--- a/test-data/NC_004668_137848_164286_icescreen.gb	Sat Apr 02 21:05:10 2022 +0000
+++ b/test-data/NC_004668_137848_164286_icescreen.gb	Tue Dec 06 10:40:53 2022 +0000
@@ -607,8 +607,8 @@
                      YLTVKKSLYYKNAQTYELVSPKTRASIRTIYLDEDTVHYLRDWKKRQDDVGGIEFILSY
                      NSVPTQKHTVRHIIKRHAKLAEVHDIRIHALRHSHASLLISMGTNALLIKERLGHEDVQ
                      TTLGTYGHLYPSSSTEIANELKGIVNVEFTNQNMASEVTNQFTKGVKK"
-     CDS             1..1511
-                     /origid="WP_002359295.1"
+     CDS             1..1512
+                     /origid="EF_RS00630"
                      /function="Coupling Protein"
                      /protein_id="WP_002359295.1"
                      /locus_tag="EF_RS00630"
@@ -616,11 +616,11 @@
                      /color=6
                      /note="ICEscreen prediction: Coupling protein; BlastP
                      result (Annotation confidence: HIGH): Coupling protein TcpA
-                     [Hit with AAO80014; Identity:100.00%; E-value:0; Query
-                     coverage:100.00%]; Hmmscan result: TcpA [Hit with tcpA HMM
-                     profile; E-value:0; i-Evalue:0]"
-     CDS             3098..4380
-                     /origid="WP_002359299.1"
+                     [Hit with AAO80014; Identity:100.00%; E-value:0.00e+00;
+                     Query coverage:100.00%]; Hmmscan result: TcpA [Hit with
+                     tcpA HMM profile; E-value:7.00e-94; i-Evalue:8.80e-94]"
+     CDS             3098..4381
+                     /origid="EF_RS00650"
                      /function="Relaxase"
                      /protein_id="WP_002359299.1"
                      /locus_tag="EF_RS00650"
@@ -628,11 +628,11 @@
                      /color=7
                      /note="ICEscreen prediction: Relaxase; BlastP result
                      (Annotation confidence: HIGH): Relaxase MOBT (PF02486) [Hit
-                     with AAO80018; Identity:99.77%; E-value:0; Query
+                     with AAO80018; Identity:99.77%; E-value:0.00e+00; Query
                      coverage:95.53%]; Hmmscan result: MOBT [Hit with T4SS_MOBT
-                     HMM profile; E-value:0; i-Evalue:0]"
-     CDS             17920..20426
-                     /origid="WP_002359320.1"
+                     HMM profile; E-value:3.00e-128; i-Evalue:3.40e-128]"
+     CDS             17920..20427
+                     /origid="EF_RS00720"
                      /function="VirB4"
                      /protein_id="WP_002359320.1"
                      /locus_tag="EF_RS00720"
@@ -640,11 +640,11 @@
                      /color="184 134 11"
                      /note="ICEscreen prediction: VirB4; BlastP result
                      (Annotation confidence: HIGH): VirB4 [Hit with CAE52368;
-                     Identity:41.15%; E-value:0; Query coverage:99.76%]; Hmmscan
-                     result: VirB4 [Hit with T4SS_virb4 HMM profile; E-value:0;
-                     i-Evalue:0]"
-     CDS             25273..26438
-                     /origid="WP_002392915.1"
+                     Identity:41.15%; E-value:0.00e+00; Query coverage:99.76%];
+                     Hmmscan result: VirB4 [Hit with T4SS_virb4 HMM profile;
+                     E-value:1.80e-28; i-Evalue:2.40e-28]"
+     CDS             25273..26439
+                     /origid="EF_RS00760"
                      /function="Tyrosine Integrase"
                      /protein_id="WP_002392915.1"
                      /locus_tag="EF_RS00760"
@@ -652,16 +652,17 @@
                      /color=8
                      /note="ICEscreen prediction: Tyrosine integrase; BlastP
                      result (Annotation confidence: HIGH): Tyrosine integrase
-                     [Hit with AAO80040; Identity:100.00%; E-value:0; Query
-                     coverage:100.00%]; Hmmscan result: Tyrosine integrase [Hit
-                     with Phage_integrase HMM profile; E-value:0; i-Evalue:0]"
+                     [Hit with AAO80040; Identity:100.00%; E-value:0.00e+00;
+                     Query coverage:100.00%]; Hmmscan result: Tyrosine integrase
+                     [Hit with Phage_integrase HMM profile; E-value:4.40e-29;
+                     i-Evalue:9.70e-29]"
      mobile_element  1..26439
                      /mobile_element_type="other: integrative and conjugative
                      element"
-                     /note="ICEscreen prediction: Putative ICE (one integrase -
+                     /note="ICEscreen prediction: Putative ICE (one integrase
                      Tyr) [Element structure: Single; ICE superfamily: Tn916;
-                     ICE family: ICESt3; Relaxase family: MOBT; Coupling protein
-                     family: TcpA] (ICEscreen ID: 2)"
+                     ICE family: ICESt3; Relaxase family: - (MOBT); Coupling
+                     protein family: TcpA] (ICEscreen ID: ID_1)"
                      /color=15
 ORIGIN
         1 atgttaaaaa aattatttag atatagagga aggcgtattc gttattcttc aagaaacctg