Mercurial > repos > guerler > hhsearch
changeset 0:0dd6880ff950 draft
"planemo upload commit 2ce78baac81e5fc7df43ca3ec81a3c51fdb98003"
author | guerler |
---|---|
date | Tue, 23 Mar 2021 21:38:01 +0000 (2021-03-23) |
parents | |
children | 589e4d51bda4 |
files | hhsearch.xml test-data/6VYB_A.fasta test-data/6VYB_A.hhr test-data/dbCAN-fam-V8/dbCAN-fam-V8_cs219.ffdata test-data/dbCAN-fam-V8/dbCAN-fam-V8_cs219.ffindex test-data/dbCAN-fam-V8/dbCAN-fam-V8_hhm.ffdata test-data/dbCAN-fam-V8/dbCAN-fam-V8_hhm.ffindex test-data/ffindex_indices.loc tool-data/ffindex_indices.loc.sample tool_data_table_conf.xml.sample tool_data_table_conf.xml.test |
diffstat | 11 files changed, 1620 insertions(+), 0 deletions(-) [+] |
line wrap: on
line diff
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/hhsearch.xml Tue Mar 23 21:38:01 2021 +0000 @@ -0,0 +1,138 @@ +<tool id="hhsearch" name="HHsearch" version="@TOOL_VERSION@+galaxy@VERSION_SUFFIX@" profile="20.01"> + <description>detecting remote homologues of proteins</description> + <macros> + <token name="@TOOL_VERSION@">3.2.0</token> + <token name="@VERSION_SUFFIX@">0</token> + <xml name="ffindex_single_inputs"> + <param name="ffdata" type="data" format="ffdata" label="PDB Database" help="Database Data file." /> + <param name="ffindex" type="data" format="ffindex" label="PDB Database Index" help="Database Index file." /> + </xml> + </macros> + <requirements> + <requirement type="package" version="@TOOL_VERSION@">hhsuite</requirement> + </requirements> + <command detect_errors="exit_code"><![CDATA[ + #if $db_source.db_source_selector == 'indexed': + ln -s '${db_source.ffindex.fields.path}.ffdata' hhdb_hhm.ffdata && + ln -s '${db_source.ffindex.fields.path}.ffindex' hhdb_hhm.ffindex && + #else + ln -s '$db_source.ffdata' hhdb_hhm.ffdata && + ln -s '$db_source.ffindex' hhdb_hhm.ffindex && + #end if + + #if $db_source_cs219.db_source_selector == 'indexed': + ln -s '${db_source_cs219.ffindex.fields.path}.ffdata' hhdb_cs219.ffdata && + ln -s '${db_source_cs219.ffindex.fields.path}.ffindex' hhdb_cs219.ffindex && + #else + ln -s '$db_source_cs219.ffdata' hhdb_cs219.ffdata && + ln -s '$db_source_cs219.ffindex' hhdb_cs219.ffindex && + #end if + + $method + -cpu \${GALAXY_SLOTS:-1} + -e '$e' + -i '$i' + -d hhdb + -o '$output' + ]]> </command> + <inputs> + <param argument="--i" type="data" format="fasta,hmm3" label="Query Sequence" help="Single sequence or multiple sequence alignment (MSA) + in FASTA format, or HMM in hhm3 format." /> + <param name="method" type="select" display="radio" label="Search Method" help="Select a search method. See help below for more information."> + <option value="hhsearch" selected="true">HHsearch</option> + <option value="hhblits">HHblits</option> + </param> + <conditional name="db_source"> + <param name="db_source_selector" type="select" label="Custom or built-in HHM index" help="Built-ins have been indexed using ffindex"> + <option value="indexed" selected="true">Use a built-in index</option> + <option value="history">Use a HHM index from history</option> + </param> + <when value="indexed"> + <param name="ffindex" type="select" label="Select ffindex" help=""> + <options from_data_table="ffindex_indices"> + <filter type="sort_by" column="0" /> + <filter type="static_value" column="3" value="hhm" /> + <validator type="no_options" message="No indices are available" /> + </options> + </param> + </when> + <when value="history"> + <expand macro="ffindex_single_inputs" /> + </when> + </conditional> + + <conditional name="db_source_cs219"> + <param name="db_source_selector" type="select" label="Custom or built-in cs219 index" help="Built-ins have been indexed using ffindex"> + <option value="indexed" selected="true">Use a built-in index</option> + <option value="history">Use a cs219 index from history</option> + </param> + <when value="indexed"> + <param name="ffindex" type="select" label="Select ffindex" help=""> + <options from_data_table="ffindex_indices"> + <filter type="sort_by" column="0" /> + <filter type="static_value" column="3" value="cs219" /> + <validator type="no_options" message="No indices are available" /> + </options> + </param> + </when> + <when value="history"> + <expand macro="ffindex_single_inputs" /> + </when> + </conditional> + <param name="e" type="float" value="0.001" min="0" max="1" label="E-value cutoff for inclusion in result alignment. (-e)" /> + </inputs> + <outputs> + <data format="hhr" name="output" /> + </outputs> + <tests> + <test> + <param name="method" value="hhblits" /> + <param name="i" value="6VYB_A.fasta" /> + <conditional name="db_source"> + <param name="db_source_selector" value="history" /> + <param name="ffindex" value="dbCAN-fam-V8/dbCAN-fam-V8_hhm.ffindex" /> + <param name="ffdata" value="dbCAN-fam-V8/dbCAN-fam-V8_hhm.ffdata" /> + </conditional> + <conditional name="db_source_cs219"> + <param name="db_source_selector" value="history" /> + <param name="ffindex" value="dbCAN-fam-V8/dbCAN-fam-V8_cs219.ffindex" /> + <param name="ffdata" value="dbCAN-fam-V8/dbCAN-fam-V8_cs219.ffdata" /> + </conditional> + <output name="output" file="6VYB_A.hhr" lines_diff="4" ftype="hhr" /> + </test> + <test> + <param name="method" value="hhblits" /> + <param name="i" value="6VYB_A.fasta" /> + <conditional name="db_source"> + <param name="db_source_selector" value="indexed" /> + <param name="ffindex" value="hmm_dbcan" /> + </conditional> + <conditional