0.99 0.97 89.09 5.57 1.80 +4Z5R_A 67 A 0.63 0.88 3.57 1.05 0.98 0.97 89.09 5.57 1.80 +4Z5R_A 68 W 0.60 0.95 3.39 0.98 0.99 0.95 204.23 5.52 -0.90 +4Z5R_A 69 D 0.56 0.77 1.14 0.86 1.01 0.99 133.10 3.80 -3.50 +4Z5R_A 70 E 0.54 0.63 -0.47 0.85 1.03 1.01 147.13 4.00 -3.50 +4Z5R_A 71 T 0.53 1.00 0.66 0.97 1.03 0.98 119.12 5.19 -0.70 +4Z5R_A 72 L 0.49 1.20 2.90 0.97 1.03 0.99 131.17 5.52 3.80 +4Z5R_A 73 L 0.48 0.60 0.16 0.85 1.02 1.02 131.17 5.52 3.80 +4Z5R_A 74 D 0.47 0.65 -1.23 0.91 1.01 1.07 133.10 3.80 -3.50 +4Z5R_A 75 K 0.45 1.14 -1.23 0.91 1.01 1.07 146.19 8.75 -3.90 +4Z5R_A 76 F 0.42 2.40 1.20 0.93 1.00 1.01 165.19 5.52 2.80 +4Z5R_A 77 Y 0.43 1.18 1.20 0.93 0.99 1.01 181.19 5.52 -1.30 +4Z5R_A 78 T 0.44 0.93 -0.50 0.88 0.99 1.05 119.12 5.19 -0.70 +4Z5R_A 79 E 0.45 1.85 -0.46 0.88 0.99 1.06 147.13 4.00 -3.50 +4Z5R_A 80 L 0.43 2.05 1.71 0.93 0.99 1.05 131.17 5.52 3.80 +4Z5R_A 81 Y 0.46 1.17 0.67 0.85 0.99 1.06 181.19 5.52 -1.30 +4Z5R_A 82 Q 0.46 1.09 0.93 0.94 0.99 1.05 146.15 5.52 -3.50 +4Z5R_A 83 Q 0.45 2.20 1.24 1.04 1.00 1.05 146.15 5.52 -3.50 +4Z5R_A 84 L 0.48 1.16 1.24 1.04 1.01 1.05 131.17 5.52 3.80 +4Z5R_A 85 N 0.50 1.16 2.63 0.99 1.01 1.00 132.12 5.52 -3.50 +4Z5R_A 86 D 0.47 0.68 2.07 0.94 1.00 1.01 133.10 3.80 -3.50 +4Z5R_A 87 L 0.47 0.44 1.41 0.97 0.98 1.07 131.17 5.52 3.80 +4Z5R_A 88 E 0.47 0.20 2.20 0.96 0.96 1.09 147.13 4.00 -3.50 +4Z5R_A 89 A 0.49 0.09 0.06 0.80 0.94 1.14 89.09 5.57 1.80 +4Z5R_A 90 C 0.48 0.18 -0.51 0.73 0.93 1.16 121.15 5.52 2.50 +4Z5R_A 91 V 0.50 0.10 1.61 0.87 0.94 1.11 117.15 5.49 4.20 +4Z5R_A 92 I 0.52 0.10 -0.10 0.85 0.95 1.10 131.17 5.52 4.50 +4Z5R_A 93 Q 0.51 0.37 0.41 0.90 0.98 1.08 146.15 5.52 -3.50 +4Z5R_A 94 G 0.52 0.87 1.33 0.84 1.00 1.00 75.07 5.52 -0.40 +4Z5R_A 95 M 0.54 2.08 3.29 0.97 1.02 0.93 149.21 5.28 1.90 +4Z5R_A 96 K 0.55 1.61 5.36 1.11 1.04 0.91 146.19 8.75 -3.90 +4Z5R_A 97 E 0.56 1.14 3.36 1.04 1.04 0.93 147.13 4.00 -3.50 +4Z5R_A 98 D 0.55 0.95 1.23 0.90 1.02 0.98 133.10 3.80 -3.50 +4Z5R_A 99 S 0.53 0.48 2.13 0.91 1.00 1.02 105.09 5.24 -0.80 +4Z5R_A 100 I 0.52 0.21 0.79 0.84 0.96 1.08 131.17 5.52 4.50 +4Z5R_A 101 L 0.52 0.24 0.27 0.87 0.94 1.09 131.17 5.52 3.80 +4Z5R_A 102 A 0.52 0.36 -0.34 0.80 0.94 1.09 89.09 5.57 1.80 +4Z5R_A 103 V 0.50 0.80 -1.54 0.76 0.96 1.12 117.15 5.49 4.20 +4Z5R_A 104 R 0.50 0.84 -1.71 0.78 0.98 1.11 174.20 9.75 -4.50 +4Z5R_A 105 K 0.51 1.45 0.46 0.83 0.99 1.07 146.19 8.75 -3.90 +4Z5R_A 106 Y 0.48 3.82 0.76 0.88 0.99 1.05 181.19 5.52 -1.30 +4Z5R_A 107 F 0.48 1.37 0.14 0.87 0.99 1.01 165.19 5.52 2.80 +4Z5R_A 108 Q 0.51 0.99 0.29 0.87 0.99 1.02 146.15 5.52 -3.50 +4Z5R_A 109 R 0.50 0.52 -1.84 0.81 0.99 1.06 174.20 9.75 -4.50 +4Z5R_A 110 I 0.47 0.94 -1.84 0.81 0.98 1.06 131.17 5.52 4.50 +4Z5R_A 111 T 0.46 0.45 -1.84 0.81 0.96 1.09 119.12 5.19 -0.70 +4Z5R_A 112 L 0.48 0.46 -1.89 0.82 0.95 1.08 131.17 5.52 3.80 +4Z5R_A 113 Y 0.49 1.13 -1.37 0.79 0.95 1.07 