Mercurial > repos > cpt > cpt_putative_isp

comparison generate-putative-isp.py @ 1:4e02e6e9e77d draft

Find changesets by keywords (author, files, the commit message), revision number or hash, or revset expression.
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
author cpt
date Mon, 05 Jun 2023 02:51:35 +0000
parents
children 08499fbf8697
comparison
equal deleted inserted replaced
0:10d13d0c37d3 1:4e02e6e9e77d
1 #!/usr/bin/env python
2
3 ##### findSpanin.pl --> findSpanin.py
4 ######### Incooperated from the findSpanin.pl script, but better and more snakey.
5
6 import argparse
7 from cpt import OrfFinder
8 from Bio import SeqIO
9 from Bio import Seq
10 import re
11 from spaninFuncs import *
12 import os
13
14 # if __name__ == '__main__':
15 # pass
16 ###############################################################################
17
18 if __name__ == "__main__":
19
20 # Common parameters for both ISP / OSP portion of script
21
22 parser = argparse.ArgumentParser(
23 description="Get putative protein candidates for spanins"
24 )
25 parser.add_argument(
26 "fasta_file", type=argparse.FileType("r"), help="Fasta file"
27 ) # the "input" argument
28
29 parser.add_argument(
30 "-f",
31 "--format",
32 dest="seq_format",
33 default="fasta",
34 help="Sequence format (e.g. fasta, fastq, sff)",
35 ) # optional formats for input, currently just going to do ntFASTA
36
37 parser.add_argument(
38 "--strand",
39 dest="strand",
40 choices=("both", "forward", "reverse"),
41 default="both",
42 help="select strand",
43 ) # Selection of +, -, or both strands
44
45 parser.add_argument(
46 "--table", dest="table", default=11, help="NCBI Translation table", type=int
47 ) # Uses "default" NCBI codon table. This should always (afaik) be what we want...
48
49 parser.add_argument(
50 "-t",
51 "--ftype",
52 dest="ftype",
53 choices=("CDS", "ORF"),
54 default="ORF",
55 help="Find ORF or CDSs",
56 ) # "functional type(?)" --> Finds ORF or CDS, for this we want just the ORF
57
58 parser.add_argument(
59 "-e",
60 "--ends",
61 dest="ends",
62 choices=("open", "closed"),
63 default="closed",
64 help="Open or closed. Closed ensures start/stop codons are present",
65 ) # includes the start and stop codon
66
67 parser.add_argument(
68 "-m",
69 "--mode",
70 dest="mode",
71 choices=("all", "top", "one"),
72 default="all", # I think we want this to JUST be all...nearly always
73 help="Output all ORFs/CDSs from sequence, all ORFs/CDSs with max length, or first with maximum length",
74 )
75
76 parser.add_argument(
77 "--switch",
78 dest="switch",
79 default="all",
80 help="switch between ALL putative osps, or a range. If not all, insert a range of two integers separated by a colon (:). Eg: 1234:4321",
81 )
82 # isp parameters
83 parser.add_argument(
84 "--isp_min_len",
85 dest="isp_min_len",
86 default=60,
87 help="Minimum ORF length, measured in codons",
88 type=int,
89 )
90 parser.add_argument(
91 "--isp_on",
92 dest="out_isp_nuc",
93 type=argparse.FileType("w"),
94 default="_out_isp.fna",
95 help="Output nucleotide sequences, FASTA",
96 )
97 parser.add_argument(
98 "--isp_op",
99 dest="out_isp_prot",
100 type=argparse.FileType("w"),
101 default="_out_isp.fa",
102 help="Output protein sequences, FASTA",
103 )
104 parser.add_argument(
105 "--isp_ob",
106 dest="out_isp_bed",
107 type=argparse.FileType("w"),
108 default="_out_isp.bed",
109 help="Output BED file",
110 )
111 parser.add_argument(
112 "--isp_og",
113 dest="out_isp_gff3",
114 type=argparse.FileType("w"),
115 default="_out_isp.gff3",
116 help="Output GFF3 file",
117 )
118 parser.add_argument(
119 "--isp_min_dist",
120 dest="isp_min_dist",
121 default=10,
122 help="Minimal distance to first AA of TMD, measured in AA",
123 type=int,
124 )
125 parser.add_argument(
126 "--isp_max_dist",
127 dest="isp_max_dist",
128 default=30,
129 help="Maximum distance to first AA of TMD, measured in AA",
130 type=int,
131 )
132 parser.add_argument(
133 "--putative_isp",
134 dest="putative_isp_fa",
135 type=argparse.FileType("w"),
136 default="_putative_isp.fa",
137 help="Output of putative FASTA file",
138 )
139 parser.add_argument(
140 "--min_tmd_size",
141 dest="min_tmd_size",
142 default=10,
143 help="Minimal size of the TMD domain",
144 type=int,
145 )
146 parser.add_argument(
147 "--max_tmd_size",
148 dest="max_tmd_size",
149 default=20,
150 help="Maximum size of the TMD domain",
151 type=int,
152 )
153 parser.add_argument(
154 "--summary_isp_txt",
155 dest="summary_isp_txt",
156 type=argparse.FileType("w"),
157 default="_summary_isp.txt",
158 help="Summary statistics on putative i-spanins",
159 )
160 parser.add_argument(
161 "--putative_isp_gff",
162 dest="putative_isp_gff",
163 type=argparse.FileType("w"),
164 default="_putative_isp.gff3",
165 help="gff3 output for putative i-spanins",
166 )
167
168 parser.add_argument(
169 "--max_isp",
170 dest="max_isp",
171 default=230,
172 help="Maximum size of the ISP",
173 type=int,
174 )
175
176 parser.add_argument("--isp_mode", action="store_true", default=True)
177
178 parser.add_argument(
179 "--peri_min",
180 type=int,
181 default=18,
182 help="amount of residues after TMD is found min",
183 )
184
185 parser.add_argument(
186 "--peri_max",
187 type=int,
188 default=206,
189 help="amount of residues after TMD is found max",
190 )
191 # parser.add_argument('-v', action='version', version='0.3.0') # Is this manually updated?