name="db_source_cs219"> + <param name="db_source_selector" value="indexed" /> + <param name="ffindex" value="cs219_dbcan" /> + </conditional> + <output name="output" file="6VYB_A.hhr" lines_diff="4" ftype="hhr" /> + </test> + </tests> + <help><![CDATA[ + +**What it does** + +HHsearch aligns a profile HMM against a database of target profile HMMs. The search first aligns the +query HMM with each of the target HMMs using the Viterbi dynamic programming algorithm, which finds the +alignment with the maximum score. The E-value for the target HMM is calculated from the Viterbi score. +Target HMMs that reach sufficient significance to be reported are realigned using the Maximum Accuracy algorithm (MAC). +This algorithm maximizes the expected number of correctly aligned pairs of residues minus a penalty between 0 and 1. +Values near 0 produce greedy, long, nearly global alignments, values above 0.3 result in shorter, local alignments. + +HHblits is an accelerated version of HHsearch that is fast enough to perform iterative searches through millions of profile HMMs, +e.g. through the Uniclust profile HMM databases, generated by clustering the UniProt database into clusters of globally alignable sequences. +Analogously to PSI-BLAST and HMMER3, such iterative searches can be used to build MSAs by starting from a single query sequence. +Sequences from matches to profile HMMs below some E-value threshold (e.g. 10−3) are added to the query MSA for the next search iteration. + +Download databases from: http://wwwuser.gwdg.de/~compbiol/data/hhsuite/databases/hhsuite_dbs/ + ]]> </help> + <citations> + <citation type="doi">10.1093/bioinformatics/bti125</citation> + </citations> +</tool> \ No newline at end of file
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/6VYB_A.fasta Tue Mar 23 21:38:01 2021 +0000 @@ -0,0 +1,20 @@ +>6VYB_A +AYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHPVLPFNDG +VYFASTEKSNIIRGWIFGTTLDSKSLLIVNNATNVVIKVCEFQFCNDPFLG +VCTFEYVSFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVD +LPIGINITRFQTLLAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSET +KCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASV +YAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFV +IRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDNYNYLYRLFR +KSNLKPFERDISTFPLQSYGFQPTNVGYQPYRVVVLSFELLHAPATVCGPK +KSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDP +QTLEILDITPCSFGGVSVITPGTNTSNEVAVLYQDVNCTEVNVFQTRAGCL +IGAEHVNNSYECDIPIGAGICASYQTQSIIAYTMSLGAENSVAYSNNSIAI +PTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNR +ALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKSKRSF +IEDLLFNKVTFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQ +IPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALG +KLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLI +TGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYH +LMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNG +THWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDS \ No newline at end of file
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/6VYB_A.hhr Tue Mar 23 21:38:01 2021 +0000 @@ -0,0 +1,156 @@ +Query 6VYB_A +Match_columns 966 +No_of_seqs 1 out of 1 +Neff 1 +Searched_HMMs 100 +Date Sun Jul 26 21:21:46 2020 +Command hhblits -i test-data/query.fasta -o query.hhr -d test-data/dbCAN-fam-V8/dbCAN-fam-V8 + + No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM + 1 ABN54336.1|CE12|183-378|9.5e-5 17.2 1.1 0.0014 32.1 0.0 13 586-598 1-13 (210) + 2 ANU56961.1|PL12_2.hmm|1.8e-61| 3.4 9.9 0.013 24.9 0.0 32 900-931 38-69 (131) + 3 CAX58257.1|CE11|4-276|4.9e-122 2.1 18 0.023 25.0 0.0 38 857-894 6-54 (277) + 4 APK54672.1|GT103 2.1 18 0.023 24.9 0.0 168 629-825 1-184 (232) + 5 AAD04130.1|GT13|24-440|6.3e-18 1.7 23 0.03 25.6 0.0 47 302-349 156-203 (390) + 6 ACR10769.1|PL1|79-276|1.4e-54 1.3 33 0.041 21.6 0.0 53 59-111 59-115 (196) + 7 AAR43340.1|GT19|17-374|6.8e-14 1.3 33 0.041 23.4 0.0 14 254-267 116-129 (357) + 8 BAD47100.1|GH125|74-473|3.2e-1 1.3 32 0.041 24.6 0.0 41 98-138 291-338 (402) + 9 ACY95489.1|CBM14|33-88|9.4e-16 1.1 38 0.047 18.2 0.0 36 238-277 39-74 (81) + 10 AAK92730.1|PL1_1.hmm|3.6e-111| 0.9 49 0.063 21.4 0.0 50 277-326 18-67 (199) + +No 1 +>ABN54336.1|CE12|183-378|9.5e-54 +Probab=17.23 E-value=1.1 Score=32.05 Aligned_cols=13 Identities=38% Similarity=0.705 Sum_probs=11.0 Template_Neff=5.400 + +Q 6VYB_A 586 TMYICGDSTECSN 598 (966) +Q Consensus 586 tmyicgdstecsn 598 (966) + |+|||||||-|.. +T Consensus 1 tI~l~GDSTva~~ 13 (210) +T ABN54336.1|CE1 1 TIFLAGDSTVANY 13 (210) +Confidence 6899999998853 + + +No 2 +>ANU56961.1|PL12_2.hmm|1.8e-61|404-534 +Probab=3.41 E-value=9.9 Score=24.92 Aligned_cols=32 Identities=25% Similarity=0.544 Sum_probs=26.7 Template_Neff=2.600 + +Q 6VYB_A 900 ICHDGKAHFPREGVFVSNGTHWFVTQRNFYEP 931 (966) +Q Consensus 900 ichdgkahfpregvfvsngthwfvtqrnfyep 931 (966) + .-++|+-.||..|.||-.|..--..+|+.|.. +T Consensus 38 Lw~~GRnf~PDaG~yvY~Gd~~~~~~R~wfR~ 69 (131) +T ANU56961.1|PL1 38 LWVKGRNFFPDAGSYVYAGDSEINKLRNWFRQ 69 (131) +Confidence 56899999999999999998866777777753 + + +No 3 +>CAX58257.1|CE11|4-276|4.9e-122 +Probab=2.10 E-value=18 Score=25.00 Aligned_cols=38 Identities=32% Similarity=0.532 Sum_probs=26.5 Template_Neff=4.700 + +Q 6VYB_A 857 KRVDFCGKGYHL------MSFPQSAPHGVVFLHVT-----YVPAQEKNF 894 (966) +Q Consensus 857 krvdfcgkgyhl------msfpqsaphgvvflhvt-----yvpaqeknf 894 (966) + +.|.+.