181.19 5.52 -1.30 +4Z5R_A 114 L 0.48 1.56 0.59 0.86 0.98 1.04 131.17 5.52 3.80 +4Z5R_A 115 K 0.50 3.79 0.66 0.87 1.02 1.04 146.19 8.75 -3.90 +4Z5R_A 116 E 0.49 3.79 1.70 0.95 1.05 1.03 147.13 4.00 -3.50 +4Z5R_A 117 K 0.48 6.16 2.90 0.99 1.06 1.01 146.19 8.75 -3.90 +4Z5R_A 118 K 0.48 4.76 4.51 1.12 1.06 0.98 146.19 8.75 -3.90 +4Z5R_A 119 Y 0.48 1.47 3.90 1.15 1.04 1.05 181.19 5.52 -1.30 +4Z5R_A 120 S 0.48 0.74 3.09 1.14 1.01 1.08 105.09 5.24 -0.80 +4Z5R_A 121 P 0.46 0.39 0.84 1.13 0.99 1.08 115.13 5.96 -1.60 +4Z5R_A 122 C 0.44 0.43 1.14 1.09 0.95 1.07 121.15 5.52 2.50 +4Z5R_A 123 A 0.41 0.24 0.89 1.00 0.94 1.10 89.09 5.57 1.80 +4Z5R_A 124 W 0.40 0.11 -0.57 0.87 0.92 1.15 204.23 5.52 -0.90 +4Z5R_A 125 E 0.39 0.42 -0.27 0.79 0.92 1.12 147.13 4.00 -3.50 +4Z5R_A 126 V 0.38 0.42 -0.17 0.71 0.93 1.07 117.15 5.49 4.20 +4Z5R_A 127 V 0.36 0.69 0.64 0.72 0.94 1.04 117.15 5.49 4.20 +4Z5R_A 128 R 0.38 0.28 0.93 0.65 0.94 1.08 174.20 9.75 -4.50 +4Z5R_A 129 A 0.39 0.37 -0.79 0.63 0.94 1.08 89.09 5.57 1.80 +4Z5R_A 130 E 0.38 0.99 0.34 0.70 0.94 1.00 147.13 4.00 -3.50 +4Z5R_A 131 I 0.36 0.67 1.80 0.83 0.94 0.95 131.17 5.52 4.50 +4Z5R_A 132 M 0.39 0.58 -0.11 0.78 0.95 0.98 149.21 5.28 1.90 +4Z5R_A 133 R 0.40 0.45 0.51 0.89 0.96 0.97 174.20 9.75 -4.50 +4Z5R_A 134 S 0.39 0.53 -1.91 0.87 0.97 1.03 105.09 5.24 -0.80 +4Z5R_A 135 F 0.41 0.71 0.16 1.00 0.97 1.01 165.19 5.52 2.80 +4Z5R_A 136 S 0.44 0.52 1.50 1.06 0.98 1.02 105.09 5.24 -0.80 +4Z5R_A 137 L 0.42 0.63 1.90 1.14 0.99 1.01 131.17 5.52 3.80 +4Z5R_A 138 S 0.42 0.60 -0.34 1.02 1.00 1.04 105.09 5.24 -0.80 +4Z5R_A 139 T 0.44 0.78 1.83 1.08 1.02 1.03 119.12 5.19 -0.70 +4Z5R_A 140 N 0.46 1.63 2.01 0.98 1.02 1.01 132.12 5.52 -3.50 +4Z5R_A 141 L 0.44 1.63 4.26 1.10 1.02 0.97 131.17 5.52 3.80 +4Z5R_A 142 Q 0.39 0.93 2.01 0.98 0.00 1.01 146.15 5.52 -3.50 +4Z5R_A 143 E 0.36 0.00 0.00 0.00 0.00 0.00 147.13 4.00 -3.50 +4Z5R_A 144 S 0.30 0.00 0.00 0.00 0.00 0.00 105.09 5.24 -0.80 +4Z5R_A 145 L 0.24 0.00 0.00 0.00 0.00 0.00 131.17 5.52 3.80
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/online-epifinder-topology.tsv Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,19 @@ +N Id Method Threshold Avg Score Cover Epitope Start End N-Glyc N-Glyc-Count N-Glyc-Motifs Length kDa I.P Avg Hydropathy Avg Cover +1 4WFF_A BepiPred-2.0 0.60 0.64 - FLKWHVPPELVRVLSA 149 165 N 0 - 16 1.89 8.75 0.54 0.58 + Emini 0.80 0.78 0.38 ...EEEE.EE...... + Parker 0.80 -1.78 0.06 .....E.......... + Chou Fosman 0.80 0.83 0.44 ...EEEEEEE...... + Karplus Schulz 0.80 0.96 1.00 EEEEEEEEEEEEEEEE + Kolaskar 0.80 1.11 1.00 EEEEEEEEEEEEEEEE + All matches - - 0.06 .....E.......... + N-Glyc - - - ................ + Hydropathy - 0.54 - ++---+---++-++-+ +2 4WFF_B BepiPred-2.0 0.60 0.64 - AIFLKWHVPPELVRVLSAML 149 169 N 0 - 20 2.32 8.80 1.03 0.54 + Emini 0.80 0.67 0.30 .....EEEE.EE........ + Parker 0.80 -2.18 0.05 .......E............ + Chou Fosman 0.80 0.80 0.35 .....EEEEEEE........ + Karplus Schulz 0.80 0.95 1.00 EEEEEEEEEEEEEEEEEEEE + Kolaskar 0.80 1.11 1.00 EEEEEEEEEEEEEEEEEEEE + All matches - - 0.05 .......E............ + N-Glyc - - - .................... + Hydropathy - 1.03 - ++++---+---++-++-+++