192 args = parser.parse_args()
193 the_args = vars(parser.parse_args())
194
195 ### isp output, naive ORF finding:
196 isps = OrfFinder(args.table, args.ftype, args.ends, args.isp_min_len, args.strand)
197 isps.locate(
198 args.fasta_file,
199 args.out_isp_nuc,
200 args.out_isp_prot,
201 args.out_isp_bed,
202 args.out_isp_gff3,
203 )
204 """
205 >T7_EIS MLEFLRKLIPWVLVGMLFGLGWHLGSDSMDAKWKQEVHNEYVKRVEAAKSTQRAIGAVSAKYQEDLAALEGSTDRIISDLRSDNKRLRVRVKTTGISDGQCGFEPDGRAELDDRDAKRILAVTQKGDAWIRALQDTIRELQRK
206 >lambda_EIS MSRVTAIISALVICIIVCLSWAVNHYRDNAITYKAQRDKNARELKLANAAITDMQMRQRDVAALDAKYTKELADAKAENDALRDDVAAGRRRLHIKAVCQSVREATTASGVDNAASPRLADTAERDYFTLRERLITMQKQLEGTQKYINEQCR
207 """
208 args.fasta_file.close()
209 args.fasta_file = open(args.fasta_file.name, "r")
210 args.out_isp_prot.close()
211 args.out_isp_prot = open(args.out_isp_prot.name, "r")
212
213 pairs = tuple_fasta(fasta_file=args.out_isp_prot)
214
215 # print(pairs)
216
217 have_tmd = [] # empty candidates list to be passed through the user input criteria
218
219 for (
220 each_pair
221 ) in (
222 pairs
223 ): # grab transmembrane domains from spaninFuncts (queries for lysin snorkels # and a range of hydrophobic regions that could be TMDs)
224 if len(each_pair[1]) <= args.max_isp:
225 try:
226 have_tmd += find_tmd(
227 pair=each_pair,
228 minimum=args.isp_min_dist,
229 maximum=args.isp_max_dist,
230 TMDmin=args.min_tmd_size,
231 TMDmax=args.max_tmd_size,
232 isp_mode=args.isp_mode,
233 peri_min=args.peri_min,
234 peri_max=args.peri_max,
235 )
236 except TypeError:
237 continue
238
239 if args.switch == "all":
240 pass
241 else:
242 # for each_pair in have_lipo:
243 range_of = args.switch
244 range_of = re.search(("[\d]+:[\d]+"), range_of).group(0)
245 start = int(range_of.split(":")[0])
246 end = int(range_of.split(":")[1])
247 have_tmd = parse_a_range(pair=have_tmd, start=start, end=end)
248
249 total_isp = len(have_tmd)
250
251 # ORF = [] # mightttttttttttt use eventually
252 length = [] # grabbing length of the sequences
253 candidate_dict = {k: v for k, v in have_tmd}
254 with args.putative_isp_fa as f:
255 for desc, s in candidate_dict.items(): # description / sequence
256 f.write(">" + str(desc))
257 f.write("\n" + lineWrapper(str(s).replace("*", "")) + "\n")
258 length.append(len(s))
259 # ORF.append(desc)
260 if not length:
261 raise Exception("Parameters yielded no candidates.")
262 bot_size = min(length)
263 top_size = max(length)
264 avg = (sum(length)) / total_isp
265 n = len(length)
266 if n == 0:
267 raise Exception("no median for empty data")
268 if n % 2 == 1:
269 med = length[n // 2]
270 else:
271 i = n // 2
272 med = (length[i - 1] + length[i]) / 2
273
274 #### Extra statistics
275 args.out_isp_prot.close()
276 all_orfs = open(args.out_isp_prot.name, "r")
277 all_isps = open(args.putative_isp_fa.name, "r")
278 # record = SeqIO.read(all_orfs, "fasta")
279 # print(len(record))
280 n = 0
281 for line in all_orfs:
282 if line.startswith(">"):
283 n += 1
284 all_orfs_counts = n
285
286 c = 0
287 for line in all_isps:
288 if line.startswith(">"):
289 c += 1
290 all_isps_counts = c
291
292 # print(f"{n} -> {c}")
293 # count = 0
294 # for feature in record.features:
295 # count += 1
296 # print(count)
297
298 with args.summary_isp_txt as f:
299 f.write("total potential o-spanins: " + str(total_isp) + "\n")
300 f.write("average length (AA): " + str(avg) + "\n")
301 f.write("median length (AA): " + str(med) + "\n")
302 f.write("maximum orf in size (AA): " + str(top_size) + "\n")
303 f.write("minimum orf in size (AA): " + str(bot_size) + "\n")
304 f.write("ratio of isps found from naive orfs: " + str(c) + "/" + str(n))
305
306 # Output the putative list in gff3 format
307 args.putative_isp_fa = open(args.putative_isp_fa.name, "r")
308 gff_data = prep_a_gff3(
309 fa=args.putative_isp_fa, spanin_type="isp", org=args.fasta_file
310 )
311 write_gff3(data=gff_data, output=args.putative_isp_gff)
312
313 """https://docs.python.org/3.4/library/subprocess.html"""
314 """https://github.tamu.edu/CPT/Galaxy-Tools/blob/f0bf4a4b8e5124d4f3082d21b738dfaa8e1a3cf6/tools/phage/transmembrane.py"""