|.|.|- --.|..+.+|++|..+- .+||.-.+. +T Consensus 6 ~~v~~~GiGLHsG~~v~l~l~PA~~~tGIvF~R~dl~~~~~IpA~~~~V 54 (277) +T CAX58257.1|CE1 6 RSVSLTGVGLHSGKKVTLTLRPAPANTGIVFRRTDLDGPPEIPADADNV 54 (277) +Confidence 456778888773 44688888999998875 555554443 + + +No 4 +>APK54672.1|GT103 +Probab=2.06 E-value=18 Score=24.88 Aligned_cols=168 Identities=24% Similarity=0.353 Sum_probs=95.1 Template_Neff=2.800 + +Q 6VYB_A 629 FAQVKQIYKTPPIKDFGGFNFSQILPDPSKSKRSFIEDLLFNKVTFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFG 708 (966) +Q Consensus 629 faqvkqiyktppikdfggfnfsqilpdpskskrsfiedllfnkvtfngltvlpplltdemiaqytsallagtitsgwtfg 708 (966) + |.|-|.|+.-+.+.+-..--+.--||..-..++.|-.+.-.+---|.||-- ..||. +T Consensus 1 ~~~~~~~~s~~~~~~~d~~~i~LsLPET~~RR~~f~~~~~~G~q~FdGlR~----------------------~~GWI-- 56 (232) +T APK54672.1|GT1 1 FSQYKSIFSQCEISPQDVDFICLSLPETIERRRDFEQDNPYGIQLFDGLRH----------------------RPGWI-- 56 (232) +Confidence 456667776666666555445555777666666666555544444555432 34663 + + +Q 6VYB_A 709 AGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTAS------AL-------GKLQDVVNQNA 775 (966) +Q Consensus 709 agaalqipfamqmayrfngigvtqnvlyenqklianqfnsaigkiqdslsstas------al-------gklqdvvnqna 775 (966) + |+++..-+..+-|- --+..+-.+-|..-+....|.+.+..+++-|...-+ .| -|+..|-.... +T Consensus 57 -GCglSyk~l~r~al---~~~~~~lti~EDDV~fp~df~~~~~~v~~yL~~~~~~WDvFsGliAdlH~dtkIl~ve~~~g 132 (232) +T APK54672.1|GT1 57 -GCGLSYKFLARKAL---ENGIPQLTICEDDVLFPPDFESKYSQVKDYLDTRRNDWDVFSGLIADLHPDTKILKVERFDG 132 (232) +Confidence 33333333222222 234455567788888888888888888887753221 11 23444444444 + + +Q 6VYB_A 776 QALNTLVKQLSSNFGAISSVLNDILSRLDPPEAE---VQIDRLITGRLQSLQT 825 (966) +Q Consensus 776 qalntlvkqlssnfgaissvlndilsrldppeae---vqidrlitgrlqslqt 825 (966) + ...-++=|-.|--|..-+.-.-++|+..||.... ..|||.+.. .+.|.. +T Consensus 133 ~~yv~iDkMtSmV~NIYs~~al~~L~~Wd~~~~d~~TNTIDRylE~-~~~LrV 184 (232) +T APK54672.1|GT1 133 IEYVTIDKMTSMVFNIYSESALEKLAQWDEKNHDAETNTIDRYLEN-QEGLRV 184 (232) +Confidence 4555555555555555555555788888876544 468998753 334433 + + +No 5 +>AAD04130.1|GT13|24-440|6.3e-183 +Probab=1.69 E-value=23 Score=25.58 Aligned_cols=47 Identities=28% Similarity=0.384 Sum_probs=24.8 Template_Neff=3.500 + +Q 6VYB_A 302 ADSFVIRGDEVRQIAPGQTGKIADYNYKLP-DDFTGCVIAWNSNNLDNY 349 (966) +Q Consensus 302 adsfvirgdevrqiapgqtgkiadynyklp-ddftgcviawnsnnldny 349 (966) + +++++|-.|. -.|||.--.-...--+-|. |+---||-|||.|..... +T Consensus 156 ~~~VII~EdD-m~iapDFf~yf~~~~~lL~~D~sl~cvSaWNDNG~~~~ 203 (390) +T AAD04130.1|GT1 156 FSRVIIVEDD-LEIAPDFFSYFSATYPLLDRDPSLWCVSAWNDNGKEQF 203 (390) +Confidence 3344444433 3566653322222222233 444579999999987654 + + +No 6 +>ACR10769.1|PL1|79-276|1.4e-54 +Probab=1.28 E-value=33 Score=21.64 Aligned_cols=53 Identities=25% Similarity=0.395 Sum_probs=33.8 Template_Neff=5.700 + +Q 6VYB_A 59 KSN-IIRGWIFGTTLD--SKSLLIVNNATNVVIKVCEFQFCNDPFLGVCTF-EYVSF 111 (966) +Q Consensus 59 ksn-iirgwifgttld--sksllivnnatnvvikvcefqfcndpflgvctf-eyvsf 111 (966) + .+| |||-.-|-...+ ...-+-++++.+|.|--|+|.-..|-.+.+..- .||.+ +T Consensus 59 ~~NVIIRnl~~~~~~~~~~~Dai~i~~s~nVWIDHcsfs~~~Dg~ldv~~~s~~VTi 115 (196) +T ACR10769.1|PL1 59 ASNVIIRNLRIRDGNDGFDGDAISIDGSSNVWIDHCSFSWGGDGLIDIKKGSDNVTI 115 (196) +Confidence 344 566666655553 223333578899999999999998887755432 34443 + + +No 7 +>AAR43340.1|GT19|17-374|6.8e-144 +Probab=1.27 E-value=33 Score=23.45 Aligned_cols=14 Identities=36% Similarity=0.700 Sum_probs=11.3 Template_Neff=5.700 + +Q 6VYB_A 254 SVYAWNRKRISNCV 267 (966) +Q Consensus 254 svyawnrkrisncv 267 (966) + +|+||..+|+..-. +T Consensus 116 qvWAWr~~R~k~i~ 129 (357) +T AAR43340.1|GT1 116 QVWAWRPGRIKKIK 129 (357) +Confidence 79999999987643 + + +No 8 +>BAD47100.1|GH125|74-473|3.2e-189 +Probab=1.27 E-value=32 Score=24.58 Aligned_cols=41 Identities=32% Similarity=0.588 Sum_probs=32.3 Template_Neff=3.500 + +Q 6VYB_A 98 DPFLGVCTFEYVSFKNLREFVFKNIDGYF-------KIYSKHTPINLV 138 (966) +Q Consensus 98 dpflgvctfeyvsfknlrefvfknidgyf-------kiyskhtpinlv 138 (966) + -|+||-|.-+---+.|-|+|+...-.-|| -|=|.|++.+-+ +T Consensus 291 lPylG~~~~~DpiYqnTR~~iLS~~NPYy~~G~~~~GIGsPHtg~~~i 338 (402) +T BAD47100.1|GH1 291 LPYLGYCSKDDPIYQNTRRFILSKENPYFYEGKAAEGIGSPHTGPRYI 338 (402) +Confidence 48899999888889999999988766665 266778876655 + + +No 9 +>ACY95489.1|CBM14|33-88|9.4e-16 +Probab=1.13 E-value=38 Score=18.15 Aligned_cols=36 Identities=31% Similarity=0.470 Sum_probs=23.4 Template_Neff=6.300 + +Q 6VYB_A 238 TNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSA 277 (966) +Q Consensus 238 tnlcpfgevfnatrfasvyawnrkrisncvadysvlynsa 277 (966) + ...||.|.+|+...-.=++.++-+ .|--| |+-|||. +T Consensus 39 ~~~Cp~g~~FD~~~~~C~~~~~v~---~C~~~-~~~~~~~ 74 (81) +T ACY95489.1|CBM 39 EFSCPPGLVFDPETQTCDWPENVD---DCSNC-SIRYNSG 74 (81) +Confidence 458999999998876666644431 24433 5666664 + + +No 10 +>AAK92730.1|PL1_1.hmm|3.6e-111|138-336 +Probab=0.87 E-value=49 Score=21.39 Aligned_cols=50 Identities=28% Similarity=0.484 Sum_probs=43.2 Template_Neff=2.500 + +Q 6VYB_A 277 ASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADY 326 (966) +Q Consensus 277 asfstfkcygvsptklndlcftnvyadsfvirgdevrqiapgqtgkiady 326 (966) + .|+.|..--|++-.--+.-|+|--|+....|.|=.+..+.|+..|-|.|- +T Consensus 18 ~S~KTIDGRGa~V~I~~g~citiq~v~nVIIHgi~IH~c~p~~~g~ir~s 67 (199) +T AAK92730.1|PL1 18 NSFKTIDGRGANVHIANGACITIQYVSNVIIHGIHIHDCKPGGNGMVRDS 67 (199) +Confidence 46777777888888888899999999999999999999999998888764 + +