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/online-epifinder.log Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,14 @@ +makeblastdb -dbtype prot -in /usr/local/bioinfo/stingrayGalaxy/tools/stingray/epifinder/test-data/proteom.fasta -out ./online-test_proteom Success: + + +Building a new DB, current time: 03/20/2021 00:12:41 +New DB name: /usr/local/bioinfo/stingrayGalaxy/tools/stingray/epifinder/online-test_proteom +New DB title: /usr/local/bioinfo/stingrayGalaxy/tools/stingray/epifinder/test-data/proteom.fasta +Sequence type: Protein +Keep Linkouts: T +Keep MBits: T +Maximum file size: 1000000000B +Adding sequences from FASTA; added 6 sequences in 0.00433183 seconds. +Error: +blastp -query ./online-epifinder-epitopes-fasta.fasta -db ./online-test_proteom -outfmt 6 qacc sacc pident qcovs qseq sseq qacc -task blastp-short -word_size 4 -out ./online-test_proteom_blast.csv Success: +Error:
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/online-epifinder.txt Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,70 @@ + +---- Running Parameters ---- +BepiPred-2.0 Threshold : 0.6 +Min epitope length : 10 +Max epitope length : 30 + +---- Softwares Threshold ---- +Emini : 0.8 +Parker : 0.8 +Chou Fosman : 0.8 +Karplus Schulz : 0.8 +Kolaskar : 0.8 + +---- Proteomes ---- +Alias File +test_proteom /usr/local/bioinfo/stingrayGalaxy/tools/stingray/epifinder/test-data/proteom.fasta + +---- Blast ---- +Identity : 90.0 +Cover : 90.0 +Word size : 4 +Task blastp-short: blastp-short + +---- Stats ---- +Processed proteins : 6 +NGlycosylated proteins : 0 +Identified epitopes : 2 +N-glycosylated epitopes: 0 + +---- Protein Summary ---- +Id Epitopes N-Glyc +4WFF_B 1 0 +5BVP_A 0 0 +4XAK_A 0 0 +4WFF_A 1 0 +5C0N_A 0 0 +4Z5R_A 0 0 + +---- Epitopes list ---- +N Id Epitope Start End N-Glyc N-Glyc-Count N-Glyc-Motifs Length MW(kDa) I.P Hydropathy All Matches Cover Avg Cover BepiPred2 Emini Parker Chou Fosman Karplus Schulz Kolaskar test_proteom_count test_proteom_acc test_proteom_count test_proteom_id +1 4WFF_A FLKWHVPPELVRVLSA 149 165 N 0 - 16 1.89 8.75 0.54 0.06 0.58 0.64 0.78 -1.78 0.83 0.96 1.11 2 4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation,4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 2 4WFF_B(100.00,100.00),4WFF_A(100.00,100.00) +2 4WFF_B AIFLKWHVPPELVRVLSAML 149 169 N 0 - 20 2.32 8.80 1.03 0.05 0.54 0.64 0.67 -2.18 0.80 0.95 1.11 2 4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation,4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation 2 4WFF_B(100.00,100.00),4WFF_A(100.00,100.00) + +---- Epitopes topology ---- +N Id Method Threshold