Mercurial > repos > iuc > deepsig
changeset 0:8d9746627f77 draft default tip
planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/deepsig commit 8d5424b11bc4d5a4112b030dc38016e4d8b60e21
| author | iuc |
|---|---|
| date | Tue, 23 May 2023 17:04:29 +0000 |
| parents | |
| children | |
| files | deepsig.xml macros.xml test-data/G5ED35.fasta |
| diffstat | 3 files changed, 88 insertions(+), 0 deletions(-) [+] |
line wrap: on
line diff
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/deepsig.xml Tue May 23 17:04:29 2023 +0000 @@ -0,0 +1,76 @@ +<?xml version="1.0"?> +<tool id="deepsig" name="DeepSig" version="@TOOL_VERSION@+galaxy0" profile="21.05"> + <description>signal peptides predictor</description> + <macros> + <import>macros.xml</import> + </macros> + <requirements> + <requirement type="package" version="@TOOL_VERSION@">deepsig</requirement> + </requirements> + <command detect_errors="exit_code"><![CDATA[ + deepsig + -f '$input_fasta' + -o '$output' + -k $organism + -m $output_format + -t \${GALAXY_SLOTS:-1} + + ]]></command> + + <inputs> + <param name="input_fasta" argument="-f" type="data" format="fasta" label="Protein sequences"/> + <param name="organism" argument="-k" type="select" label="Taxonomic domain"> + <option value="euk" selected="true">Eukaryotes</option> + <option value="gramp">Gram-positive</option> + <option value="gramn">Gram-negative</option> + </param> + + <param name="output_format" argument="-m" type="select" label="output_format"> + <option value="gff3" selected="true">GFF3</option> + <option value="json">JSON</option> + </param> + </inputs> + + <outputs> + <data name="output" format="gff3" label="DeepSig on ${on_string}"> + <change_format> + <when input="output_format" value="json" format="json"/> + </change_format> + </data> + </outputs> + + <tests> + <test expect_num_outputs="1"> + <param name="input_fasta" value="G5ED35.fasta"/> + <param name="organism" value="euk"/> + <param name="output_format" value="gff3"/> + <output name="output" ftype="gff3"> + <assert_contents> + <has_text text="sp|G5ED35|TTR52_CAEEL"/> + <has_text text="evidence=ECO:0000256"/> + </assert_contents> + </output> + </test> + <test expect_num_outputs="1"> + <param name="input_fasta" value="G5ED35.fasta"/> + <param name="organism" value="euk"/> + <param name="output_format" value="json"/> + <output name="output" ftype="json"> + <assert_contents> + <has_text text='"sequence": "MSRFLIYFLPFFIYSGNVLSKTSCLMATGVLKCPTDPEAVKKVHIDLWDEDSLPLESDDLMGRTWSDRNGNFQVTGCASDFGPINTPDPYLYIQHNCPHRDSNATNPIQIDVIPLFLPSIVRLGNVYLDRYLEDY"'/> + </assert_contents> + </output> + </test> + </tests> + + <help><![CDATA[ + deepsig_ Predictor of signal peptides in proteins based on deep learning. + DeepSig is a novel approach to predict signal peptides in proteins based on + deep learning and sequence labelling methods. The proposed approach was + evaluated and compared with other available predictors, including the top-performing SignalP. + + .. _deepsig: https://github.com/BolognaBiocomp/deepsig + ]]></help> + +<expand macro="citation"></expand> +</tool>
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/macros.xml Tue May 23 17:04:29 2023 +0000 @@ -0,0 +1,8 @@ +<macros> + <token name="@TOOL_VERSION@">1.2.5</token> + <xml name="citation"> + <citations> + <citation type="doi">10.1093/bioinformatics/btx818</citation> + </citations> + </xml> +</macros> \ No newline at end of file
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/G5ED35.fasta Tue May 23 17:04:29 2023 +0000 @@ -0,0 +1,4 @@ +>sp|G5ED35|TTR52_CAEEL Transthyretin-like protein 52 OS=Caenorhabditis elegans OX=6239 GN=ttr-52 PE=1 SV=1 +MSRFLIYFLPFFIYSGNVLSKTSCLMATGVLKCPTDPEAVKKVHIDLWDEDSLPLESDDL +MGRTWSDRNGNFQVTGCASDFGPINTPDPYLYIQHNCPHRDSNATNPIQIDVIPLFLPSI +VRLGNVYLDRYLEDY