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/dbCAN-fam-V8/dbCAN-fam-V8_cs219.ffindex Tue Mar 23 21:38:01 2021 +0000 @@ -0,0 +1,641 @@ +AA1 130000 614 +AA10 98449 182 +AA11 89861 198 +AA12 161477 401 +AA13 205723 233 +AA14 84523 269 +AA15 202053 196 +AA16 2537 168 +AA1_1 72683 316 +AA1_2 163839 340 +AA1_3 13117 316 +AA2 50468 260 +AA3 175231 645 +AA3_1 132900 776 +AA3_2 109017 591 +AA3_3 152711 592 +AA3_4 117354 551 +AA4 29900 535 +AA5 101197 751 +AA5_1 127310 826 +AA5_2 56821 607 +AA6 51847 197 +AA7 83849 457 +AA8 137667 816 +AA9 65399 217 +CBM1 143663 30 +CBM10 587 29 +CBM11 31337 166 +CBM12 7963 35 +CBM13 202249 200 +CBM14 6549 82 +CBM15 187832 146 +CBM16 181198 132 +CBM17 173997 204 +CBM18 77912 41 +CBM19 126554 45 +CBM2 53796 105 +CBM20 139439 91 +CBM21 7998 107 +CBM22 179903 157 +CBM23 134513 161 +CBM24 106005 77 +CBM25 60676 79 +CBM26 70634 78 +CBM27 163083 167 +CBM28 77953 209 +CBM29 154838 145 +CBM3 142429 87 +CBM30 62778 92 +CBM31 116063 93 +CBM32 616 120 +CBM34 16724 117 +CBM35 0 117 +CBM36 81639 125 +CBM37 156062 63 +CBM38 49755 133 +CBM39 78942 95 +CBM4 24839 132 +CBM40 71507 177 +CBM41 128335 107 +CBM42 17609 137 +CBM43 116609 85 +CBM44 82069 65 +CBM45 35210 83 +CBM46 59324 90 +CBM47 8105 129 +CBM48 125686 98 +CBM49 193665 79 +CBM5 177402 44 +CBM50 178810 47 +CBM51 64368 135 +CBM52 189940 52 +CBM53 76078 89 +CBM54 168537 117 +CBM55 182270 47 +CBM56 80372 182 +CBM57 156125 143 +CBM58 176573 117 +CBM59 50728 146 +CBM6 169738 133 +CBM60 165499 111 +CBM61 1500 143 +CBM62 103830 132 +CBM63 203091 79 +CBM64 39709 84 +CBM65 20745 120 +CBM66 139530 158 +CBM67 62100 183 +CBM68 186041 95 +CBM69 52322 130 +CBM70 123217 165 +CBM71 147133 204 +CBM72 5128 130 +CBM73 100024 51 +CBM74 187978 309 +CBM75 49888 283 +CBM76 154983 160 +CBM77 148424 104 +CBM78 145774 133 +CBM79 126599 111 +CBM8 9993 144 +CBM80 69465 89 +CBM81 59414 98 +CBM82 106082 130 +CBM83 164179 110 +CBM84 78162 138 +CBM85 26881 167 +CBM9 13433 193 +CE1 116156 210 +CE10 172669 335 +CE11 52044 278 +CE12 97509 211 +CE13 36921 354 +CE14 106403 125 +CE15 62870 346 +CE16 79037 267 +CE2 97071 210 +CE3 92750 196 +CE4 4980 148 +CE5 57610 190 +CE6 161252 98 +CE7 183858 317 +CE8 171685 291 +CE9 77362 372 +GH1 107679 399 +GH10 81764 305 +GH100 40271 453 +GH101 143693 708 +GH102 110459 155 +GH103 120684 294 +GH104 177446 145 +GH105 194761 330 +GH106 112942 795 +GH107 111119 330 +GH108 143579 84 +GH109 161350 127 +GH11 195727 179 +GH110 205956 549 +GH111 85330 657 +GH112 188287 716 +GH113 25744 309 +GH114 106212 191 +GH115 58293 701 +GH116 59512 364 +GH117 48439 240 +GH118 170684 485 +GH119 168654 1084 +GH12 11026 153 +GH120 148528 101 +GH121 156268 1401 +GH122 190610 340 +GH123 142516 536 +GH124 117905 319 +GH125 128442 403 +GH126 8234 325 +GH127 124794 530 +GH128 151708 225 +GH129 190950 658 +GH13 177591 394 +GH130 48679 298 +GH131 86835 256 +GH132 2705 306 +GH133 193305 360 +GH134 123520 160 +GH135 63216 240 +GH136 72999 518 +GH137 203908 368 +GH138 60755 922 +GH139 94778 811 +GH13_1 28119 307 +GH13_10 180360 316 +GH13_11 93920 357 +GH13_12 138483 313 +GH13_13 82134 394 +GH13_14 116694 331 +GH13_15 106528 286 +GH13_16 139688 355 +GH13_17 31503 351 +GH13_18 165610 344 +GH13_19 24971 361 +GH13_2 69554 311 +GH13_20 121854 302 +GH13_21 43260 318 +GH13_22 76167 402 +GH13_23 32724 346 +GH13_24 182317 298 +GH13_25 176690 439 +GH13_26 193744 301 +GH13_27 35293 320 +GH13_28 88374 318 +GH13_29 39793 346 +GH13_3 68240 296 +GH13_30 148629 376 +GH13_31 42301 352 +GH13_32 17746 304 +GH13_33 6631 325 +GH13_34 44319 245 +GH13_35 14870 355 +GH13_36 92946 319 +GH13_37 3769 321 +GH13_38 178857 376 +GH13_39 103962 321 +GH13_4 147337 401 +GH13_40 10137 361 +GH13_41 28809 324 +GH13_42 123680 425 +GH13_5 102512 348 +GH13_6 47406 307 +GH13_7 128845 291 +GH13_8 52452 294 +GH13_9 70712 323 +GH14 95878 417 +GH140 186136 452 +GH141 197431 596 +GH142 164289 550 +GH143 100075 575 +GH144 118224 441 +GH145 11179 420 +GH146 110614 505 +GH147 160402 850 +GH148 158304 182 +GH149 22061 1154 +GH15 126710 341 +GH150 53901 943 +GH151 20865 133 +GH152 181330 217 +GH153 101948 360 +GH154 74901 350 +GH156 134674 553 +GH157 80554 657 +GH158 155143 139 +GH159 98631 292 +GH16 161878 228 +GH160 201456 98 +GH161 23603 1077 +GH162 131816 499 +GH163 71684 258 +GH164 136160 696 +GH165 114700 703 +GH17 117 270 +GH18 19637 322 +GH19 108078 220 +GH2 1643 713 +GH20 46197 333 +GH22 184175 123 +GH23 123382 138 +GH24 191608 140 +GH25 163250 175 +GH26 16841 307 +GH27 41459 371 +GH28 119028 346 +GH29 84792 336 +GH3 59876 241 +GH30 192233 419 +GH30_1 37275 419 +GH30_2 6956 421 +GH30_3 174201 426 +GH30_4 153303 488 +GH30_5 52746 459 +GH30_6 189992 456 +GH30_7 97720 446 +GH30_8 35613 389 +GH30_9 38410 448 +GH31 76569 415 +GH32 141568 283 +GH33 19959 337 +GH34 177985 467 +GH35 111700 302 +GH36 204276 681 +GH37 9235 489 +GH38 169871 278 +GH39 162659 424 +GH4 48977 180 +GH42 133676 372 +GH43 111449 251 +GH43_1 130614 311 +GH43_10 203170 272 +GH43_11 184298 293 +GH43_12 136856 415 +GH43_13 18050 306 +GH43_14 63456 292 +GH43_15 82528 277 +GH43_16 90059 313 +GH43_17 44564 271 +GH43_18 179233 271 +GH43_19 141851 242 +GH43_2 129136 307 +GH43_20 140043 281 +GH43_21 64503 232 +GH43_22 5258 245 +GH43_23 98923 275 +GH43_24 87091 254 +GH43_25 120978 219 +GH43_26 68536 295 +GH43_27 78300 324 +GH43_28 186588 264 +GH43_29 158486 280 +GH43_3 88692 300 +GH43_30 106814 270 +GH43_31 50874 280 +GH43_32 153791 316 +GH43_33 165954 321 +GH43_34 138796 285 +GH43_35 50171 297 +GH43_36 198911 267 +GH43_37 43578 244 +GH43_4 104283 315 +GH43_5 4090 288 +GH43_6 119374 295 +GH43_7 27048 272 +GH43_8 150204 283 +GH43_9 149005 293 +GH44 13626 519 +GH45 67130 197 +GH46 15225 220 +GH47 125784 448 +GH48 145907 621 +GH49 33070 562 +GH5 34512 274 +GH50 91682 649 +GH51 57800 493 +GH52 122156 419 +GH53 121197 342 +GH54 20998 316 +GH55 173004 714 +GH56 109608 334 +GH57 28426 383 +GH58 65616 450 +GH59 90372 628 +GH5_1 67327 312 +GH5_10 31854 308 +GH5_11 189003 315 +GH5_12 108298 542 +GH5_13 82805 276 +GH5_14 49157 278 +GH5_15 79304 301 +GH5_16 200339 338 +GH5_17 73517 294 +GH5_18 147738 283 +GH5_19 30435 275 +GH5_2 99198 246 +GH5_20 38858 347 +GH5_21 18356 301 +GH5_22 36002 288 +GH5_23 29133 281 +GH5_24 144401 316 +GH5_25 166275 264 +GH5_26 195906 280 +GH5_27 51154 332 +GH5_28 736 337 +GH5_29 151933 343 +GH5_30 199178 437 +GH5_31 167824 285 +GH5_32 7377 342 +GH5_33 175876 279 +GH5_34 113737 239 +GH5_35 53205 142 +GH5_36 182615 288 +GH5_37 12425 314 +GH5_38 79605 313 +GH5_39 63748 306 +GH5_4 26053 294 +GH5_40 44835 285 +GH5_41 37694 257 +GH5_42 164839 256 +GH5_43 130925 372 +GH5_44 201554 305 +GH5_45 180060 300 +GH5_46 140324 260 +GH5_47 96295 281 +GH5_48 154107 317 +GH5_49 186852 295 +GH5_5 102860 286 +GH5_50 202449 286 +GH5_51 155282 352 +GH5_52 69865 287 +GH5_53 132315 387 +GH5_54 204957 283 +GH5_55 15445 267 +GH5_56 142093 164 +GH5_7 181547 296 +GH5_8 194045 269 +GH5_9 151402 306 +GH6 95589 289 +GH62 62283 279 +GH63 185313 728 +GH64 71942 369 +GH65 119669 381 +GH66 129443 557 +GH67 104598 675 +GH68 88992 401 +GH7 179504 399 +GH70 27320 799 +GH71 21314 372 +GH72 124105 306 +GH73 105876 129 +GH74 171976 321 +GH75 97281 228 +GH76 178452 358 +GH77 191748 485 +GH78 43822 497 +GH79 150487 454 +GH8 18657 326 +GH80 107084 64 +GH81 115403 660 +GH82 84306 217 +GH83 5503 550 +GH84 171169 300 +GH85 194314 311 +GH86 196186 606 +GH87 149298 906 +GH88 4378 330 +GH89 64735 664 +GH9 25332 412 +GH90 54844 552 +GH91 137271 396 +GH92 187147 496 +GH93 135227 312 +GH94 66066 1064 +GH95 184591 722 +GH96 75251 615 +GH97 68831 634 +GH98 107148 327 +GH99 85987 328 +GT1 203442 466 +GT10 182903 358 +GT101 26347 226 +GT102 47713 366 +GT103 67810 233 +GT104 1073 382 +GT105 40724 76 +GT106 49435 320 +GT107 158766 843 +GT11 177129 273 +GT12 81211 136 +GT13 166539 391 +GT14 100650 249 +GT15 32162 280 +GT16 180676 351 +GT17 83081 285 +GT18 56100 721 +GT19 189318 358 +GT20 41830 471 +GT21 73811 234 +GT22 148021 403 +GT23 117025 329 +GT24 87345 250 +GT25 57428 182 +GT26 142257 172 +GT27 8559 301 +GT28 190448 162 +GT29 168109 248 +GT2_Cellulose_synt 15712 723 +GT2_Chitin_synth_1 36290 164 +GT2_Chitin_synth_2 10498 528 +GT2_Glyco_tranf_2_2 143052 277 +GT2_Glyco_tranf_2_3 53347 231 +GT2_Glyco_tranf_2_4 139081 97 +GT2_Glyco_tranf_2_5 70152 211 +GT2_Glyco_trans_2_3 30710 198 +GT2_Glycos_transf_2 200677 171 +GT3 195091 636 +GT30 77734 178 +GT31 139178 188 +GT32 7719 84 +GT33 176155 418 +GT34 152276 246 +GT35 93265 655 +GT37 37951 459 +GT38 174627 468 +GT39 109942 233 +GT4 40139 132 +GT40 140584 213 +GT41 112002 588 +GT42 81347 292 +GT43 61677 209 +GT44 11599 104 +GT45 64054 117 +GT46 45120 357 +GT47 96576 298 +GT48 14145 725 +GT49 146528 356 +GT5 134048 465 +GT50 113976 265 +GT51 67639 171 +GT52 159609 262 +GT53 144717 1057 +GT54 40800 290 +GT55 60117 381 +GT56 51486 361 +GT57 29414 486 +GT58 122575 366 +GT59 92331 419 +GT6 98166 283 +GT60 103146 321 +GT61 155634 240 +GT62 39205 268 +GT63 46530 341 +GT64 163425 252 +GT65 74045 341 +GT66 11703 722 +GT67 205240 338 +GT68 140797 382 +GT69 127051 237 +GT7 17148 251 +GT70 72311 372 +GT71 79918 265 +GT72 202735 356 +GT73 116366 243 +GT74 83366 283 +GT75 198027 354 +GT76 30908 429 +GT77 34786 228 +GT78 87595 135 +GT79 33632 880 +GT8 32442 282 +GT80 192652 380 +GT81 89393 283 +GT82 100899 298 +GT83 131297 519 +GT84 199615 216 +GT85 157669 431 +GT87 39473 236 +GT88 170149 535 +GT89 183261 597 +GT9 107475 204 +GT90 9724 269 +GT91 114241 459 +GT92 126232 322 +GT93 26573 308 +GT94 110175 284 +GT95 74386 295 +GT96 91000 305 +GT97 58994 330 +GT98 18983 654 +GT99 12739 378 +PL1 68043 197 +PL10 6053 287 +PL10_1 16435 289 +PL10_2 122941 276 +PL10_3 70363 271 +PL11 42653 607 +PL11_1 105273 603 +PL11_2 99444 580 +PL12 199831 141 +PL12_1 3011 136 +PL12_2 121539 132 +PL12_3 205578 145 +PL13 103467 363 +PL14 387 200 +PL14_1 125324 209 +PL14_2 20296 210 +PL14_3 201859 194 +PL14_4 53578 218 +PL14_5 154424 211 +PL15 55396 134 +PL15_1 172297 140 +PL15_2 76984 158 +PL16 173718 279 +PL17 124411 139 +PL17_1 175095 136 +PL17_2 163677 162 +PL18 187643 189 +PL1_1 83649 200 +PL1_10 108840 177 +PL1_11 71035 181 +PL1_12 2356 181 +PL1_13 155874 188 +PL1_2 89676 185 +PL1_3 17399 210 +PL1_4 152522 189 +PL1_5 6340 209 +PL1_6 62562 216 +PL1_7 165095 183 +PL1_8 96874 197 +PL1_9 121671 183 +PL2 159871 531 +PL20 181843 230 +PL21 141179 73 +PL21_1 139366 73 +PL22 60498 178 +PL22_1 181027 171 +PL22_2 20506 239 +PL23 3147 622 +PL24 36454 467 +PL25 150941 461 +PL26 166930 894 +PL27 196792 639 +PL28 71216 291 +PL29 118665 363 +PL2_1 198381 530 +PL2_2 46871 535 +PL3 85128 202 +PL30 45477 720 +PL31 80183 189 +PL32 135539 621 +PL33 154635 203 +PL33_1 7803 160 +PL33_2 24680 159 +PL34 158100 204 +PL35 64171 197 +PL36 61886 214 +PL36_1 132702 198 +PL36_2 35014 196 +PL37 87730 644 +PL3_1 168357 180 +PL3_2 182073 197 +PL3_3 75866 212 +PL3_4 128136 199 +PL3_5 102308 204 +PL4 55530 570 +PL4_1 94277 501 +PL4_2 200848 608 +PL4_3 120050 634 +PL4_4 162106 553 +PL4_5 86315 520 +PL5 141252 316 +PL5_1 78624 318 +PL6 41090 369 +PL6_1 91305 377 +PL6_2 48079 360 +PL6_3 8860 375 +PL7 172437 232 +PL7_1 74681 220 +PL7_2 165278 221 +PL7_3 171469 216 +PL7_4 77142 220 +PL7_5 193032 273 +PL8 189676 264 +PL8_1 4708 272 +PL8_2 146884 249 +PL8_3 143329 250 +PL8_4 124550 244 +PL9 199972 367 +PL9_1 23215 388 +PL9_2 21686 375 +PL9_3 112590 352 +PL9_4 125533 153 +SLH 1455 45 +cohesin 127288 22 +dockerin 194625 136
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/dbCAN-fam-V8/dbCAN-fam-V8_hhm.ffindex Tue Mar 23 21:38:01 2021 +0000 @@ -0,0 +1,641 @@ +AA1 4899912 78853 +AA10 22364198 21228 +AA11 21760883 23972 +AA12 10127010 45991 +AA13 20516545 23633 +AA14 19150205 29478 +AA15 21972583 26896 +AA16 22692389 18431 +AA1_1 15112952 36685 +AA1_2 13331028 39956 +AA1_3 15074691 38261 +AA2 19526212 31159 +AA3 4131972 77066 +AA3_1 1966671 87859 +AA3_2 5534746 81506 +AA3_3 5471387 63359 +AA3_4 6188528 57631 +AA4 6673812 57641 +AA5 2054530 88778 +AA5_1 1499532 92324 +AA5_2 5116111 70166 +AA6 21904075 23148 +AA7 8447955 55076 +AA8 1591856 91833 +AA9 21017071 29388 +CBM1 24391847 4224 +CBM10 24396071 3984 +CBM11 22751985 18988 +CBM12 24386862 4985 +CBM13 21665784 27011 +CBM14 24233176 11523 +CBM15 23118308 14914 +CBM16 23636325 17248 +CBM17 21545499 22657 +CBM18 24380826 6036 +CBM19 24368810 5523 +CBM2 23967498 15068 +CBM20 24121820 13479 +CBM21 23953233 14265 +CBM22 22999327 21499 +CBM23 22869454 20500 +CBM24 24285071 9108 +CBM25 24264306 10430 +CBM26 24274736 10335 +CBM27 22731910 20075 +CBM28 21429187 22980 +CBM29 23168702 13382 +CBM3 24166463 12142 +CBM30 24112417 9403 +CBM31 24102924 9493 +CBM32 23808866 18522 +CBM34 23883759 16794 +CBM35 23866186 17573 +CBM36 23764961 14182 +CBM37 24330092 8276 +CBM38 23550726 15988 +CBM39 24090953 11971 +CBM4 23617311 19014 +CBM40 22554699 21017 +CBM41 23938205 15028 +CBM42 23373752 17442 +CBM43 24178605 11563 +CBM44 24317611 6225 +CBM45 24222718 10458 +CBM46 24135299 10939 +CBM47 23714498 17844 +CBM48 24051532 13880 +CBM49 24255048 9258 +CBM5 24374333 6493 +CBM50 24355770 7028 +CBM51 23467055 17834 +CBM52 24338368 5870 +CBM53 24155032 11431 +CBM54 23852940 13246 +CBM55 24350170 5600 +CBM56 22342846 21352 +CBM57 23217315 19419 +CBM58 23840505 12435 +CBM59 23101620 16688 +CBM6 23530995 19731 +CBM60 23913555 12822 +CBM61 23198196 19119 +CBM62 23602089 15222 +CBM63 24244699 10349 +CBM64 24213431 9287 +CBM65 23794728 14138 +CBM66 22977074 22253 +CBM67 22265672 26073 +CBM68 24078815 12138 +CBM69 23680758 14832 +CBM70 22770973 20057 +CBM71 21521992 23507 +CBM72 23666324 14434 +CBM73 24344238 5932 +CBM74 15589050 33193 +CBM75 18054658 25579 +CBM76 22927390 15378 +CBM77 23995686 11718 +CBM78 23516448 14547 +CBM79 23900553 13002 +CBM8 23182084 16112 +CBM80 24146238 8794 +CBM81 24041935 9597 +CBM82 23653573 12751 +CBM83 23926377 11828 +CBM84 23358170 15582 +CBM85 22710820 21090 +CBM9 22023070 27155 +CE1 21327849 31391 +CE10 13575504 47403 +CE11 18493789 37156 +CE12 21231270 28245 +CE13 12477654 42512 +CE14 23747505 17456 +CE15 12976262 43834 +CE16 19266147 30344 +CE2 21299941 27908 +CE3 21946227 26356 +CE4 23079671 21949 +CE5 22074701 25238 +CE6 24029537 12398 +CE7 14853220 41327 +CE8 17244642 40294 +CE9 11315293 49833 +GH1 10222179 59107 +GH10 16086916 43464 +GH100 8607671 52602 +GH101 3018581 78835 +GH102 23020826 20542 +GH103 16976975 40440 +GH104 23150367 18335 +GH105 13893254 45534 +GH106 1865071 101600 +GH107 13860996 32258 +GH108 24202138 11293 +GH109 23732342 15163 +GH11 22467323 23580 +GH110 6372976 65294 +GH111 3818805 69235 +GH112 2741306 78192 +GH113 15551554 37496 +GH114 22050225 24476 +GH115 3177471 91984 +GH116 11675547 46849 +GH117 20290163 27688 +GH118 7842856 45713 +GH119 275912 105920 +GH12 23058839 20832 +GH120 24007404 12091 +GH121 0 145952 +GH122 13292547 38481 +GH123 6503802 60411 +GH124 14680312 29531 +GH125 9939030 48205 +GH126 14131175 41554 +GH127 6838327 68838 +GH128 20766455 30460 +GH129 3688064 69947 +GH13 10323799 56324 +GH130 16596931 32723 +GH131 19645795 29908 +GH132 15981846 37214 +GH133 12012432 47872 +GH134 22909624 17766 +GH135 20258054 32109 +GH136 7147898 60535 +GH137 11503184 39644 +GH138 884209 99488 +GH139 1683689 90836 +GH13_1 15801175 37656 +GH13_10 15034430 40261 +GH13_11 12240218 46810 +GH13_12 15329875 35218 +GH13_13 10380123 49155 +GH13_14 13745273 42840 +GH13_15 17623415 31555 +GH13_16 12395098 43151 +GH13_17 12677624 40121 +GH13_18 13020096 42567 +GH13_19 11884204 42982 +GH13_2 15516055 35499 +GH13_20 16209527 39211 +GH13_21 14779104 39118 +GH13_22 9987235 44088 +GH13_23 12933731 42531 +GH13_24 16565762 31169 +GH13_25 8959721 49481 +GH13_26 16349901 39462 +GH13_27 14605345 34629 +GH13_28 14743159 35945 +GH13_29 12893836 39895 +GH13_3 16702351 35809 +GH13_30 11009221 46321 +GH13_31 12595687 43235 +GH13_32 16130380 37689 +GH13_33 14095951 35224 +GH13_34 20059717 26850 +GH13_35 12359845 35253 +GH13_36 14639974 40338 +GH13_37 14531437 34409 +GH13_38 10967010 42211 +GH13_39 14491311 40126 +GH13_4 10079450 47560 +GH13_40 11843678 40526 +GH13_41 14210008 37058 +GH13_42 9210624 43680 +GH13_5 12763798 43396 +GH13_6 15766084 35091 +GH13_7 17212299 32343 +GH13_8 16943621 33354 +GH13_9 14247066 39802 +GH14 9667733 50217 +GH140 8660273 54216 +GH141 5400748 70639 +GH142 6310933 62043 +GH143 5758752 61151 +GH144 8907551 52170 +GH145 9361225 50176 +GH146 7208433 67420 +GH147 1285009 98431 +GH148 22318092 24754 +GH149 145952 129960 +GH15 13243451 49096 +GH150 783158 101051 +GH151 23500078 16370 +GH152 20989122 27949 +GH153 11967967 44465 +GH154 12717745 46053 +GH156 6075064 61644 +GH157 3758011 60794 +GH158 23321282 17351 +GH159 17149020 33141 +GH16 20706101 34050 +GH160 24019495 10042 +GH161 381832 127878 +GH162 7331349 54284 +GH163 19557371 32320 +GH164 3269455 71438 +GH165 3097416 80055 +GH17 19046243 37447 +GH18 14327558 49391 +GH19 20894491 30636 +GH2 2909398 109183 +GH20 13664192 47325 +GH22 23779143 15585 +GH23 23338633 19537 +GH24 23284422 20405 +GH25 22575716 25386 +GH26 15722385 43699 +GH27 11365126 46146 +GH28 12844157 49679 +GH29 13529185 46319 +GH3 20193005 34349 +GH30 9507467 58508 +GH30_1 9565975 51730 +GH30_2 9312489 48736 +GH30_3 9155615 55009 +GH30_4 7655338 59255 +GH30_5 8392788 55167 +GH30_6 8503031 45541 +GH30_7 8858377 49174 +GH30_8 10474566 44407 +GH30_9 8816018 42359 +GH31 9765578 60003 +GH32 18012894 41764 +GH33 13480840 48345 +GH34 8047999 48229 +GH35 16168069 41458 +GH36 3340893 97188 +GH37 7590578 64760 +GH38 18455001 38788 +GH39 9254304 58185 +GH4 22443823 23500 +GH42 11265935 49358 +GH43 19771686 37755 +GH43_1 15481551 34504 +GH43_10 18881651 35291 +GH43_11 17050383 35020 +GH43_12 9717950 47628 +GH43_13 15950769 31077 +GH43_14 17117138 31882 +GH43_15 18557858 29224 +GH43_16 15292466 37409 +GH43_17 18978890 33376 +GH43_18 18945954 32936 +GH43_19 20163300 29705 +GH43_2 15687773 34612 +GH43_20 18179623 29685 +GH43_21 20570935 25158 +GH43_22 20027683 32034 +GH43_23 18680246 30847 +GH43_24 19675703 34251 +GH43_25 20925127 19937 +GH43_26 16837033 40393 +GH43_27 14172729 37279 +GH43_28 19432342 31515 +GH43_29 18305557 35034 +GH43_3 16455992 37553 +GH43_30 19012266 33977 +GH43_31 18273072 32485 +GH43_32 14997289 37141 +GH43_33 14456320 34991 +GH43_34 17747441 38277 +GH43_35 16629654 33439 +GH43_36 19238007 28140 +GH43_37 20107715 27475 +GH43_4 15184740 39619 +GH43_5 17455625 36056 +GH43_6 16804369 32664 +GH43_7 18853165 28486 +GH43_8 17982480 30414 +GH43_9 17017415 32968 +GH44 7087569 60329 +GH45 21879662 24413 +GH46 20868296 26195 +GH47 8755470 60548 +GH48 4771540 70910 +GH49 5890318 58683 +GH5 18711093 41253 +GH50 4054954 77018 +GH51 7522665 67913 +GH52 9461847 45620 +GH53 13130596 44389 +GH54 14931063 35059 +GH55 2819498 89900 +GH56 13622907 41285 +GH57 10608286 52610 +GH58 8714489 40981 +GH59 4568953 72481 +GH5_1 15403452 38974 +GH5_10 15652666 35107 +GH5_11 15149637 35103 +GH5_12 6438270 65532 +GH5_13 18616345 32766 +GH5_14 18426387 28614 +GH5_15 16318898 31003 +GH5_16 13409806 35930 +GH5_17 16916274 27347 +GH5_18 17950326 32154 +GH5_19 18649111 31135 +GH5_2 19996434 31249 +GH5_20 12807194 36963 +GH5_21 16287054 31844 +GH5_22 17423400 32225 +GH5_23 18151533 28090 +GH5_24 14966122 31167 +GH5_25 19400652 31690 +GH5_26 18243809 29263 +GH5_27 13711517 33756 +GH5_28 13445736 35104 +GH5_29 13062663 34007 +GH5_30 9009202 43187 +GH5_31 17720441 27000 +GH5_32 13096670 33926 +GH5_33 18400446 25941 +GH5_34 20344074 25302 +GH5_35 23236734 14283 +GH5_36 17390619 32781 +GH5_37 15224359 34718 +GH5_38 15259077 33389 +GH5_39 15914673 36096 +GH5_4 16877426 38848 +GH5_40 17689738 30703 +GH5_41 19589691 27894 +GH5_42 19617585 28210 +GH5_43 11227453 38482 +GH5_44 16053855 33061 +GH5_45 16427329 28663 +GH5_46 19494873 31339 +GH5_47 18121689 29844 +GH5_48 14818222 34998 +GH5_49 16770788 33581 +GH5_5 17555058 36593 +GH5_50 17591651 31764 +GH5_51 12558566 37121 +GH5_52 17528048 27010 +GH5_53 10568579 39707 +GH5_54 17922402 27924 +GH5_55 19210828 27179 +GH5_56 22811327 14778 +GH5_7 16663093 39258 +GH5_8 19118075 32130 +GH5_9 15876013 38660 +GH6 17352841 37778 +GH62 18368278 32168 +GH63 2143308 91052 +GH64 11457840 45344 +GH65 10784632 50493 +GH66 5949001 65799 +GH67 3438081 80943 +GH68 10031323 48127 +GH7 10173001 49178 +GH70 1774525 90546 +GH71 11180658 46795 +GH72 15838831 37182 +GH73 23695590 18908 +GH74 14416625 39695 +GH75 20679482 26619 +GH76 12158210 49615 +GH77 7774745 68111 +GH78 7385633 70624 +GH79 8548572 59099 +GH8 14051431 44520 +GH80 24323836 6256 +GH81 3601511 86553 +GH82 20965729 23393 +GH83 6246159 64774 +GH84 16389363 37966 +GH85 15442426 39125 +GH86 5186277 73331 +GH87 983697 106982 +GH88 13818094 42902 +GH89 3519024 82487 +GH9 9825581 58416 +GH90 6136708 51820 +GH91 10281286 42513 +GH92 7456257 66408 +GH93 15365093 38359 +GH94 509710 145659 +GH95 2495876 99876 +GH96 4842450 57462 +GH97 4486992 81961 +GH98 14016766 34665 +GH99 13977770 38996 +GT1 8096228 72211 +GT10 12108747 49463 +GT101 20740151 26304 +GT102 11635708 39839 +GT103 20491630 24915 +GT104 10705003 37352 +GT105 24294179 8996 +GT106 14565846 39499 +GT107 1383440 116092 +GT11 18784599 39298 +GT12 23422325 14930 +GT13 10429278 45288 +GT14 19895596 35011 +GT15 18209308 34501 +GT16 12638922 38702 +GT17 17654970 34768 +GT18 2595752 77072 +GT19 12060304 48443 +GT20 7888569 64430 +GT21 20429652 30274 +GT22 9883997 55033 +GT23 13938788 38982 +GT24 19837137 28373 +GT25 22291745 26347 +GT26 22601102 23956 +GT27 16248738 38316 +GT28 22845740 23714 +GT29 19930607 34333 +GT2_Cellulose_synt 2321677 73509 +GT2_Chitin_synth_1 22791030 20297 +GT2_Chitin_synth_2 6907165 52810 +GT2_Glyco_tranf_2_2 18530945 26913 +GT2_Glyco_tranf_2_3 20596093 29194 +GT2_Glyco_tranf_2_4 24065412 13403 +GT2_Glyco_tranf_2_5 21205841 25429 +GT2_Glyco_trans_2_3 21732640 28243 +GT2_Glycos_transf_2 22667797 24592 +GT3 4350457 75068 +GT30 22512883 24951 +GT31 22179250 26598 +GT32 24190168 11970 +GT33 9617705 50028 +GT34 19964940 31494 +GT35 3888040 90060 +GT37 8340009 52779 +GT38 7952999 44365 +GT39 20459926 31704 +GT4 23581318 20771 +GT40 21143249 22975 +GT41 5616252 81261 +GT42 17085403 31735 +GT43 21403582 25605 +GT44 23982566 13120 +GT45 23827388 13117 +GT46 12207825 32393 +GT47 16524763 40999 +GT48 2234360 87317 +GT49 12317692 42153 +GT5 8168439 67893 +GT50 19332926 32259 +GT51 22644060 23737 +GT52 19463857 31016 +GT53 655369 127789 +GT54 17284936 31794 +GT55 10742355 42277 +GT56 11801304 42374 +GT57 7714593 60152 +GT58 11592957 42751 +GT59 9411401 50446 +GT6 17888984 33418 +GT60 14376949 39676 +GT61 20227354 30700 +GT62 19179683 31145 +GT63 13212617 30834 +GT64 19709954 30262 +GT65 13174985 37632 +GT66 2395186 100690 +GT67 13370984 38822 +GT68 10660896 44107 +GT69 20369376 28362 +GT7 19740216 31470 +GT70 11140895 39763 +GT71 19296491 36435 +GT72 12287028 30664 +GT73 20135190 28110 +GT74 17858011 30973 +GT75 12438249 39405 +GT76 9100038 55577 +GT77 20649668 29814 +GT78 23454678 12377 +GT79 1197474 87535 +GT8 18080237 41452 +GT80 10835125 40570 +GT81 17822289 35722 +GT82 16493545 31218 +GT83 7010085 77484 +GT84 21096867 25062 +GT85 9052389 47649 +GT87 20397738 31914 +GT88 6618219 55593 +GT89 5333360 67388 +GT9 21491858 30134 +GT90 19083690 34385 +GT91 8284884 55125 +GT92 14286868 40690 +GT93 15622243 30423 +GT94 17785718 36571 +GT95 16738160 32628 +GT96 16019060 34795 +GT97 13788113 29981 +GT98 3978100 76854 +GT99 10875695 42942 +PL1 21853525 26137 +PL10 17491681 36367 +PL10_1 17316730 36111 +PL10_2 18587082 29263 +PL10_3 18916942 29012 +PL11 5042312 73799 +PL11_1 5259608 73752 +PL11_2 5697513 61239 +PL12 23251017 18413 +PL12_1 23405911 16414 +PL12_2 23566714 14604 +PL12_3 23133222 17145 +PL13 11764724 36580 +PL14 21619103 24677 +PL14_1 21384043 19539 +PL14_2 21259515 20012 +PL14_3 21999479 23591 +PL14_4 20945064 20665 +PL14_5 21186624 19217 +PL15 23484889 15189 +PL15_1 23269430 14992 +PL15_2 22962553 14521 +PL16 18340591 27687 +PL17 23304827 16455 +PL17_1 23391194 14717 +PL17_2 22826105 19635 +PL18 22122520 18678 +PL1_1 21643780 22004 +PL1_10 22537834 16865 +PL1_11 22403877 19486 +PL1_12 22385426 18451 +PL1_13 22162176 17074 +PL1_2 22205848 23409 +PL1_3 21279527 20414 +PL1_4 22141198 20978 +PL1_5 21359240 24803 +PL1_6 21071580 25287 +PL1_7 22246456 19216 +PL1_8 21832147 21378 +PL1_9 22229257 17199 +PL2 6731453 56466 +PL20 20625287 24381 +PL21 24303175 7581 +PL21_1 24310756 6855 +PL22 22490903 21980 +PL22_1 22625058 19002 +PL22_2 20317851 26223 +PL23 4641434 74342 +PL24 7997364 50635 +PL25 8236332 48552 +PL26 1090679 106795 +PL27 4279868 70589 +PL28 17182161 30138 +PL29 11722396 42328 +PL2_1 6787919 50408 +PL2_2 6564213 54006 +PL3 21594049 25054 +PL30 2672824 68482 +PL31 22099939 22581 +PL32 4715776 55764 +PL33 21568156 25893 +PL33_1 22889954 19670 +PL33_2 22942768 19785 +PL34 21472104 19754 +PL35 21784855 24652 +PL36 21121929 21320 +PL36_1 21715403 17237 +PL36_2 21927223 19004 +PL37 4209038 70830 +PL3_1 22423363 20460 +PL3_2 21809507 22640 +PL3_3 21166224 20400 +PL3_4 21692795 22608 +PL3_5 21452167 19937 +PL4 5819903 70415 +PL4_1 7275853 55496 +PL4_2 4978765 63547 +PL4_3 4425525 61467 +PL4_4 6014800 60264 +PL4_5 6959975 50110 +PL5 14894547 36516 +PL5_1 14709843 33316 +PL6 11411272 46568 +PL6_1 10918637 48373 +PL6_2 11927186 40781 +PL6_3 11101377 39518 +PL7 20540178 30757 +PL7_1 20843621 24675 +PL7_2 20796915 22716 +PL7_3 21046459 25121 +PL7_4 20819631 23990 +PL7_5 18752346 32253 +PL8 19365185 35467 +PL8_1 18823897 29268 +PL8_2 19865510 30086 +PL8_3 19809441 27696 +PL8_4 20086567 21148 +PL9 11542828 50129 +PL9_1 10518973 49606 +PL9_2 11055542 45835 +PL9_3 12520166 38400 +PL9_4 23041368 17471 +SLH 24362798 6012 +cohesin 24400055 3247 +dockerin 23437255 17423
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/ffindex_indices.loc Tue Mar 23 21:38:01 2021 +0000 @@ -0,0 +1,4 @@ +##ffindex indices +#unique_id display name path type +hmm_dbcan HMM 2021-03-17-dbCAN ${__HERE__}/dbCAN-fam-V8/dbCAN-fam-V8_hhm hhm +cs219_dbcan cs19 2021-03-17-dbCAN ${__HERE__}/dbCAN-fam-V8/dbCAN-fam-V8_cs219 cs219 \ No newline at end of file
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/tool-data/ffindex_indices.loc.sample Tue Mar 23 21:38:01 2021 +0000 @@ -0,0 +1,7 @@ +# ffindex collection, you can add multiple indices here and seperate them via the type (last column) +# The path should point to a directory and the file-prefix ('pdb_prefix'). +# The folder needs to contain two files pdb_prefix.ffindex and pdb_prefix.ffdata +# +#identifer description from the PDB set /mnt/pdb_indices/pdb/pdb_prefix pdb +#identifer description from the HHR set /mnt/hhr/hhr_prefix hhr +
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/tool_data_table_conf.xml.sample Tue Mar 23 21:38:01 2021 +0000 @@ -0,0 +1,6 @@ +<tables> + <table name="ffindex_indices" comment_char="#" allow_duplicate_entries="False"> + <columns>value, name, path, type</columns> + <file path="tool-data/ffindex_indices.loc" /> + </table> +</tables>
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/tool_data_table_conf.xml.test Tue Mar 23 21:38:01 2021 +0000 @@ -0,0 +1,7 @@ +<tables> + <!-- Location of ffindex indexes for testing --> + <table name="ffindex_indices" comment_char="#" allow_duplicate_entries="False"> + <columns>value, name, path, type</columns> + <file path="${__HERE__}/test-data/ffindex_indices.loc" /> + </table> +</tables>