Avg Score Cover Epitope Start End N-Glyc N-Glyc-Count N-Glyc-Motifs Length kDa I.P Avg Hydropathy Avg Cover +1 4WFF_A BepiPred-2.0 0.60 0.64 - FLKWHVPPELVRVLSA 149 165 N 0 - 16 1.89 8.75 0.54 0.58 + Emini 0.80 0.78 0.38 ...EEEE.EE...... + Parker 0.80 -1.78 0.06 .....E.......... + Chou Fosman 0.80 0.83 0.44 ...EEEEEEE...... + Karplus Schulz 0.80 0.96 1.00 EEEEEEEEEEEEEEEE + Kolaskar 0.80 1.11 1.00 EEEEEEEEEEEEEEEE + All matches - - 0.06 .....E.......... + N-Glyc - - - ................ + Hydropathy - 0.54 - ++---+---++-++-+ +2 4WFF_B BepiPred-2.0 0.60 0.64 - AIFLKWHVPPELVRVLSAML 149 169 N 0 - 20 2.32 8.80 1.03 0.54 + Emini 0.80 0.67 0.30 .....EEEE.EE........ + Parker 0.80 -2.18 0.05 .......E............ + Chou Fosman 0.80 0.80 0.35 .....EEEEEEE........ + Karplus Schulz 0.80 0.95 1.00 EEEEEEEEEEEEEEEEEEEE + Kolaskar 0.80 1.11 1.00 EEEEEEEEEEEEEEEEEEEE + All matches - - 0.05 .......E............ + N-Glyc - - - .................... + Hydropathy - 1.03 - ++++---+---++-++-+++ +Generated files: + ./online-epifinder-parameters.txt + ./online-epifinder-protein-summary.tsv + ./online-epifinder-topology.tsv + ./online-epifinder-epitope-detail.tsv + ./online-epifinder-scores.tsv + ./online-epifinder-epitopes-fasta.fasta \ No newline at end of file
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/online-test_proteom_blast.csv Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,5 @@ +qacc sacc pident qcovs qseq sseq qacc +1-FLKWHVPPELVRVLSA 4WFF_B 100.00 100 FLKWHVPPELVRVLSA FLKWHVPPELVRVLSA +1-FLKWHVPPELVRVLSA 4WFF_A 100.00 100 FLKWHVPPELVRVLSA FLKWHVPPELVRVLSA +2-AIFLKWHVPPELVRVLSAML 4WFF_B 100.00 100 AIFLKWHVPPELVRVLSAML AIFLKWHVPPELVRVLSAML +2-AIFLKWHVPPELVRVLSAML 4WFF_A 100.00 100 AIFLKWHVPPELVRVLSAML AIFLKWHVPPELVRVLSAML
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/proteom.fasta Thu Nov 25 01:26:36 2021 +0000 @@ -0,0 +1,12 @@ +>5C0N_A Chain A of Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes. +CDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDLVTIRSESTFKNTEISFKLGVEFDEITADDRKVKSIITLDGGALVQVQKWDGKSTTIKRKRDGDKLVVECVMKGVTSTRVYERA +>5BVP_A Chain A of The molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing IL-1beta +VRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGGGQDITDFTMQFVSS +>4XAK_A Chain A of Crystal structure of potent neutralizing antibody m336 in complex with MERS Co-V RBD +VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTTNSVCPKLEFA +>4WFF_A Chain A of Human TRAAK K+ channel in a K+ bound nonconductive conformation +RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVV +>4WFF_B Chain B of Human TRAAK K+ channel in a K+ bound nonconductive conformation +RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETQSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLR +>4Z5R_A Chain A of Rontalizumab Fab bound to Interferon-a2 +LGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESL