Mercurial > repos > peterjc > predictnls
changeset 1:f35b2f3ca139 draft
Uploaded v0.0.6, new README file, citation information
| author | peterjc |
|---|---|
| date | Fri, 11 Oct 2013 04:35:15 -0400 |
| parents | 6e26c5a48e9a |
| children | 9f2088ca5f6a |
| files | tools/predictnls/My_NLS_list tools/predictnls/README.rst tools/predictnls/predictnls.py tools/predictnls/predictnls.xml tools/protein_analysis/My_NLS_list tools/protein_analysis/predictnls.py tools/protein_analysis/predictnls.txt tools/protein_analysis/predictnls.xml |
| diffstat | 8 files changed, 678 insertions(+), 651 deletions(-) [+] |
line wrap: on
line diff
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/tools/predictnls/My_NLS_list Fri Oct 11 04:35:15 2013 -0400 @@ -0,0 +1,310 @@ +RRMKWKK Experimental 77 100 0 hxa5_ambme,scr_apime,hx5l_brare,hxb4_brare,hxb5_brare,hxb6_brare,hxc5_brare,hxc6_brare,hxd4_brare,hxa4_chick,hxa7_cotja,hxb4_chick,hxb5_chick,hxb6_chick,hxd4_chick,hxd8_chick,hmdf_drome,scr_drome,hxb4_fugru,hxa4_human,hxa5_human,hxa6_human,hxa7_human,hxb4_human,hxb5_human,hxb6_human,hxb7_human,hxb8_human,hxc4_human,hxc5_human,hxc6_human,hxc8_human,hxd4_human,hxd8_human,ipf1_human,hxa4_mouse,hxa5_mouse,hxa6_mouse,hxa7_mouse,hxb4_mouse,hxb5_mouse,hxb6_mouse,hxb7_mouse,hxb8_mouse,hxc4_mouse,hxc5_mouse,hxc6_mouse,hxc8_mouse,hxd4_mouse,hxd8_mouse,ipf1_mesau,ipf1_mouse,hxc5_notvi,hxc6_notvi,hxb8_pig,hxa4_rat,hxa5_rat,hxa7_rat,hxb7_rat,hxb8_rat,hxc4_rat,hxc8_rat,ipf1_rat,hxa4_sheep,hxa5_salsa,hxa5_sheep,hxa7_sheep,hxc6_sheep,hb7a_xenla,hb7b_xenla,hm8_xenla,hxa7_xenla,hxb4_xenla,hxb5_xenla,hxb6_xenla,hxc5_xenla,hxc6_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RVHPYQR Experimental 0 0 0 +KRPACTLKPECVQQLLVCSQEAKK Experimental 0 0 0 +PKKKRKV Experimental 3 100 0 tala_povba,tala_povbk,tala_sv40 nuc,nuc,nuc +GKKRSKA Experimental 2 100 0 ppol_drome,h2b1_yeast nuc,nuc +KAKRQR Experimental 3 66.6666666666667 33.3333333333333 rel_avire,rel_chick,rel_melga cyt,nuc,nuc +RGRRRRQR Experimental 0 0 0 +RKRRR Experimental 20 85 15 ht31_arath,mb11_copci,sdc3_caeel,chd3_human,sn22_human,ve2_hpv04,ve2_hpv07,ve2_hpv40,atf3_mouse,rms5_neucr,h2b_patgr,rpb1_plafd,fre6_rat,spm1_rat,leu3_salty,prt2_scyca,tat_sivmk,tat_sivml,leu3_theaq,yox1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,mit,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,cyt,nuc +PPVKRERTS Experimental 0 0 0 +PYLNKRKGKP Experimental 0 0 0 +CYGSKNTGAKKRKIDDA Experimental 0 0 0 +KKKKRKREK Experimental 1 100 0 lef1_mouse nuc +KKKRRSREK Experimental 2 100 0 tcf1_human,tcf1_mouse nuc,nuc +KRx{7,9}PQPKKKP Experimental 6 100 0 p53_bovin,p53_cerae,p53_human,p53_macfa,p53_macmu,p53_spebe nuc,nuc,nuc,nuc,nuc,nuc +KVTKRKHDNEGSGSKRPK Experimental 1 100 0 ku70_human nuc +RLKKLKCSKx{19}KTKR Experimental 1 100 0 gal4_yeast nuc +RRERx{4}RPRKIPR Experimental 0 0 0 +KKKKKEEEGEGKKK Experimental 0 0 0 +PRPRKIPR Experimental 0 0 0 +PPRIYPQLPSAPT Experimental 0 0 0 +KDCVINKHHRNRCQYCRLQR Experimental 0 0 0 +KRx{9}KTKK Experimental 0 0 0 +APKRKSGVSKC Experimental 0 0 0 +RKKRRQRRR Experimental 17 100 0 tat_hv112,tat_hv1a2,tat_hv1b1,tat_hv1b5,tat_hv1br,tat_hv1c4,tat_hv1h2,tat_hv1jr,tat_hv1ma,tat_hv1mn,tat_hv1oy,tat_hv1pv,tat_hv1s1,tat_hv1sc,tat_hv1y2,tat_hv1z2,tat_hv1z6 nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RQARRNRRRRWR Experimental 26 100 0 rev_hv112,rev_hv1a2,rev_hv1b1,rev_hv1b8,rev_hv1bn,rev_hv1br,rev_hv1c4,rev_hv1el,rev_hv1h2,rev_hv1j3,rev_hv1jr,rev_hv1lw,rev_hv1ma,rev_hv1mn,rev_hv1nd,rev_hv1oy,rev_hv1pv,rev_hv1rh,rev_hv1s1,rev_hv1s3,rev_hv1sc,rev_hv1w2,rev_hv1y2,rev_hv1z2,rev_hv1z6,rev_hv1z8 nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +MPKTRRRPRRSQRKRPPT Experimental 0 0 0 +KRPMNAFIVWSRDQRRK Experimental 4 100 0 sry_calja,sry_gorgo,sry_human,sry_pig nuc,nuc,nuc,nuc +RPRRK Experimental 16 100 0 sox2_chick,sox3_chick,sry_calja,sry_caphi,sry_gorgo,sox2_human,sox3_human,sry_horse,sry_human,sox2_mouse,sox3_mouse,sx18_mouse,sry_pig,sox2_sheep,sry_sheep,sox3_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +KRPMNAFMVWAQAARRK Experimental 1 100 0 sx21_mouse nuc +PRRRK Experimental 1 100 0 sx21_mouse nuc +[KAR]TPIQKHWRPTVLTEGPPVKIRIETGEWE[KA] Experimental 0 0 0 +PPRKKRTVV Experimental 0 0 0 +YKRPCKRSFIRFI Experimental 0 0 0 +LKDVRKRKLGPGH Experimental 0 0 0 +KRPRP Experimental 4 100 0 ebn2_ebv,tala_povm3,tala_povma,tala_povmc nuc,nuc,nuc,nuc +RRSMKRK Experimental 7 100 0 vdr_bovin,vdr_chick,vdr_cotja,vdr_human,vdr_mouse,vdr_rat,vdr_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc +PAKRARRGYK Experimental 0 0 0 +RKCLQAGMNLEARKTKK Experimental 8 100 0 gcr_aotna,gcr_human,gcr_mouse,gcr_rat,gcr_sagoe,gcr_saibb,gcr_tupgb,gcr_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RRERNKMAAAKCRNRRR Experimental 5 100 0 fos_chick,fos_cypca,fos_human,fos_mouse,fos_rat nuc,nuc,nuc,nuc,nuc +KRMRNRIAASKCRKRKL Experimental 7 100 0 ap1_chick,ap1_cotja,ap1_human,ap1_mouse,ap1_pig,ap1_rat,ap1_serca nuc,nuc,nuc,nuc,nuc,nuc,nuc +KKSKKGRQEALERLKKA Experimental 3 100 0 dpoa_human,dpoa_mouse,dpoa_rat nuc,nuc,nuc +RKEWLTNFMEDRRQRKL Experimental 3 100 0 tp2a_human,tp2a_mouse,tp2a_rat nuc,nuc,nuc +KKQTTLAFKPIKKGKKR Experimental 2 100 0 tp2a_crigr,tp2a_human nuc,nuc +RKRKKMPASQRSKRRKT Experimental 0 0 0 +RAIKRRPGLDFDDDGEGNSKFLR Experimental 1 100 0 arnt_human nuc +SxGTKRSYxxM Experimental 0 0 0 +TKRSxxxM Experimental 1 100 0 cha4_yeast nuc +RIRKKLR Experimental 0 0 0 +KRAAEDDEDDDVDTKKQK Experimental 2 100 0 thya_bovin,thya_human nuc,nuc +GRKRKKRT Experimental 28 100 0 br11_brare,pou1_brare,sgf3_bommo,zp12_brare,zp23_brare,zp47_brare,zp50_brare,cf1a_drome,brn1_human,brn4_human,oc3n_human,oct6_human,brn1_mouse,brn4_mouse,oc11_mouse,oc3n_mouse,oct6_mouse,oc3n_rat,oct6_rat,sk1a_rat,sk1i_rat,hm16_xenla,hm19_xenla,hm20_xenla,po3a_xenla,po3b_xenla,pou1_xenla,pou2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +REKKEKEQKEKCA Experimental 0 0 0 +LEKKVKKKFDWCA Experimental 0 0 0 +TEKK[QG]KSILYDCA Experimental 0 0 0 +SDKKVRSRLIECA Experimental 0 0 0 +LKRKLQR Experimental 8 100 0 pax6_brare,pax6_chick,pax6_cotja,pax6_human,pax6_mouse,pax6_oryla,pax6_rat,pax6_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RRKGKEK Experimental 2 0 100 hd_human,hd_mouse cyt,cyt +CKRKTTNADRRKA Experimental 10 100 0 myod_brare,myod_chick,myod_cotja,myod_human,myod_mouse,myo1_oncmy,myod_pig,myod_rat,myod_sheep,myod_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +VNEAFETLKRC Experimental 7 100 0 myod_chick,myod_cotja,myod_human,myod_mouse,myod_pig,myod_rat,myod_sheep nuc,nuc,nuc,nuc,nuc,nuc,nuc +MPTEERVRKRKESNRESARRSRYRKAAHLK Experimental 0 0 0 +KVNSRKRRKEVPGPNGATEED Experimental 0 0 0 +PRRGPR Experimental 0 0 0 +PRGRRQPIPKARQP Experimental 0 0 0 +KRSAEGGNPPKPLKKLR Experimental 1 100 0 rb_rat nuc +KRKx{11}KKKSKK Experimental 3 100 0 ppol_bovin,ppol_human,ppol_rat nuc,nuc,nuc +EYLSRKGKLEL Experimental 0 0 0 +PKRPRDRHDGELGGRKRARG Experimental 0 0 0 +KRPAATKKAGQAKKKK Experimental 1 100 0 nupl_xenla nuc +KRKKEMANKSAPEAKKKK Experimental 1 100 0 nucl_chick nuc +RKRAFHGDDPFGEGPPDKK Experimental 3 100 0 dnbi_hsv11,dnbi_hsv1f,dnbi_hsv1k nuc,nuc,nuc +GGGx{3}KNRRx{6}RGGRN Experimental 1 100 0 nab2_yeast nuc +YNNQSSNFGPMKGGN Experimental 0 0 0 +PAAKRVKLD Experimental 4 100 0 myc_calja,myc_human,myc_hylla,myc_pantr nuc,nuc,nuc,nuc +KRPAEDMEEEQAFKRSR Experimental 1 100 0 rok_human nuc +SxGTKRSYxxM Experimental 0 0 0 +MNKIPIKDLLNPG Experimental 0 0 0 +PKKARED Experimental 3 100 0 tala_povm3,tala_povma,tala_povmc nuc,nuc,nuc +VSRKRPR Experimental 3 100 0 tala_povm3,tala_povma,tala_povmc nuc,nuc,nuc +APTKRKGS Experimental 0 0 0 +PNKKKRK Experimental 0 0 0 +EEDGPQKKKRRL Experimental 0 0 0 +PLLKKIKQ Experimental 4 100 0 myb_bovin,myb_chick,myb_human,myb_mouse nuc,nuc,nuc,nuc +PPQKKIKS Experimental 1 100 0 mycn_human nuc +PQPKKKP Experimental 6 100 0 p53_bovin,p53_cerae,p53_human,p53_macfa,p53_macmu,p53_spebe nuc,nuc,nuc,nuc,nuc,nuc +SKRVAKRKL Experimental 9 100 0 tha_chick,tha1_human,tha2_human,tha1_mouse,tha2_mouse,tha2_rat,tha_ranca,tha1_sheep,thab_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +IKYFKKFPKD Experimental 1 100 0 ski3_yeast nuc +KTRKHRG Experimental 0 0 0 +KHRKHPG Experimental 0 0 0 +PQSRKKLR Experimental 4 100 0 max_chick,max_human,max_mouse,max_xenla nuc,nuc,nuc,nuc +HRKYEAPRHx{6}PRKR Experimental 1 0 100 rl3_yeast cyt +KKEKKKSKK Experimental 0 0 0 +RKKRKR Potential 3 10 0 hm22_caeel,u2af_caebr,u2af_caeel nuc,nuc,nuc +RKKRRxR Potential 23 100 0 cx10_mouse,sp10_human,tat_hv112,tat_hv1a2,tat_hv1b1,tat_hv1b5,tat_hv1br,tat_hv1c4,tat_hv1el,tat_hv1h2,tat_hv1jr,tat_hv1ma,tat_hv1mn,tat_hv1nd,tat_hv1oy,tat_hv1pv,tat_hv1rh,tat_hv1s1,tat_hv1s3,tat_hv1sc,tat_hv1y2,tat_hv1z2,tat_hv1z6 nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[KR]KRKK Potential 50 100 0 br11_brare,brn1_human,brn1_mouse,brn4_human,brn4_mouse,cf1a_drome,chd3_human,cx10_mouse,dd16_human,dnl1_mouse,dpoa_schpo,elf1_mouse,h2b_agabi,h2b_caeel,h2b_caimo,h2b_chick,hm16_xenla,hm19_xenla,hm20_xenla,if16_human,lyar_mouse,mcm3_human,mcm3_mouse,oc11_mouse,oc3n_human,oc3n_mouse,oc3n_rat,oct6_human,oct6_mouse,oct6_rat,p53_salir,pang_drome,pap_canal,po3a_xenla,po3b_xenla,pou1_brare,pou1_xenla,pou2_xenla,prh_petcr,sgf3_bommo,sk1a_rat,sk1i_rat,sko1_yeast,sus_drome,t2d1_human,trx_drome,zp12_brare,zp23_brare,zp47_brare,zp50_brare nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RKRKR[KR] Potential 12 100 0 hmp1_bovin,hmp1_human,hmp1_melga,hmp1_mouse,hmp1_oncke,hmp1_oncmy,hmp1_pig,hmp1_rat,hmp1_sheep,hrx_human,pou2_brare,sko1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 12 100 10 83.33 hbox: 100 +KKRKR[KR] Potential 10 100 0 h2b_drohy,h2b_drome,h2b_patgr,hm22_caeel,po61_human,po61_mouse,po61_rat,pouc_brare,sn22_human,wc1_neucr nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +KKRRK Potential 9 100 0 skip_human,t2fa_human,cys3_neucr,rpb1_plafd,h2b_sipnu,h2bo_strpu,h2b1_xenla,h2b2_xenla,spt6_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[RK]R[MS]KxK[KR] Potential 163 100 0 hxa5_ambme,hxa9_ambme,hxb1_ambme,scr_apime,h114_brare,hox3_brafl,hx5l_brare,hxa1_brare,hxb4_brare,hxb5_brare,hxb6_brare,hxc5_brare,hxc6_brare,hxd4_brare,hxda_brare,hxdc_brare,hxa2_chick,hxa4_chick,hxa7_cotja,hxa9_cavpo,hxa9_chick,hxab_chick,hxb1_chick,hxb1_cypca,hxb3_chick,hxb4_chick,hxb5_chick,hxb6_chick,hxd3_chick,hxd4_chick,hxd8_chick,hxd9_chick,hxda_chick,hxdb_chick,hxdc_chick,vab7_caeel,hmab_drome,hmdf_drome,hmdl_drome,hmev_drome,hmft_drohy,hmft_drome,hmla_drome,hmpb_drome,hmux_drome,hmz1_drome,hmz2_drome,scr_drome,hxa9_fugru,hxb4_fugru,hxc9_fugru,evx1_human,evx2_human,hb9_human,hxa1_human,hxa2_human,hxa3_human,hxa4_human,hxa5_human,hxa6_human,hxa7_human,hxa9_human,hxaa_human,hxab_human,hxb1_human,hxb2_human,hxb3_human,hxb4_human,hxb5_human,hxb6_human,hxb7_human,hxb8_human,hxb9_human,hxc4_human,hxc5_human,hxc6_human,hxc8_human,hxc9_human,hxcb_human,hxcc_human,hxd3_human,hxd4_human,hxd8_human,hxd9_human,hxda_human,hxdb_human,hxdc_human,ipf1_human,evx1_mouse,evx2_mouse,hxa1_mouse,hxa2_mouse,hxa3_mouse,hxa4_mouse,hxa5_mouse,hxa6_mouse,hxa7_mouse,hxa9_mouse,hxaa_mouse,hxab_mouse,hxb1_mouse,hxb3_mouse,hxb4_mouse,hxb5_mouse,hxb6_mouse,hxb7_mouse,hxb8_mouse,hxb9_mouse,hxc4_mouse,hxc5_mouse,hxc6_mouse,hxc8_mouse,hxc9_mouse,hxca_mouse,hxcb_mouse,hxcc_mouse,hxd1_mouse,hxd3_mouse,hxd4_mouse,hxd8_mouse,hxd9_mouse,hxda_mouse,hxdb_mouse,hxdc_mouse,ipf1_mesau,ipf1_mouse,hxa2_notvi,hxc5_notvi,hxc6_notvi,hxdb_notvi,hxb8_pig,hxa2_rat,hxa4_rat,hxa5_rat,hxa7_rat,hxb7_rat,hxb8_rat,hxc4_rat,hxc8_rat,hxd3_rat,ipf1_rat,hxa4_sheep,hxa5_salsa,hxa5_sheep,hxa7_sheep,hxb2_salsa,hxc6_sheep,hxc9_sheep,hb7a_xenla,hb7b_xenla,hm8_xenla,hx3_xenla,hxa1_xenla,hxa7_xenla,hxb3_xenla,hxb4_xenla,hxb5_xenla,hxb6_xenla,hxb9_xenla,hxc5_xenla,hxc6_xenla,hxd1_xenla,pr05_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 162 99.38 162 100 hbox: 100 +PK[KR][KRP][RAK][KT][VSE] Potential 12 100 0 hmin_drome,tdg_mouse,tala_povba,tala_povbk,tala_povbo,tala_povjc,tala_povly,tala_sv40,h1a_xenla,h1b_xenla,h1c1_xenla,h1c2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +KR[MNSQ]R[MNSQ]R Potential 27 100 0 ap1_chick,ap1_cotja,rxra_chick,u2af_caebr,u2af_caeel,ap1_drome,usp_drome,h1l6_ensmi,ap1_human,ddx8_human,rxra_human,rxrb_human,rxrg_human,sfr3_human,ap1_mouse,rxra_mouse,rxrb_mouse,rxrg_mouse,usp_manse,ap1_pig,ap1_rat,rrxb_rat,rxra_rat,ap1_serca,rxra_xenla,rxrg_xenla,pop1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 21 77.77 21 100 znc: 61.9 bas: 38.09 +T[PLV]KRC Potential 18 100 0 myf5_bovin,myod_brare,myf5_chick,myod_chick,myod_cotja,myf5_human,myod_human,mpi3_mesau,myf5_mouse,myod_mouse,myf5_notvi,myo1_oncmy,mpi3_pig,myod_pig,myod_rat,cut1_schpo,myod_sheep,myf5_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[DE][ST][PL]KR[STC] Potential 16 100 0 myf5_bovin,myod_brare,myf5_chick,myod_chick,myod_cotja,dif_drome,myf5_human,myod_human,myf5_mouse,myod_mouse,myf5_notvi,myo1_oncmy,myod_pig,myod_rat,myod_sheep,myf5_xenla nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RRKx{3,5}R[DE]R{3,}?[PLV] Potential 24 100 0 myf5_bovin,myod_brare,myf5_chick,myf6_chick,myod_caebr,myod_caeel,myod_chick,myod_cotja,myod_drome,myf5_human,myf6_human,myod_human,myf5_mouse,myf6_mouse,myod_mouse,myf5_notvi,myo1_oncmy,myo2_oncmy,myod_pig,myf6_rat,myod_rat,myod_sheep,myf5_xenla,myod_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 24 100 24 100 bas: 100 +[ED]R{4,}?[ED] Potential 13 100 0 nr54_human,psf_human,usf1_human,usf2_human,ve2_hpv37,ve2_hpv48,usf1_mouse,usf2_mouse,usf1_rabit,usf2_rat,usf_strpu,usf1_xenbo,cbf1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 9 69.23 9 100 hlh: 11.11 bas: 88.88 +R{2,}?[QMN]R{3,}? Potential 57 100 0 hsp2_bovin,rev_hv112,rev_hv1a2,rev_hv1b1,rev_hv1b8,rev_hv1bn,rev_hv1br,rev_hv1c4,rev_hv1el,rev_hv1h2,rev_hv1j3,rev_hv1jr,rev_hv1lw,rev_hv1ma,rev_hv1mn,rev_hv1nd,rev_hv1oy,rev_hv1pv,rev_hv1rh,rev_hv1s1,rev_hv1s3,rev_hv1sc,rev_hv1w2,rev_hv1y2,rev_hv1z2,rev_hv1z6,rev_hv1z8,rev_hv2be,rev_hv2ca,rev_hv2d1,rev_hv2g1,rev_hv2kr,rev_hv2nz,rev_hv2ro,rev_hv2sb,rev_hv2st,tat_hv112,tat_hv1a2,tat_hv1b1,tat_hv1b5,tat_hv1br,tat_hv1c4,tat_hv1h2,tat_hv1jr,tat_hv1ma,tat_hv1mn,tat_hv1oy,tat_hv1pv,tat_hv1s1,tat_hv1sc,tat_hv1y2,tat_hv1z2,tat_hv1z6,ve2_hpv17,rev_sivcz,rev_sivm2,rev_sivmk nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +K{1,}?R{2,}?[QM]R{2,} Potential 21 100 0 rev_hv1j3,tat_hv112,tat_hv1a2,tat_hv1b1,tat_hv1b5,tat_hv1br,tat_hv1c4,tat_hv1el,tat_hv1h2,tat_hv1jr,tat_hv1ma,tat_hv1mn,tat_hv1nd,tat_hv1oy,tat_hv1pv,tat_hv1rh,tat_hv1s1,tat_hv1sc,tat_hv1y2,tat_hv1z2,tat_hv1z6 nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +R{2,}?PR{3,}? Potential 2 100 0 prt3_clupa,hsp1_orcor nuc,nuc +RRx{0,1}RRRRR Potential 56 100 0 hsp1_antla,hsp1_antst,hsp1_antsw,prt_antgr,prta_acist,prtb_acigu,gatb_bommo,hsp1_bovin,hsp2_bovin,cdp_canfa,hsp1_caefu,hsp_chick,hsp_cotja,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,ebn6_ebv,hsp1_horse,hsp2_horse,hsp3_horse,rev_hv2be,rev_hv2d1,rev_hv2kr,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_mouse,hsp1_murlo,hsp2_mouse,hsp1_notty,prt3_oncmy,prt4_oncmy,prt7_oncmy,prt9_oncmy,prtb_oncmy,hsp1_parbi,hsp1_pig,hsp1_psecu,hsp2_pig,hsp1_rabit,hsp1_rat,h2b1_strpu,h2b2_strpu,hsp1_sagim,hsp1_sarha,hsp1_sheep,prt1_sepof,prt2_sepof,prt3_scyca,rev_sivs4,rev_sivsp,hsp1_tacac,hsp1_trivu nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RxRSRSx{0,1}RxR Potential 52 100 0 hsp1_antla,hsp1_antst,hsp1_antsw,stp2_bovin,ve2_bpv4,hsp1_caefu,hsp2_calja,hsp_chick,hsp_cotja,sfr2_chick,u2af_caebr,u2af_caeel,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,sr55_drome,trsf_drome,u2af_drome,em1_ensmi,h1l6_ensmi,ddx8_human,sfr1_human,sfr2_human,sfr5_human,sfr6_human,sfr7_human,u2ag_human,ve2_hpv05,ve2_hpv08,ve2_hpv14,ve2_hpv17,ve2_hpv25,ve2_hpv37,ve2_hpv47,ve2_hpv49,ve2_hpv5b,hsp1_isoma,h1l_mytca,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_murlo,hsp1_notty,hsp1_parbi,hsp1_pergu,hsp1_psecu,sfr6_rabit,hsp1_sarha,hsp1_trivu nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +Rx{2,3}RRRRRR Potential 69 100 0 hsp1_alose,hsp1_antla,hsp1_antst,hsp1_antsw,prt_antgr,prtb_acigu,gatb_bommo,hsp1_bovin,hsp2_bovin,prt1_bufja,prt2_bufja,cdp_canfa,hsp1_caefu,hsp1_cavpo,hsp2_calja,hsp_chick,hsp_cotja,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,ebn6_ebv,hsp1_gorgo,hsp1_horse,hsp1_human,hsp2_horse,hsp3_horse,rev_hv2be,rev_hv2d1,ve2_hpv37,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_mouse,hsp1_murlo,hsp2_macmu,hsp2_macne,hsp1_notty,prt1_oncke,prt5_oncmy,prt6_oncmy,prt7_oncmy,prt8_oncmy,prt9_oncmy,h2b2_paran,h2b3_paran,hsp1_parbi,hsp1_phaci,hsp1_pig,hsp1_plagi,hsp1_plain,hsp1_plate,hsp1_psecu,hsp2_pig,hsp1_rabit,hsp1_rat,h2b2_strpu,hsp1_sagim,hsp1_sarha,hsp1_sheep,prt1_sepof,prt2_salir,prt2_sepof,prt3_salir,prt3_scyca,hsp1_tacac,hsp1_trivu nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RRRRRRx{0,2}R Potential 64 100 0 hsp1_alose,hsp1_antla,hsp1_antst,hsp1_antsw,prt_antgr,prta_acist,prtb_acigu,gatb_bommo,hsp1_bovin,hsp2_bovin,cdp_canfa,hsp1_caefu,hsp1_cavpo,hsp2_calja,hsp_chick,hsp_cotja,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,ebn6_ebv,hsp1_horse,hsp2_horse,hsp3_horse,rev_hv2be,rev_hv2d1,ve2_hpv37,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_mouse,hsp1_murlo,hsp2_macmu,hsp2_macne,hsp1_notty,prt1_oncke,prt5_oncmy,prt6_oncmy,prt7_oncmy,prt8_oncmy,prt9_oncmy,hsp1_parbi,hsp1_phaci,hsp1_plams,hsp1_psecu,hsp2_pig,hsp1_rabit,hsp1_rat,h2b1_strpu,h2b2_strpu,hsp1_sagim,hsp1_sarha,hsp1_sheep,prt1_sepof,prt2_salir,prt2_sepof,prt3_salir,prt3_scyca,rev_sivs4,rev_sivsp,hsp1_tacac,hsp1_trivu nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +KKKKR[KR] Potential 8 100 0 h2b_anoga,h2b_drohy,h2b_drome,pang_drome,nnp1_human,lef1_mouse,h2b_pladu,t2fa_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +KKKR[KR][VPL] Potential 8 100 0 tat_hv1u4,tala_povba,tala_povbk,tala_sv40,orc2_yeast,t2d1_drome,t2d1_human,zfy_human nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +R[MNQ]RRRRxR Potential 35 100 0 hsp2_bovin,hsp1_droau,rev_hv112,rev_hv1a2,rev_hv1b1,rev_hv1b8,rev_hv1bn,rev_hv1br,rev_hv1c4,rev_hv1el,rev_hv1h2,rev_hv1j3,rev_hv1jr,rev_hv1lw,rev_hv1ma,rev_hv1mn,rev_hv1nd,rev_hv1oy,rev_hv1pv,rev_hv1rh,rev_hv1s1,rev_hv1s3,rev_hv1sc,rev_hv1w2,rev_hv1y2,rev_hv1z2,rev_hv1z6,rev_hv1z8,rev_hv2be,rev_hv2ca,rev_hv2d1,rev_hv2g1,rev_sivcz,rev_sivm2,rev_sivmk nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +R[KR]RRRRxR Potential 41 100 0 hsp1_antla,hsp1_antst,hsp1_antsw,prt_antgr,gatb_bommo,hsp1_bovin,cdp_canfa,hsp1_caefu,hsp_cotja,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,hsp1_horse,ve2_hpv37,atf3_mouse,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_mouse,hsp1_murlo,hsp1_notty,prt7_oncmy,prt9_oncmy,hsp1_parbi,hsp1_phaci,hsp1_psecu,hsp1_rabit,hsp1_rat,hsp1_sarha,hsp1_sheep,prt1_sepof,prt2_scyca,prt2_sepof,prt3_scyca,rev_sivs4,rev_sivsp,hsp1_tacac,hsp1_trivu nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +R[GVLIP]RRRRxR Potential 8 100 0 prt_antgr,hsp1_droau,ebn6_ebv,hsp2_horse,hsp3_horse,hsp1_pig,hsp1_psecu,hsp1_sagim nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RRRRRR Potential 81 100 0 hsp1_alose,hsp1_antla,hsp1_antst,hsp1_antsw,prt_antgr,prta_acist,prtb_acigu,gatb_bommo,hsp1_bovin,hsp2_bovin,prt1_bufja,prt2_bufja,cdp_canfa,hsp1_caefu,hsp1_cavpo,hsp2_calja,hsp_chick,hsp_cotja,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,ebn6_ebv,hsp1_gorgo,fre4_human,hsp1_horse,hsp1_human,hsp1_hylla,hsp2_horse,hsp3_horse,rev_hv2be,rev_hv2d1,ve2_hpv37,h2b2_lytpi,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_mouse,hsp1_murlo,hsp2_macmu,hsp2_macne,hsp1_notty,prt1_oncke,prt5_oncmy,prt6_oncmy,prt7_oncmy,prt8_oncmy,prt9_oncmy,h2b1_paran,h2b2_paran,h2b3_paran,hsp1_parbi,hsp1_phaci,hsp1_pig,hsp1_plagi,hsp1_plain,hsp1_plams,hsp1_plate,hsp1_psecu,hsp2_pig,hsp1_rabit,hsp1_rat,h2b1_strpu,h2b2_strpu,hsp1_sagim,hsp1_sarha,hsp1_sheep,prt1_salir,prt1_sepof,prt2_salir,prt2_scyca,prt2_sepof,prt3_salir,prt3_scyca,rev_sivs4,rev_sivsp,hsp1_tacac,hsp1_trivu,mcm2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RRRRRxRR Potential 37 100 0 hsp1_antst,prt_antgr,gatb_bommo,hsp1_bovin,cdp_canfa,hsp1_caefu,hsp2_calja,hsp_cotja,hsp1_didma,hsp1_horse,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_mouse,prt2_mugja,hsp1_notty,hsp1_ornan,prt7_oncmy,prt9_oncmy,hsp1_phaci,hsp1_psecu,hsp2_pig,prt_perfv,hsp1_rabit,hsp1_rat,hsp1_sheep,prt1_saror,prt1_sepof,prt2_salir,prt2_sepof,prt3_scyca,hsp1_tacac,hsp1_trivu,prt1_thuth,prt2_thuth nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RRxRRRRR Potential 35 100 0 hsp1_antst,prt_antgr,gatb_bommo,hsp1_bovin,hsp2_bovin,cdp_canfa,hsp1_caefu,hsp_cotja,hsp1_didma,hsp1_droau,hsp1_horse,hsp2_horse,hsp3_horse,rev_hv2be,rev_hv2d1,rev_hv2kr,hsp1_mouse,hsp2_mouse,prt3_oncmy,prt4_oncmy,prt7_oncmy,prt9_oncmy,prtb_oncmy,hsp1_pig,hsp1_psecu,hsp2_pig,hsp1_rabit,hsp1_rat,hsp1_sagim,hsp1_sheep,prt1_sepof,prt2_sepof,prt3_scyca,hsp1_tacac,hsp1_trivu nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[KR][KR][KR][KR][KR][KR][KR] Potential 74 100 0 h2b_astru,hsp1_antla,hsp1_antst,hsp1_antsw,prt_antgr,prta_acist,prtb_acigu,gatb_bommo,hsp1_bovin,cdp_canfa,hm22_caeel,hsp1_caefu,hsp_chick,hsp_cotja,brm_drome,h2b_drohy,h2b_drome,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,pang_drome,sus_drome,ebn6_ebv,dd16_human,gcf_human,hsp1_horse,rev_hv2be,rev_hv2d1,sn22_human,sp10_human,t2d1_human,t2fa_human,h2b2_lytpi,cx10_mouse,h2b_margl,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_murlo,lef1_mouse,hsp1_notty,wc1_neucr,h2b1_paran,h2b2_paran,h2b3_paran,h2b_patgr,h2b_pladu,hsp1_parbi,hsp1_psecu,prh_petcr,rpb1_plafd,dkc1_rat,fre6_rat,h2b1_strpu,h2b2_strpu,h2b_sipnu,h2bl_strpu,h2bn_strpu,h2bo_strpu,hmgh_strpu,hsp1_sarha,hsp1_sheep,prt1_sepof,prt2_scyca,prt2_sepof,prt3_scyca,rev_sivs4,rev_sivsp,hsp1_tacac,hsp1_trivu,h2b_ureca nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RRxxKRK Potential 25 100 0 h2b_acrfo,vdr_bovin,vdr_chick,vdr_cotja,elf1_drome,t2fa_drome,twst_drome,dnl4_human,ets1_human,ets2_human,moz_human,rag1_human,vdr_human,ve2_hpv48,ets2_lytva,ets1_mouse,ets2_mouse,vdr_mouse,ets1_rat,vdr_rat,et1a_xenla,et1b_xenla,et2a_xenla,et2b_xenla,vdr_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[KR]{2,3}xxKR[KR][QLM] Potential 31 100 0 ctcf_chick,tha_chick,thb_chick,elf1_drome,ak95_human,ctcf_human,nol1_human,tha1_human,tha2_human,thb1_human,thb2_human,ve1_hpv33,ve2_hpv48,mx1_mouse,tha1_mouse,tha2_mouse,thb1_mouse,thb2_mouse,ak95_rat,mx1_rat,tha2_rat,tha_ranca,thb1_rat,thb2_rat,thb_ranca,cc21_schpo,tha1_sheep,thb1_sheep,thaa_xenla,thab_xenla,pus4_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RR[TS]x[QK][KR][KN] Potential 35 100 0 vdr_bovin,tha_chick,thb_chick,vdr_chick,vdr_cotja,dnl4_human,rrb2_human,rrg1_human,rrg2_human,tha1_human,tha2_human,thb1_human,thb2_human,vdr_human,rra_mouse,rrb_mouse,rrg1_mouse,rrg2_mouse,tha1_mouse,tha2_mouse,vdr_mouse,rra_notvi,rrb_notvi,tha2_rat,tha_ranca,thb_ranca,vdr_rat,tha1_sheep,thb1_sheep,rra_xenla,rrg1_xenla,rrg2_xenla,thaa_xenla,thab_xenla,vdr_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 34 97.14 34 100 znc: 100 +KRxRxRx{2,6}RKRK Potential 16 100 0 ap1_chick,ap1_cotja,junb_cypca,jund_chick,ap1_drome,ap1_human,junb_human,jund_human,ap1_mouse,junb_mouse,jund_mouse,ap1_pig,ap1_rat,junb_rat,jund_rat,ap1_serca nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 16 100 15 93.75 bas: 100 +KKKKKx{3,6}KK Potential 11 100 0 t2d2_drome,t2fa_drome,atrx_human,chd4_human,rdp_human,ssrp_human,rdp_mouse,ssrp_mouse,ssrp_rat,ra16_yeast,sen1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RxRxRxRxRxRxK Potential 7 100 0 ebn2_ebv,ddx8_human,sfr5_human,ve2_hpv05,ve2_hpv14,ve2_hpv5b,rdp_mouse nuc,nuc,nuc,nuc,nuc,nuc,nuc +RxRxRxRxRxR Potential 74 97.29 2.7 hsp1_alose,hsp1_antla,hsp1_antst,hsp1_antsw,hsp1_bovin,hsp1_caefu,hsp_cotja,sfr2_chick,u2af_caebr,u2af_caeel,dab_drome,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,sr55_drome,stc_drome,trsf_drome,u2af_drome,ebn1_ebv,ebn2_ebv,ddx8_human,hsp1_horse,hsp1_human,rdp_human,sfr1_human,sfr2_human,sfr5_human,sfr6_human,smd1_human,u2ag_human,ve2_hpv05,ve2_hpv08,ve2_hpv14,ve2_hpv17,ve2_hpv25,ve2_hpv49,ve2_hpv5b,hsp1_isoma,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_mouse,hsp1_murlo,hsp2_mouse,rdp_mouse,hsp1_notty,hsp1_orcor,hsp1_ornan,prt7_oncmy,prt9_oncmy,hsp1_pantr,hsp1_parbi,hsp1_pergu,hsp1_psecu,hsp2_pig,hsp1_rabit,hsp1_rat,vtnc_rabit,hsp1_sagim,hsp1_sarha,hsp1_sheep,prt1_sepof,prt2_sepof,prt3_scyca,rev_sivag,rev_sivai,rev_sivat,rev_sivs4,rev_sivsp,hsp1_trivu,snf2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,ext,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[GAPLV]RKRKKR Potential 29 100 0 chd3_human,br11_brare,pou1_brare,sgf3_bommo,zp12_brare,zp23_brare,zp47_brare,zp50_brare,cf1a_drome,brn1_human,brn4_human,oc3n_human,oct6_human,brn1_mouse,brn4_mouse,oc11_mouse,oc3n_mouse,oct6_mouse,oc3n_rat,oct6_rat,sk1a_rat,sk1i_rat,hm16_xenla,hm19_xenla,hm20_xenla,po3a_xenla,po3b_xenla,pou1_xenla,pou2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 28 96.55 28 100 hbox: 100 +RRRKKR Potential 10 100 0 oct1_chick,pdm1_drome,pdm2_drome,pdm2_drovi,oct1_human,oct2_human,oct1_mouse,oct2_mouse,oct2_pig,oct1_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 10 100 10 100 hbox: 100 +RKx{7,12}RK[STMNQ]KK Potential 16 100 0 gcr_aotna,gcr_cavpo,aant_hdvit,aant_hdvl1,aant_hdvna,aant_hdvwo,gcr_human,gcr_mouse,gcr_oncmy,gcr_parol,gcr_rat,gcr_sagoe,gcr_saibb,gcr_tupgb,gcr_xenla,rox1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 12 75 12 100 znc: 91.66 hmg: 8.33 +KRKx{2,4}DRRK Potential 21 100 0 myf5_bovin,myod_brare,myf5_chick,myf6_chick,myod_chick,myod_cotja,myf5_human,myf6_human,myod_human,myf5_mouse,myf6_mouse,myod_mouse,myf5_notvi,myo1_oncmy,myo2_oncmy,myod_pig,myf6_rat,myod_rat,myod_sheep,myf5_xenla,myod_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +R[GA][IVLP]KRR Potential 7 100 0 bimb_emeni,arnt_human,arnt_mouse,arnt_rabit,arnt_rat,rag1_rabit,smd3_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc +R[IVLP][IVLP]KRR Potential 10 100 0 cbfb_human,npl1_human,sp10_human,hap2_klula,cbfb_mouse,h2b2_paran,h2b3_paran,cbfb_rat,php2_schpo,hap2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RRER[MNQ]Kx{4,8}R[MNQ]RRR Potential 13 100 0 fos_chick,fos_cypca,fra2_chick,fos_fugru,fos_human,fosb_human,fra2_human,fos_mouse,fosb_mouse,fra2_mouse,fos_rat,fra2_rat,fos_tetfl nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 13 100 13 100 bas: 100 +RER[MNQ]Kx{4,8}R[MNQ]RR Potential 16 100 0 fos_chick,fos_cypca,fra2_chick,fos_fugru,fos_human,fosb_human,fra1_human,fra2_human,fos_mouse,fosb_mouse,fra1_mouse,fra2_mouse,fos_rat,fra1_rat,fra2_rat,fos_tetfl nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 16 100 16 100 bas: 100 +KKxRx{3,5}R[PVL]K Potential 4 100 0 dpoa_human,dpoa_mouse,dpoa_rat,ly14_yeast nuc,nuc,nuc,nuc +R[MNQ]x{4,8}R[MNQ]RR Potential 26 100 0 area_aspor,hsp2_bovin,fos_chick,fos_cypca,fra2_chick,fos_fugru,atf5_human,cebg_human,fos_human,fosb_human,fra1_human,fra2_human,mycn_human,rev_hv1c4,ve2_hpv17,ve2_hpv25,cebg_mouse,fos_mouse,fosb_mouse,fra1_mouse,fra2_mouse,cebg_rat,fos_rat,fra1_rat,fra2_rat,fos_tetfl nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 21 80.76 18 85.71 bas: 100 +KKx{1,7}K[PL][PLIV]KK Potential 13 100 0 h2b_arath,tp2a_crigr,ddx5_human,p15_human,tp2a_human,p15_mouse,tp2a_mouse,h1_psami,p15_rat,tp2a_rat,h1e_strpu,h1_tetpy,tfs2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[DE]R{2,4}xRK[PL] Potential 4 100 0 tp2a_crigr,tp2a_human,tp2a_mouse,tp2a_rat nuc,nuc,nuc,nuc +KRKx{0,8}KR[PL]K Potential 3 100 0 ku70_human,orc1_klula,prt4_scyca nuc,nuc,nuc +KRKx{5,10}KK[PL]K Potential 6 100 0 hrx_human,rag1_human,ku70_mouse,rag1_mouse,h1_paran,cych_xenla nuc,nuc,nuc,nuc,nuc,nuc +R[STCMNQ]R[STCMNQ]KR Potential 5 100 0 atfa_human,crep_human,atf2_mouse,atf2_rat,b7_ustma nuc,nuc,nuc,nuc,nuc +KK[MNQSTC]R[MNQSTC]K[MNQSTC] Potential 12 100 0 ppar_cavpo,ppar_human,ppas_human,ppat_human,ppar_mouse,ppas_mouse,ppat_mouse,ppar_rat,ppat_rabit,ppar_xenla,ppas_xenla,ppat_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 12 100 12 100 znc: 100 +RR[PLIV]RKxK Potential 3 100 0 hp1_drome,hp1_drovi,moz_human nuc,nuc,nuc +RRxKRxK[PLV] Potential 7 100 0 sdc3_caeel,fd4_drome,hn3g_human,fkh4_mouse,fkh5_mouse,hn3g_mouse,hn3g_rat nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 6 85.71 6 100 fork: 100 +[PL]KxxKRR Potential 19 100 0 e2f1_chick,hm18_caeel,ve1_ccpv1,suhw_droan,e2f1_human,e2f3_human,npl4_human,sn22_human,ve1_hpv11,ve1_hpv44,ve1_hpv6a,ve1_hpv6b,hsf3_lycpe,e2f1_mouse,e2f3_mouse,npl1_mouse,ve1_pcpv1,e2f1_rat,ly14_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[DE]KxRRK[MNQ] Potential 23 100 0 gcr_aotna,prgr_chick,andr_human,gcr_human,mcr_human,prgr_human,andr_mouse,gcr_mouse,prgr_mouse,gcr_oncmy,gcr_parol,andr_rabit,andr_rat,gcr_rat,mcr_rat,prgr_rabit,gcr_sagoe,gcr_saibb,prgr_sheep,gcr_tupgb,mcr_tupgb,gcr_xenla,mcr_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 23 100 23 100 znc: 100 +[DE]K[NIF]RR[DEK][STMNQ] Potential 24 100 0 gcr_aotna,gcr_cavpo,prgr_chick,andr_human,gcr_human,mcr_human,prgr_human,andr_mouse,gcr_mouse,prgr_mouse,gcr_oncmy,gcr_parol,andr_rabit,andr_rat,gcr_rat,mcr_rat,prgr_rabit,gcr_sagoe,gcr_saibb,prgr_sheep,gcr_tupgb,mcr_tupgb,gcr_xenla,mcr_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 24 100 24 100 znc: 100 +[YFW]RRRR[PL] Potential 8 100 0 yb1_chick,rxrb_human,tfe3_human,yb1_human,rxrb_mouse,yb1_mouse,yb1_xenla,yb3_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RKR[PLQMN]R[PLQMN]R Potential 16 100 0 ap1_chick,ap1_cotja,junb_cypca,jund_chick,ap1_drome,ap1_human,junb_human,jund_human,ap1_mouse,junb_mouse,jund_mouse,ap1_pig,ap1_rat,junb_rat,jund_rat,ap1_serca nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 16 100 15 93.75 bas: 100 +K[PLMN]RRK[MNQ] Potential 3 100 0 sx19_brare,slp1_drome,son1_yeast nuc,nuc,nuc +RR[PLQMN]xRRRR Potential 10 100 0 hsp2_bovin,yb1_chick,hsp2_horse,hsp3_horse,rev_hv2be,rev_hv2d1,rev_hv2kr,yb1_human,yb1_mouse,prt5_oncmy nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RxKKKK[DE] Potential 12 100 0 rrb2_human,rrg1_human,rrg2_human,rra_mouse,rrb_mouse,rrg1_mouse,rrg2_mouse,u2r1_mouse,rrb_notvi,rra_xenla,rrg1_xenla,rrg2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[DE]RxKKKK Potential 15 100 0 ssrp_chick,t2d4_drome,ddx8_human,rrb2_human,rrg1_human,rrg2_human,rra_mouse,rrb_mouse,rrg1_mouse,rrg2_mouse,rra_notvi,rrb_notvi,rra_xenla,rrg1_xenla,rrg2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RRxR[PVL]RK Potential 13 100 0 gbf1_arath,gbf2_arath,gbf3_arath,gsbd_drome,gsbp_drome,hmpr_drome,moz_human,ocs1_maize,cpr1_petcr,cpr3_petcr,taf1_tobac,emp1_wheat,hbpa_wheat nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 24 92.3 24 100 hbox: 25 bas: 75 +RRR[LP]xxR[PLQ] Potential 6 100 0 zfx_bovin,tra1_caeel,zfx_human,zfx1_mouse,zfx2_mouse,ra54_yeast nuc,nuc,nuc,nuc,nuc,nuc +[DE]RKRR[DEPLQ] Potential 15 100 0 max_brare,max_chick,brm_drome,trsf_drome,max_human,sn22_human,sn24_human,wrn_human,max_mouse,scp1_mesau,max_rat,scp1_rat,mlh_tetth,max_xenla,dpoe_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[KR][DE][KR][DE]xx[KR]{4,}? Potential 5 100 0 tala_bfdv,aant_hdvs1,aant_hdvs2,cenc_human,snf5_yeast nuc,nuc,nuc,nuc,nuc +[PL]R[DE]K[DE]R Potential 2 100 0 dp30_caeel,mpi3_mouse nuc,nuc +[PL][KR]{5,7}[PL] Potential 12 100 0 dnb2_ade05,zfx_bovin,myba_chick,chd4_human,zfx_human,zfy_human,mbp1_klula,tdg_mouse,zfx1_mouse,zfx2_mouse,p53_salir,tf3a_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[KR]{2,}?[PL]x{1,4}[KR]{2,}?x{1,5}K{3,}? Potential 11 100 0 h2b_arath,hmga_chite,tf3a_ictpu,phi3_mytca,h1_paran,h1d_strpu,prt4_scyca,h1_tigca,h5a_xenla,h5b_xenla,nupl_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +K[GA]K[AG]KK[AG] Potential 5 100 0 tp2a_crigr,t2fa_drome,tp2a_mouse,cebb_rat,tp2a_rat nuc,nuc,nuc,nuc,nuc +[KR][KR]x[KR][KR][KR]x[KR][KR] Potential 54 98.14 1.85 h2b_agabi,h2b_anoga,prt_antgr,hsp1_bovin,hsp2_bovin,cdp_canfa,hsp1_caefu,brm_drome,hsp1_didma,hsp1_droau,t2d2_drome,twst_drome,rms5_emeni,aant_hdvam,aant_hdvd3,aant_hdvit,aant_hdvl1,aant_hdvm1,aant_hdvm2,aant_hdvna,aant_hdvwo,ell2_human,gcf_human,hsp1_horse,pwp1_human,rev_hv2be,rev_hv2d1,rev_hv2kr,sn22_human,h2b1_maize,h2b2_maize,h2b3_maize,h2b4_maize,h2b5_maize,hsp1_mouse,u2r1_mouse,hsp1_orcor,prt7_oncmy,prt9_oncmy,hsp1_phaci,hsp1_pig,hsp1_psecu,rpb1_plafd,hsp1_rabit,hsp1_rat,hsp1_sagim,hsp1_sheep,prt1_sepof,prt2_sepof,prt3_scyca,hsp1_trivu,h2b1_wheat,pr08_yeast,sen1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,mit,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[RK][PLIV][KR][RK]{2,4}[PLVI]R Potential 5 100 0 ht31_arath,cg2f_human,prt3_oncmy,prt4_oncmy,prtb_oncmy nuc,nuc,nuc,nuc,nuc +KR[PLV][GA]KRK[PL] Potential 19 100 0 tha_chick,thb_chick,tha1_human,tha2_human,thb1_human,thb2_human,tha1_mouse,tha2_mouse,thb1_mouse,thb2_mouse,tha2_rat,tha_ranca,thb1_rat,thb2_rat,thb_ranca,tha1_sheep,thb1_sheep,thaa_xenla,thab_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[DE][KR]RR[KR][FYW] Potential 6 100 0 crep_human,tfe3_human,tfeb_human,atf2_mouse,tfe3_mouse,atf2_rat nuc,nuc,nuc,nuc,nuc,nuc +Rx[KR][KR][KR]xxRKKR Potential 2 100 0 dd16_human,sth1_yeast nuc,nuc +KRxxKKxK[DE] Potential 3 100 0 xpa_chick,chd3_human,snf2_yeast nuc,nuc,nuc +[DE]KR[MQN]R[MQN]R Potential 13 100 0 rxra_chick,usp_drome,rxra_human,rxrb_human,rxrg_human,rxra_mouse,rxrb_mouse,rxrg_mouse,usp_manse,rrxb_rat,rxra_rat,rxra_xenla,rxrg_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 13 100 13 100 znc: 100 +K[RK]{3,5}x{11,18}[RK]Kx{2,3}K Experimental 31 100 0 scii_chick,tp2b_chick,tp2b_crilo,orc2_drome,ssrp_drome,t2fa_drome,ac15_human,atf3_human,chd3_human,moz_human,tp2b_human,dpoa_leido,ac15_mouse,atf3_mouse,lyar_mouse,phi1_myted,tdg_mouse,tp2b_mouse,h1_paran,dkc1_rat,prt4_scyca,apn1_yeast,cbf5_yeast,dpod_yeast,fkb3_yeast,nop5_yeast,pus3_yeast,ra16_yeast,rok1_yeast,sen1_yeast,tea1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +DR[MN]KKKKE Potential 11 100 0 rrb2_human,rrg1_human,rrg2_human,rra_mouse,rrb_mouse,rrg1_mouse,rrg2_mouse,rrb_notvi,rra_xenla,rrg1_xenla,rrg2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RK[PL][PLV]KK[RKH] Potential 5 100 0 tp2b_chick,tp2b_crilo,tp2b_mouse,rap1_yeast,spt5_yeast nuc,nuc,nuc,nuc,nuc +RK[IVE]W[ML][TQR]N[HF] Potential 9 100 0 tp2a_chick,tp2b_chick,tp2b_crilo,top2_drome,tp2a_human,tp2b_human,tp2a_mouse,tp2b_mouse,tp2a_rat nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +R[RK]{2,4}[PL][RK][MNQ]R Potential 10 100 0 junb_cypca,jund_chick,hsp1_droau,junb_human,jund_human,xbp1_human,junb_mouse,jund_mouse,junb_rat,jund_rat nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 9 90 8 88.88 bas: 100 +R{2,3}K{3,4}[PLRKE] Potential 15 100 0 creb_bovin,creb_chlvr,crem_canfa,bbf2_drome,atf1_human,creb_human,relb_human,atf1_mouse,crea_mouse,creb_mouse,relb_mouse,creb_rat,crem_rat,dpol_rcmvm,orc5_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 11 73.33 11 100 bas: 100 +R[KR]{3,4}K[DE] Potential 30 100 0 h2b_astru,creb_bovin,creb_chlvr,crem_canfa,bbf2_drome,sus_drome,atf1_human,atf6_human,crea_human,creb_human,if16_human,zep2_human,atf1_mouse,crea_mouse,creb_mouse,crem_mouse,h2b_margl,h2b3_psami,h2b4_psami,h2b_patgr,creb_rat,crem_rat,h2b_sipnu,h2bl_strpu,h2bn_strpu,h2bo_strpu,hmgh_strpu,orc5_yeast,sko1_yeast,sof1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +K[MNQ]RR[PLVI]K[PL] Potential 44 100 0 br11_brare,pou1_brare,sgf3_bommo,zp12_brare,zp23_brare,zp47_brare,zp50_brare,brn3_chick,oct1_chick,un86_caeel,cf1a_drome,ipou_drome,pdm1_drome,pdm2_drome,pdm2_drovi,br3a_human,br3b_human,br3c_human,brn1_human,brn4_human,oc3n_human,oct1_human,oct2_human,oct6_human,br3a_mouse,br3b_mouse,br3c_mouse,brn1_mouse,brn4_mouse,oc11_mouse,oc3n_mouse,oct1_mouse,oct2_mouse,oct6_mouse,oct2_pig,oc3n_rat,oct6_rat,sk1a_rat,sk1i_rat,oct1_xenla,po3a_xenla,po3b_xenla,pou1_xenla,pou2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[GA]KxKKK[MNQ] Potential 3 100 0 tfs2_human,tfs2_mouse,mrf1_yeast nuc,nuc,nuc +[PVLI][RK][RK][RK][RK][RK][QMN]K Potential 4 100 0 msl1_drome,no56_human,zep1_human,zep1_mouse nuc,nuc,nuc,nuc +R[GA]x{0,2}[GA]R[GA]x[GA]R[GA] Potential 19 100 0 nucl_chick,ebn1_ebv,ebn2_ebv,ews_human,p80c_human,smd1_human,smd3_human,tfeb_human,fbrl_leima,ews_mouse,fbrl_mouse,nucl_mesau,nfil_pig,5e5_rat,fbrl_rat,fbrl_schpo,nucl_xenla,nsr1_yeast,snf2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[GA][KR]KRx[KR][GA] Potential 11 100 0 dpod_bovin,h2b_caeel,ppol_drome,dpod_human,pmsc_human,dpod_mesau,dpod_mouse,dpod_rat,spm1_rat,dpod_soybn,h2b1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +R[RK]K[RK]KR Potential 5 100 0 prh_arath,hm22_caeel,u2af_caebr,u2af_caeel,dpol_rcmvm nuc,nuc,nuc,nuc,nuc +[PLV]K[RK]x[QMN][RK]R Potential 16 100 0 dnb2_ade05,wt1_allmi,dp27_caeel,gsbd_drome,gsbp_drome,hmpr_drome,pax3_human,pax7_human,wt1_human,pax3_mouse,pax7_mouse,wt1_mouse,wt1_pig,wt1_rat,wt1_smima,nuf1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[PLQMNKR]K[KR][KR]RxK[PLQMNKR] Potential 5 100 0 h2b_chith,sn22_human,lef1_mouse,u2r1_mouse,rpb1_plafd nuc,nuc,nuc,nuc,nuc +[PLQMKR]R[KR][QM][KR]RxK Potential 11 100 0 axia_brare,sgf1_bommo,fkh_drome,hn3a_human,hn3g_human,hn3a_mouse,hn3b_mouse,hn3g_mouse,hn3a_rat,hn3b_rat,hn3g_rat nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 11 100 11 100 fork: 100 +KRx[DE][KR][KR]xK Potential 2 100 0 xpa_chick,snf2_yeast nuc,nuc +R[QMPL]RR[DE]R Potential 9 100 0 cebd_human,cebe_human,cebg_human,cebd_mouse,cebg_mouse,cebd_rat,cebe_rat,cebg_rat,u2af_schpo nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 8 88.88 7 87.5 bas: 100 +[PLV]RK[ST]R[DE]K Potential 14 100 0 cebb_chick,ceb_drome,ceb_drovi,ceba_human,cebb_human,cebd_human,cebe_human,ceba_mouse,cebb_mouse,cebd_mouse,ceba_rat,cebb_rat,cebd_rat,cebe_rat nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 14 100 13 92.85 bas: 100 +[STQM]RKRK[STQM] Potential 7 100 0 prh_arath,elt2_caeel,ga15_crilo,tp2a_crigr,ga15_human,zn46_human,ga15_mouse nuc,nuc,nuc,nuc,nuc,nuc,nuc +[STQM]RKRR[STQM] Potential 1 100 0 mklp_human nuc +[STQM]RRRK[STQM] Potential 4 100 0 prt_antgr,ve2_hpv38,cpr2_petcr,msn4_yeast nuc,nuc,nuc,nuc +[PL][RK][RK][KR][GAPL][RK][STQM] Potential 8 100 0 sx11_chick,hmux_drome,hmux_drops,sry_gorgo,sry_horse,sry_human,ve2_hpv5b,tala_povmk nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +K[KR][QMN][RK]R[QMN]R Potential 4 100 0 hnfb_human,hnfb_mouse,hnfb_pig,hnfb_rat nuc,nuc,nuc,nuc DNA_BIND 4 100 4 100 hbox: 100 +[PLQ]K[RK]x{1,2}[RK]x{3,6}[RK][RK]x{1,2}[RK]x{1,2}[RK][RK] Potential 22 100 0 h1_anapl,prt_antgr,h101_chick,h103_chick,h110_chick,h11l_chick,h11r_chick,h1_chick,h1_echcr,h1a_human,moz_human,h11_mouse,h15_mouse,h1l_myttr,phi1_myted,h1_oncmy,h1_paran,h1_saltr,h1e_strpu,h5a_xenla,h5b_xenla,gcn4_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +K[PL]K{2,3}x{1,3}[RK]{2,4}x{6,9}K[KR] Potential 24 100 0 h1_anapl,hg17_bovin,h101_chick,h103_chick,h110_chick,h11l_chick,h11r_chick,h1_chick,h1a_chite,h1b_chite,hg15_chick,hg17_chick,h1_drome,h13_glyba,chd4_human,hg17_human,t2d4_human,hg17_mouse,h1_oncmy,h1_paran,hg17_pig,hg17_rat,ap1_schpo,h1_saltr nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[PL][RK][RK][DEP]R[RK][FYW] Potential 4 100 0 zep2_human,agie_rat,maz3_schco,u2af_schpo nuc,nuc,nuc,nuc +[KR][KR][QMN]R[RK][QMN]R Potential 6 100 0 hnfb_human,pmx1_human,hnfb_mouse,pmx1_mouse,hnfb_pig,hnfb_rat nuc,nuc,nuc,nuc,nuc,nuc +R[KR][RK]x{0,2}[RK]x{0,2}[RK]x{3,5}[RK]x{0,2}[RK][RK][RK][RK][PMQL] Potential 22 100 0 ap1_chick,ap1_cotja,junb_cypca,jund_chick,prt2_clupa,ap1_drome,ap1_human,hsp2_horse,hsp3_horse,junb_human,jund_human,ap1_mouse,junb_mouse,jund_mouse,prt5_oncmy,prt6_oncmy,ap1_pig,ap1_rat,junb_rat,jund_rat,ap1_serca,prt1_salir nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 16 72.72 15 93.75 bas: 100 +KR[RK][RK]x{2,4}[RK]x{0,2}Rx{3,5}[RK]x{0,2}[RK]x{0,2}[RK][RK]K Potential 4 100 0 prt_antgr,crep_human,atf2_mouse,atf2_rat nuc,nuc,nuc,nuc +[RK]{3,}?x{8,16}[RK]{4,}? Potential 193 97.92 2.07 hsp1_antla,hsp1_antst,hsp1_antsw,prt_antgr,prta_acist,prtb_acigu,creb_bovin,hsp1_bovin,if2_borbu,pap_bovin,prt1_bufja,prt2_bufja,stp2_bovin,ap1_chick,ap1_cotja,creb_chlvr,crem_canfa,hsp1_caefu,hsp1_cavpo,hsp2_calja,hsp_chick,hsp_cotja,ince_chick,junb_cypca,jund_chick,nucl_chick,prt1_clupa,prt2_clupa,prt3_clupa,ap1_drome,ato_drome,bbf2_drome,brm_drome,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,ssrp_drome,sus_drome,suwa_drome,t2fa_drome,trsf_drome,h1l6_ensmi,nira_emeni,prt1_esolu,hsp2_gorgo,aant_hdvam,aant_hdvd3,aant_hdvit,aant_hdvl1,aant_hdvm1,aant_hdvm2,aant_hdvna,aant_hdvwo,ak95_human,ap1_human,cb80_human,cbf_human,chd3_human,crea_human,creb_human,creb_hydat,crep_human,dpoe_human,gcf_human,hsp1_hylla,hsp2_horse,hsp2_human,hsp2_hylla,hsp3_horse,junb_human,jund_human,moz_human,ngp1_human,nr54_human,psf_human,sfr4_human,sn22_human,sp10_human,t2d1_human,t2fa_human,u2af_human,ve2_hpv04,ve2_hpv41,ve2_hpv60,hsp1_isoma,tf3a_ictpu,ap1_mouse,atf2_mouse,crea_mouse,creb_mouse,crem_mouse,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_mouse,hsp1_murlo,hsp2_macmu,hsp2_macne,hsp2_mouse,ifi3_mouse,junb_mouse,jund_mouse,lyar_mouse,phi1_myted,prt2_mugja,u2af_mouse,hsp1_notty,nit4_neucr,p53_oryla,prt1_oncke,prt2_oncmy,prt3_oncmy,prt4_oncmy,prt5_oncmy,prt6_oncmy,prt7_oncmy,prt8_oncmy,prt9_oncmy,prta_oncmy,prtb_oncmy,a33_plewa,ap1_pig,can3_pig,h2b1_paran,hsp1_parbi,hsp1_pergu,hsp1_phaci,hsp1_pig,hsp1_plagi,hsp1_plain,hsp1_plams,hsp1_plate,hsp1_psecu,hsp2_panpa,hsp2_pantr,hsp2_pig,hsp2_ponpy,prt_perfv,rm14_parte,ak95_rat,ap1_rat,atf2_rat,creb_rat,crem_rat,hsp1_rat,hsp2_rat,junb_rat,jund_rat,ap1_schpo,ap1_serca,h2b1_strpu,hsp1_sagim,hsp1_sarha,hsp1_sheep,prt1_salir,prt1_saror,prt1_scyca,prt1_sepof,prt2_salir,prt2_scyca,prt2_sepof,prt3_salir,prt3_scyca,prt4_scyca,hsp1_tacac,hsp1_trivu,prt1_thuth,prt2_thuth,rm14_tetpy,cych_xenla,pap1_xenla,pap2_xenla,rag1_xenla,sph1_xenla,t2fa_xenla,apn1_yeast,cac1_yeast,cha4_yeast,cyp1_yeast,dbp7_yeast,ly14_yeast,mtr4_yeast,rad5_yeast,reb1_yeast,rok1_yeast,ru1c_yeast,sen1_yeast,sko1_yeast,sof1_yeast,tea1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,mit,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,mit,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[KR]{2}x{0,1}[KR]{2,4}x{25,34}K{2,4}x{1,2}K Potential 155 97.42 2.58 dnb2_ade02,dnb2_ade05,h1_anapl,hxa5_ambme,scr_apime,sr53_arath,hx5l_brare,hxb4_brare,hxb5_brare,hxb6_brare,hxc5_brare,hxd4_brare,zfx_bovin,h101_chick,h103_chick,h110_chick,h11_caeel,h11l_chick,h11r_chick,h12_caeel,h1_chick,h1a_chite,h1o_chith,h5_caimo,h5_chick,hxa4_chick,hxa7_cotja,hxb4_chick,hxb5_chick,hxb6_chick,hxd4_chick,sr72_canfa,tp2a_crigr,hmdf_drome,hmft_drohy,no60_drome,rrp1_drome,scr_drome,suwa_drome,t2fa_drome,hxb4_fugru,atrx_human,h10_human,h1a_human,h1b_human,h1c_human,h1d_human,hxa4_human,hxa5_human,hxa6_human,hxa7_human,hxb4_human,hxb5_human,hxb6_human,hxb7_human,hxc5_human,hxd4_human,if16_human,mec2_human,no56_human,p80c_human,phi0_holtu,sfr4_human,sn24_human,sr72_human,stp2_human,t2d1_human,tat_hv2ca,tat_hv2d1,tat_hv2kr,tat_hv2nz,tat_hv2ro,tat_hv2sb,tat_hv2st,tp2a_human,zfx_human,zfy_human,tf3a_ictpu,h1_lytpi,atrx_mouse,cenc_mouse,form_mouse,h10_mouse,h11_mouse,h12_mouse,h13_mouse,h14_mouse,h15_mouse,h1l_myttr,hxa4_mouse,hxa5_mouse,hxa6_mouse,hxa7_mouse,hxb4_mouse,hxb5_mouse,hxb6_mouse,hxb7_mouse,hxc5_mouse,hxd4_mouse,lyar_mouse,phi1_myted,phi3_mytca,rt02_marpo,tp2a_mouse,zfa_mouse,zfx1_mouse,zfx2_mouse,zfy1_mouse,zfy2_mouse,hxc5_notvi,dpoa_oxytr,h1_oncmy,h1_paran,h10_rat,h12_rat,hxa4_rat,hxa5_rat,hxb7_rat,hxd3_rat,mec2_rat,h1_saltr,h1b_strpu,h1d_strpu,h1e_strpu,h1g_strpu,hxa4_sheep,hxa5_salsa,hxa7_sheep,tat_sivm1,b4_xenla,h1b_xenla,h1c1_xenla,h1c2_xenla,h5a_xenla,h5b_xenla,hb7a_xenla,hb7b_xenla,hxa7_xenla,hxb4_xenla,hxb5_xenla,hxc5_xenla,t2fa_xenla,cbf5_yeast,dpoa_yeast,drs1_yeast,nop2_yeast,nop4_yeast,nop5_yeast,r101_yeast,rad2_yeast,sen1_yeast,tf3b_yeast,top2_yeast,uga3_yeast,ume6_yeast nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,mit,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[KR]{4}x{20,24}K{1,4}xK Experimental 161 97.52 2.48 ath5_arath,ath6_arath,cop1_arath,h5_ansan,hxa5_ambme,hxad_ambme,scr_apime,sr5c_arath,sys_aquae,hx5l_brare,hxad_brare,hxb4_brare,hxb5_brare,hxb6_brare,hxc5_brare,hxc6_brare,hxd4_brare,hxdc_brare,h5_caimo,h5_chick,hmg1_chick,hmga_chick,hxa4_chick,hxa7_cotja,hxab_chick,hxb4_chick,hxb5_chick,hxb6_chick,hxd4_chick,hxd8_chick,hxdb_chick,hxdc_chick,hxdd_chick,ince_chick,sr54_canal,tp2a_crigr,tp2b_chick,tp2b_crilo,hmab_drome,hmdf_drome,hmft_drohy,hmft_drome,hmux_drome,no60_drome,scr_drome,ssrp_drome,t2d2_drome,t2fa_drome,hxb4_fugru,atrx_human,dd16_human,elf1_human,hxa4_human,hxa5_human,hxa6_human,hxa7_human,hxab_human,hxad_human,hxb4_human,hxb5_human,hxb6_human,hxb7_human,hxb8_human,hxbd_human,hxc4_human,hxc5_human,hxc6_human,hxc8_human,hxcb_human,hxcd_human,hxd4_human,hxd8_human,hxdb_human,hxdc_human,hxdd_human,mcm3_human,no56_human,ri14_human,rms1_human,sn24_human,ssrp_human,tp2a_human,tp2b_human,u2af_human,zep1_human,zn46_human,atrx_mouse,elf1_mouse,hes3_mouse,hxa4_mouse,hxa5_mouse,hxa6_mouse,hxa7_mouse,hxab_mouse,hxad_mouse,hxb4_mouse,hxb5_mouse,hxb6_mouse,hxb7_mouse,hxb8_mouse,hxbd_mouse,hxc4_mouse,hxc5_mouse,hxc6_mouse,hxc8_mouse,hxcc_mouse,hxd4_mouse,hxd8_mouse,hxdb_mouse,hxdc_mouse,hxdd_mouse,ldb1_mouse,lyar_mouse,mcm3_mouse,phi1_myted,relb_mouse,tp2a_mouse,tp2b_mouse,u2af_mouse,zep1_mouse,hxc5_notvi,hxc6_notvi,hxdb_notvi,dpoa_oxyno,rms5_penur,dkc1_rat,hes3_rat,hxa4_rat,hxa5_rat,hxb7_rat,hxb8_rat,hxc4_rat,hxc8_rat,hxd3_rat,ssrp_rat,hxa4_sheep,hxa5_salsa,hxa5_sheep,hxa7_sheep,hxc6_sheep,prt4_scyca,hb7a_xenla,hb7b_xenla,hxa7_xenla,hxb4_xenla,hxb5_xenla,hxc5_xenla,hxc6_xenla,ldb1_xenla,sph1_xenla,ubf2_xenla,dpog_yeast,mat2_yeast,msn4_yeast,nop5_yeast,pr05_yeast,rpc2_yeast,sen1_yeast,stp1_yeast,tf3b_yeast,yox1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,pla,,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,mit,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,mit,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[RK]{2,4}x{1,2}[RK]x{0,2}[RK]x{3,5}[RK]x{0,2}[RK][RK]{2,4}[PL] Potential 51 100 0 ap1_chick,ap1_cotja,hsp2_calja,irf1_chick,junb_cypca,jund_chick,prt1_clupa,prt2_clupa,yb1_chick,ap1_drome,hsp1_droau,t2fa_drome,ap1_human,cbp_human,hsp2_horse,hsp3_horse,junb_human,jund_human,no56_human,p300_human,sn22_human,ssrp_human,yb1_human,tf3a_ictpu,ap1_mouse,cbp_mouse,irf1_mouse,junb_mouse,jund_mouse,scp1_mesau,yb1_mouse,prt2_oncmy,prt3_oncmy,prt4_oncmy,prt5_oncmy,prt6_oncmy,prta_oncmy,prtb_oncmy,ap1_pig,hsp2_pig,ap1_rat,irf1_rat,junb_rat,jund_rat,scp1_rat,ap1_serca,prt1_salir,prt4_scyca,sss2_scyca,yb1_xenla,yb3_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +R[RK]x{4,6}[RK][RK]x[RK]x{1,3}[RK][RK][PLQ] Potential 18 100 0 ces2_caeel,h5_caimo,hmgi_human,hmgy_human,nnp1_human,no56_human,tef_human,hmgy_mouse,u2r1_mouse,hsp1_orcor,prt3_oncmy,prt4_oncmy,prtb_oncmy,hsp2_pig,top2_plafk,tef_rat,sss1_scyca,sss2_scyca nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[RK]{3,}?x[RK]x[RK]x{4,9}[RK]{3,}? Potential 88 100 0 hsp1_antst,hsp1_antsw,prt_antgr,hsp1_bovin,ap1_chick,ap1_cotja,hsp1_caefu,hsp_cotja,junb_cypca,jund_chick,prt3_clupa,u2af_caebr,u2af_caeel,ap1_drome,bbf2_drome,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,t2fa_drome,trsf_drome,u2ag_drome,h1l6_ensmi,prt1_esolu,ap1_human,atf3_human,chd3_human,gcf_human,hsp1_horse,junb_human,jund_human,sp10_human,xbp1_human,ap1_mouse,atf3_mouse,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_mouse,hsp1_murlo,junb_mouse,jund_mouse,prt2_mugja,requ_mouse,hsp1_notty,prt1_oncke,prt2_oncmy,prt3_oncmy,prt4_oncmy,prt5_oncmy,prt6_oncmy,prt7_oncmy,prt8_oncmy,prt9_oncmy,prta_oncmy,prtb_oncmy,ap1_pig,hsp1_parbi,hsp1_phaci,hsp1_pig,hsp1_plagi,hsp1_plain,hsp1_plate,hsp1_psecu,prt_perfv,ap1_rat,hsp1_rabit,hsp1_rat,junb_rat,jund_rat,ap1_serca,hsp1_sagim,hsp1_sarha,hsp1_sheep,prt1_saror,prt1_sepof,prt2_salir,prt2_scyca,prt2_sepof,prt4_scyca,hsp1_trivu,prt1_thuth,prt2_thuth,dbp7_yeast,rad4_yeast,sen1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[GA]Rx[RK]x[RK][RK]x[QM] Potential 14 100 0 apte_drome,eya_drome,hmgc_human,rag1_human,dbx_mouse,hmgc_mouse,cys3_neucr,prh_petcr,rag1_rabit,rev_sivai,rev_sivam,rev_sivgb,dbp7_yeast,dpoe_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[PL][RK]{2,3}K[PLI][RK]x[PLI]xK Potential 2 100 0 ra17_schpo,gcn5_yeast nuc,nuc +[PLV]K[RK]x[RK][RK][RK][PL] Potential 15 100 0 dnb2_ade05,ve1_ccpv1,h10_human,no56_human,pu1_human,ve1_hpv11,ve1_hpv44,ve1_hpv6a,ve1_hpv6b,h10_mouse,pu1_mouse,tdg_mouse,ve1_pcpv1,h10_rat,hbpa_wheat nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[PL][PL]x[KR]R[DE][KR][QST] Potential 4 100 0 adf1_drome,gat1_human,gat1_mouse,gat1_rat nuc,nuc,nuc,nuc +[PLQ][KR]x{3,4}KKRK Potential 10 100 0 h2b_caimo,h2b_chick,pap_canal,h2b0_human,h2b_human,h2b1_mouse,h2b2_mouse,lyar_mouse,p53_oryla,hsf_schpo nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +R[PL]xx[KR]{2,}?xx[KR]V Potential 25 100 0 hsp2_alose,prt1_clupa,prt2_clupa,tf2d_chick,hsp2_horse,hsp3_horse,tf2d_human,tf2d_mesau,tf2d_mouse,prt1_oncke,prt2_oncmy,prt5_oncmy,prt6_oncmy,prt7_oncmy,prt8_oncmy,prt9_oncmy,prta_oncmy,prt1_salir,prt2_salir,prt3_salir,tf2d_strpu,tf2d_trifl,tf2d_triga,tf2d_xenla,est1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +R[RK]x[KR]x[RK]{2,}?[DE] Potential 132 100 0 hxa5_ambme,hxb1_ambme,scr_apime,h114_brare,hox3_brafl,hx5l_brare,hxa1_brare,hxb4_brare,hxb5_brare,hxb6_brare,hxc5_brare,hxc6_brare,hxd4_brare,pax6_brare,ctcf_chick,hxa4_chick,hxa7_cotja,hxb1_chick,hxb1_cypca,hxb3_chick,hxb4_chick,hxb5_chick,hxb6_chick,hxd3_chick,hxd4_chick,hxd8_chick,pax6_chick,pax6_cotja,un30_caeel,brm_drome,croc_drome,hmdf_drome,hmft_drohy,hmft_drome,hmux_drome,hmz1_drome,scr_drome,sus_drome,t2d2_drome,hxb4_fugru,ak95_human,cg2f_human,chd3_human,ctcf_human,fre3_human,hxa1_human,hxa3_human,hxa4_human,hxa5_human,hxa6_human,hxa7_human,hxb1_human,hxb3_human,hxb4_human,hxb5_human,hxb6_human,hxb7_human,hxb8_human,hxc4_human,hxc5_human,hxc6_human,hxc8_human,hxd3_human,hxd4_human,hxd8_human,ipf1_human,pax6_human,cx10_mouse,fre3_mouse,gsh2_mouse,gshi_mouse,hxa1_mouse,hxa3_mouse,hxa4_mouse,hxa5_mouse,hxa6_mouse,hxa7_mouse,hxb1_mouse,hxb3_mouse,hxb4_mouse,hxb5_mouse,hxb6_mouse,hxb7_mouse,hxb8_mouse,hxc4_mouse,hxc5_mouse,hxc6_mouse,hxc8_mouse,hxd1_mouse,hxd3_mouse,hxd4_mouse,hxd8_mouse,ipf1_mesau,ipf1_mouse,pax6_mouse,hxc5_notvi,hxc6_notvi,pax6_oryla,dpod_plafk,hxb8_pig,ak95_rat,hxa4_rat,hxa5_rat,hxa7_rat,hxb7_rat,hxb8_rat,hxc4_rat,hxc8_rat,hxd3_rat,ipf1_rat,pax6_rat,h2b1_strpu,h2b2_strpu,hxa4_sheep,hxa5_salsa,hxa5_sheep,hxa7_sheep,hxc6_sheep,hb7a_xenla,hb7b_xenla,hm8_xenla,hxa1_xenla,hxa7_xenla,hxb3_xenla,hxb4_xenla,hxb5_xenla,hxb6_xenla,hxc5_xenla,hxc6_xenla,hxd1_xenla,pax6_xenla,snf2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 119 90.15 116 97.47 hbox: 100 +Rx[KR][KR]K[PLQM]R Potential 6 100 0 ht31_arath,chd4_human,myba_human,tdg_mouse,cys3_neucr,top2_schpo nuc,nuc,nuc,nuc,nuc,nuc +K[KR][KR]RR[KR] Potential 28 100 0 h2b_astru,prt_antgr,prta_acist,brm_drome,atrx_human,mcm3_human,sn22_human,ssrp_human,h2b2_lytpi,atrx_mouse,cbf_mouse,h2b_margl,mcm3_mouse,ssrp_mouse,wc1_neucr,h2b1_paran,h2b2_paran,h2b3_paran,h2b_patgr,h2b_pladu,rpb1_plafd,ssrp_rat,h2bl_strpu,h2bn_strpu,hmgh_strpu,prt1_scyca,prt2_scyca,h2b_ureca nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +KKRR[DE]K Potential 3 100 0 pop1_caeel,ak95_human,ak95_rat nuc,nuc,nuc +KKRRxK Potential 12 100 0 h2b_astru,h2b_chith,pop1_caeel,ato_drome,ak95_human,t2eb_human,vbp1_human,hsf8_lycpe,h2b_margl,u2r1_mouse,ak95_rat,h2bn_strpu nuc,nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc +Kx[PLV][RK][RK]RK Potential 4 100 0 h1_echcr,stp2_mouse,stp2_rat,rpc8_yeast nuc,nuc,nuc,nuc +RRR[PL]RK Potential 5 100 0 myod_caebr,myod_caeel,myod_drome,sum1_lytva,5e5_rat nuc,nuc,nuc,nuc,nuc +[PL]RKRK[PL] Potential 3 100 0 apte_drome,ski_human,cha4_yeast nuc,nuc,nuc +R[RK]{3,}?[DE]K Potential 12 100 0 atf5_human,roa2_human,usf1_human,usf2_human,zep2_human,usf1_mouse,usf2_mouse,usf1_rabit,usf2_rat,usf_strpu,usf1_xenbo,mat2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 10 83.33 10 100 hbox: 10 bas: 90 +[PL]xxKR[IV]K[PL][DE] Potential 5 100 0 myc_calja,myc_human,myc_hylla,myc_pantr,gcn5_yeast nuc,nuc,nuc,nuc,nuc +G{2,4}[RK]x{1,3}G{3} Potential 37 100 0 ddx9_bovin,fus_bovin,hfh2_chick,nucl_chick,ceb_drome,ets4_drome,sr55_drome,cdn1_felca,ak95_human,dnbi_hsv11,dnbi_hsv1k,fbrl_human,mec2_human,nucl_human,roa2_human,rol_human,tyy1_human,ddx9_mouse,fbrl_mouse,nucl_mesau,nucl_mouse,sx21_mouse,tyy1_mouse,h2a1_pea,h2a2_pea,5e5_rat,mec2_rat,nucl_rat,sya_rhime,fbrl_schpo,gar2_schpo,grp1_sinal,grp2_sinal,fbrl_tetth,fbrl_xenla,nucl_xenla,ro22_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[KR]G{2,}?xxG{3,}?[RK] Potential 15 100 0 u2ag_drome,dnbi_hsv11,dnbi_hsv1k,fbrl_human,hme1_human,p72_human,u2ag_human,fbrl_leima,fbrl_mouse,nucl_mesau,fbrl_schpo,grp1_sinal,grp2_sinal,fbrl_xenla,nucl_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[DE][RK]{2,4}[GA]R[PL][GA] Potential 2 100 0 rok_human,dbp2_schpo nuc,nuc +[DE][RK]{3,}?x[KR]{2,}?[PL] Potential 3 100 0 yema_drome,ru1a_human,tf3a_ranpi nuc,nuc,nuc +KxxKxKxKxxxxxRKK Potential 8 100 0 ran_brare,ran_chick,ran_human,ran_mouse,rant_mouse,spi1_schpo,gsp1_yeast,gsp2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +KxKxKxxxxxRKK Potential 11 100 0 ran_brare,ran_chick,atrx_human,ran_human,atrx_mouse,ran_mouse,rant_mouse,requ_mouse,spi1_schpo,gsp1_yeast,gsp2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[RK]x[RK]x[KR]x{4,6}RKK Potential 16 100 0 ran_brare,ince_chick,ran_chick,atrx_human,dd16_human,ran_human,atrx_mouse,hx1a_maize,ran_mouse,rant_mouse,requ_mouse,prt2_scyca,spi1_schpo,apn1_yeast,gsp1_yeast,gsp2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[RK]{4,}?[QMNPL][RK]x{3,4}[RK]{2} Potential 18 100 0 prt1_clupa,prt2_clupa,prt3_clupa,hsp1_droau,prt1_esolu,atrx_human,gcf_human,prt1_oncke,prt2_oncmy,prt3_oncmy,prt4_oncmy,prt5_oncmy,prt6_oncmy,prt9_oncmy,prta_oncmy,prtb_oncmy,prt1_salir,prt2_salir nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[MI]VWSRD[HEQ]RRK Potential 8 100 0 sry_calja,sry_gorgo,sry_halgr,sry_horse,sry_human,sry_macfa,sry_melme,sry_pig nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 8 100 8 100 hmg: 100 +[TS][RK]KK[VLI]R[PL] Potential 4 100 0 hat4_arath,pu1_human,spib_human,pu1_mouse nuc,nuc,nuc,nuc +N[QR]RQ[RK][EG]KR[IVLS] Potential 26 100 0 hmp1_bovin,pou2_brare,oct1_chick,pdm1_drome,pdm2_drome,pdm2_drovi,hmp1_human,oc3a_human,oc3b_human,oct1_human,oct2_human,hmp1_melga,hmp1_mouse,oc11_mouse,oct1_mouse,oct2_mouse,oct3_mouse,hmp1_oncke,hmp1_oncmy,hmp1_pig,oct2_pig,hmp1_rat,sk1a_rat,sk1i_rat,hmp1_sheep,oct1_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 26 100 26 100 hbox: 100 +K[IVQM]RR[VI][STK]L Potential 49 100 0 br11_brare,hmp1_bovin,pou1_brare,sgf3_bommo,zp12_brare,zp23_brare,zp47_brare,zp50_brare,brn3_chick,oct1_chick,un86_caeel,cf1a_drome,ipou_drome,pdm1_drome,pdm2_drome,pdm2_drovi,br3a_human,br3b_human,br3c_human,brn1_human,brn4_human,hmp1_human,oc3n_human,oct1_human,oct2_human,oct6_human,br3a_mouse,br3b_mouse,br3c_mouse,brn1_mouse,brn4_mouse,hmp1_mouse,oc11_mouse,oc3n_mouse,oct1_mouse,oct2_mouse,oct6_mouse,oct2_pig,hmp1_rat,oc3n_rat,oct6_rat,sk1a_rat,sk1i_rat,hmp1_sheep,oct1_xenla,po3a_xenla,po3b_xenla,pou1_xenla,pou2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +WKQ[KR]RKF Potential 18 100 0 tha_chick,thb_chick,tha1_human,tha2_human,thb1_human,tha1_mouse,tha2_mouse,thb1_mouse,thb2_mouse,tha2_rat,tha_ranca,thb1_rat,thb2_rat,thb_ranca,tha1_sheep,thb1_sheep,thaa_xenla,thab_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[LF][STK][VIQM][KR]R[QMVI][STK]L Potential 52 100 0 br11_brare,hmp1_bovin,pou1_brare,sgf3_bommo,zp12_brare,zp23_brare,zp47_brare,zp50_brare,brn3_chick,oct1_chick,un86_caeel,cf1a_drome,ipou_drome,pdm1_drome,pdm2_drome,pdm2_drovi,br3a_human,br3b_human,br3c_human,brn1_human,brn4_human,hmp1_human,oc3a_human,oc3b_human,oc3n_human,oct1_human,oct2_human,oct6_human,br3a_mouse,br3b_mouse,br3c_mouse,brn1_mouse,brn4_mouse,hmp1_mouse,oc11_mouse,oc3n_mouse,oct1_mouse,oct2_mouse,oct3_mouse,oct6_mouse,oct2_pig,hmp1_rat,oc3n_rat,oct6_rat,sk1a_rat,sk1i_rat,hmp1_sheep,oct1_xenla,po3a_xenla,po3b_xenla,pou1_xenla,pou2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +QNRRxKx[RK][RK][DQE] Potential 110 100 0 hxa5_ambme,scr_apime,h114_brare,hox3_brafl,hx5l_brare,hxb4_brare,hxb5_brare,hxb6_brare,hxc5_brare,hxc6_brare,hxd4_brare,hxa2_chick,hxa4_chick,hxa7_cotja,hxb3_chick,hxb4_chick,hxb5_chick,hxb6_chick,hxd3_chick,hxd4_chick,hxd8_chick,vab7_caeel,hmdf_drome,hmev_drome,hmft_drohy,hmft_drome,hmpb_drome,hmux_drome,hmz1_drome,scr_drome,hxb4_fugru,evx1_human,evx2_human,hxa2_human,hxa3_human,hxa4_human,hxa5_human,hxa6_human,hxa7_human,hxb2_human,hxb3_human,hxb4_human,hxb5_human,hxb6_human,hxb7_human,hxb8_human,hxc4_human,hxc5_human,hxc6_human,hxc8_human,hxd3_human,hxd4_human,hxd8_human,ipf1_human,evx1_mouse,evx2_mouse,gsh2_mouse,gshi_mouse,hxa2_mouse,hxa3_mouse,hxa4_mouse,hxa5_mouse,hxa6_mouse,hxa7_mouse,hxb3_mouse,hxb4_mouse,hxb5_mouse,hxb6_mouse,hxb7_mouse,hxb8_mouse,hxc4_mouse,hxc5_mouse,hxc6_mouse,hxc8_mouse,hxd3_mouse,hxd4_mouse,hxd8_mouse,ipf1_mesau,ipf1_mouse,hxa2_notvi,hxc5_notvi,hxc6_notvi,hxa2_rat,hxa4_rat,hxa5_rat,hxa7_rat,hxb7_rat,hxb8_rat,hxc4_rat,hxc8_rat,hxd3_rat,ipf1_rat,hxa4_sheep,hxa5_salsa,hxa5_sheep,hxa7_sheep,hxb2_salsa,hxc6_sheep,hb7a_xenla,hb7b_xenla,hm8_xenla,hx3_xenla,hxa7_xenla,hxb3_xenla,hxb4_xenla,hxb5_xenla,hxb6_xenla,hxc5_xenla,hxc6_xenla,mix1_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 110 100 110 100 hbox: 100 +[QMN]R[RK]xKx[RK][RK] Potential 265 99.622641509434 0.377358490566038 hxa5_ambme,hxa9_ambme,hxad_ambme,hxb1_ambme,rt11_acaca,scr_apime,br11_brare,gsc_brare,h114_brare,hmma_brare,hmmb_brare,hmmc_brare,hmmd_brare,hmx1_bovin,hox3_brafl,hx5l_brare,hxa1_brare,hxad_brare,hxb4_brare,hxb5_brare,hxb6_brare,hxc5_brare,hxc6_brare,hxd4_brare,hxda_brare,hxdc_brare,hxdd_brare,pax6_brare,pou1_brare,pou2_brare,sgf3_bommo,zp12_brare,zp23_brare,zp47_brare,zp50_brare,gsc_chick,hm18_caeel,hmd1_chick,hmx1_chick,hmx2_chick,hmx2_cotja,hxa2_chick,hxa4_chick,hxa7_cotja,hxa9_cavpo,hxa9_chick,hxab_chick,hxb1_chick,hxb1_cypca,hxb3_chick,hxb4_chick,hxb5_chick,hxb6_chick,hxd3_chick,hxd4_chick,hxd8_chick,hxd9_chick,hxda_chick,hxdb_chick,hxdc_chick,hxdd_chick,li11_caeel,mec3_caebr,mec3_caeel,mec3_caevu,oct1_chick,pax6_chick,pax6_cotja,un30_caeel,vab7_caeel,cf1a_drome,gsc_drome,hmab_drome,hmdf_drome,hmdl_drome,hmes_drome,hmev_drome,hmft_drohy,hmft_drome,hmla_drome,hmpb_drome,hmsh_drome,hmux_drome,hmz1_drome,hmz2_drome,pdm1_drome,pdm2_drome,pdm2_drovi,scr_drome,hxa9_fugru,hxb4_fugru,hxc9_fugru,brn1_human,brn4_human,cdx1_human,cdx2_human,evx1_human,evx2_human,hb9_human,hmx1_human,hxa1_human,hxa2_human,hxa3_human,hxa4_human,hxa5_human,hxa6_human,hxa7_human,hxa9_human,hxaa_human,hxab_human,hxad_human,hxb1_human,hxb2_human,hxb3_human,hxb4_human,hxb5_human,hxb6_human,hxb7_human,hxb8_human,hxb9_human,hxbd_human,hxc4_human,hxc5_human,hxc6_human,hxc8_human,hxc9_human,hxcb_human,hxcc_human,hxcd_human,hxd3_human,hxd4_human,hxd8_human,hxd9_human,hxda_human,hxdb_human,hxdc_human,hxdd_human,ipf1_human,oc3a_human,oc3b_human,oc3n_human,oct1_human,oct2_human,oct6_human,pax6_human,pmx1_human,rms1_human,brn1_mouse,brn4_mouse,cdx1_mouse,cdx2_mesau,cdx2_mouse,cdx4_mouse,cx10_mouse,evx1_mouse,evx2_mouse,gsc_mouse,gsh2_mouse,gshi_mouse,hmx1_mouse,hmx2_mouse,hxa1_mouse,hxa2_mouse,hxa3_mouse,hxa4_mouse,hxa5_mouse,hxa6_mouse,hxa7_mouse,hxa9_mouse,hxaa_mouse,hxab_mouse,hxad_mouse,hxb1_mouse,hxb3_mouse,hxb4_mouse,hxb5_mouse,hxb6_mouse,hxb7_mouse,hxb8_mouse,hxb9_mouse,hxbd_mouse,hxc4_mouse,hxc5_mouse,hxc6_mouse,hxc8_mouse,hxc9_mouse,hxca_mouse,hxcb_mouse,hxcc_mouse,hxd1_mouse,hxd3_mouse,hxd4_mouse,hxd8_mouse,hxd9_mouse,hxda_mouse,hxdb_mouse,hxdc_mouse,hxdd_mouse,ipf1_mesau,ipf1_mouse,msx3_mouse,oc11_mouse,oc3n_mouse,oct1_mouse,oct2_mouse,oct3_mouse,oct6_mouse,pax6_mouse,pmx1_mouse,hxa2_notvi,hxc5_notvi,hxc6_notvi,hxdb_notvi,pax6_oryla,hxb8_pig,oct2_pig,cdx1_rat,hxa2_rat,hxa4_rat,hxa5_rat,hxa7_rat,hxb7_rat,hxb8_rat,hxc4_rat,hxc8_rat,hxd3_rat,ipf1_rat,msx2_rat,oc3n_rat,oct6_rat,pax6_rat,sk1a_rat,sk1i_rat,hxa4_sheep,hxa5_salsa,hxa5_sheep,hxa7_sheep,hxb2_salsa,hxc6_sheep,hxc9_sheep,rev_sivm1,gsca_xenla,gscb_xenla,hb7a_xenla,hb7b_xenla,hm8_xenla,hx3_xenla,hxa1_xenla,hxa7_xenla,hxb3_xenla,hxb4_xenla,hxb5_xenla,hxb6_xenla,hxb9_xenla,hxc5_xenla,hxc6_xenla,hxd1_xenla,mix1_xenla,oct1_xenla,pax6_xenla,po3a_xenla,po3b_xenla,pou1_xenla,pou2_xenla,pho2_yeast nuc,nuc,nuc,nuc,mit,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 262 98.86 262 100 hbox: 100 +LKKIKQ Potential 4 100 0 myb_bovin,myb_chick,myb_human,myb_mouse nuc,nuc,nuc,nuc +KxKRQR Potential 10 90 10 rel_avire,rel_chick,vab7_caeel,hmev_drome,evx1_human,evx2_human,evx1_mouse,evx2_mouse,rel_melga,hx3_xenla cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +R[PL]xGx[KR][KR]xK Potential 11 100 0 p53_brare,elg_drome,elk1_human,erf_human,etv2_human,sapa_human,sapb_human,elk1_mouse,erf_mouse,etv2_mouse,sapa_mouse nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 10 90.9 10 100 ets: 100 +KRKx{10,14}[KR]{3,}?x[KR]K Potential 24 100 0 myf5_bovin,ppol_bovin,myf5_chick,myf6_chick,myog_chick,myog_cotja,ppol_chick,myf5_human,myf6_human,myog_human,ppol_human,sum1_lytva,myf5_mouse,myf6_mouse,myog_mouse,ppol_mouse,myf5_notvi,myog_pig,myf6_rat,myog_rat,ppol_rat,myf5_xenla,ppol_xenla,pr08_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RxRRx{4,6}RKK Potential 14 100 0 p53_bovin,p53_cerae,p53_equas,p53_felca,p53_horse,p53_human,p53_macfa,p53_macmu,p53_mouse,p53_rabit,p53_rat,p53_sheep,prt2_scyca,mcm2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +KR{3,}?[LVI] Potential 21 100 0 hxad_ambme,hxad_brare,hxdd_chick,sdc3_caeel,atrx_human,hxad_human,hxcd_human,hxdd_human,ki67_human,ve2_hpv26,ve2_hpv58,ve2_hpv60,atrx_mouse,hxad_mouse,hxcd_mouse,hxdd_mouse,dpod_schpo,ra16_schpo,lama_xenla,rad5_yeast,rox3_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +K[PL]K{3,}?xKK Potential 4 100 0 aant_hdvam,chd4_human,ell_human,t2d4_human nuc,nuc,nuc,nuc +[RK]H[RK]xxx[RK]{2,4}xR Potential 11 100 0 hsp2_horse,hsp3_horse,hap2_klula,hsp2_macmu,hsp2_macne,hsp2_mouse,hsp1_notty,hsp2_pig,hsp2_rat,php2_schpo,hap2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RRxRxKxKQ Potential 5 100 0 ath5_arath,ath6_arath,hat4_arath,hat5_arath,hat7_arath nuc,nuc,nuc,nuc,nuc DNA_BIND 5 100 5 100 hbox: 100 +KRx{1,3}Hx{3,5}R[LQ]RR Potential 20 100 0 myc_astvu,myc_brare,myc1_cypca,myc2_cypca,myc_calja,myc_canfa,myc_carau,myc_chick,myc_felca,myc_human,myc_hylla,myc_marmo,myc_mouse,myc_oncmy,myc_pantr,myc_pig,myc_rat,myc_sheep,myc1_xenla,myc2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 20 100 20 100 bas: 100 +GR[RK]{2,4}xx[RK][QL] Potential 3 100 0 prh_arath,hsp2_hylla,tat_hv1s3 nuc,nuc,nuc +RRKx{5,7}RRR Potential 31 100 0 myf5_bovin,myod_brare,prt1_bufja,prt2_bufja,myf5_chick,myf6_chick,myod_caebr,myod_caeel,myod_chick,myod_cotja,myod_drome,hsp2_gorgo,hsp2_human,myf5_human,myf6_human,myod_human,myf5_mouse,myf6_mouse,myod_mouse,myf5_notvi,myo1_oncmy,myo2_oncmy,hsp2_panpa,hsp2_pantr,hsp2_ponpy,myod_pig,myf6_rat,myod_rat,myod_sheep,myf5_xenla,myod_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +PKRPx{5,8}Lx{2,4}RxKxK Potential 4 100 0 ssrp_chick,ssrp_human,ssrp_mouse,ssrp_rat nuc,nuc,nuc,nuc DNA_BIND 4 100 4 100 hmg: 100 +KKPx{6,9}Kx{1,3}RK Potential 14 100 0 h11_arath,h1_anapl,h101_chick,h103_chick,h110_chick,h11l_chick,h11r_chick,h1_chick,pop1_caeel,h1l_myttr,ku70_mouse,p53_mouse,h2am_rat,t2fa_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +KKRKR[ST] Potential 15 100 0 br3a_chick,brn3_chick,u2af_caebr,u2af_caeel,un86_caeel,br3a_human,br3b_human,h2b0_human,h2b_human,br3a_mouse,br3b_mouse,h2b1_mouse,h2b2_mouse,br3a_rat,h2b_saltr nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RK[RK][QML][RK]xR Potential 18 100 0 ap1_chick,ap1_cotja,junb_cypca,jund_chick,ap1_drome,msl1_drome,ap1_human,junb_human,jund_human,ap1_mouse,junb_mouse,jund_mouse,ap1_pig,ap1_rat,junb_rat,jund_rat,ap1_serca,tfc5_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 16 88.88 15 93.75 bas: 100 +K[RK]{2,}?[QL]x{3,8}R{3} Potential 23 100 0 tha_chick,thb_chick,ato_drome,trsf_drome,nr54_human,tha1_human,tha2_human,thb1_human,thb2_human,tha1_mouse,tha2_mouse,thb1_mouse,thb2_mouse,tha2_rat,tha_ranca,thb1_rat,thb2_rat,prt1_scyca,tha1_sheep,thb1_sheep,thaa_xenla,thab_xenla,cha4_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +[QL]K{2,4}x{8,12}[RK][QL][RK][QL]KR Potential 9 100 0 brn3_chick,un86_caeel,ipou_drome,br3a_human,br3b_human,br3c_human,br3a_mouse,br3b_mouse,br3c_mouse nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 9 100 9 100 hbox: 100 +[RK]K{2,4}x[RK][QL][RK][PL] Potential 5 100 0 rag1_chick,ez_drome,t2d1_drome,no56_human,rag1_oncmy nuc,nuc,nuc,nuc,nuc +RRRK[STC]K Potential 2 100 0 nira_emeni,nit4_neucr nuc,nuc +Rx{2,3}Hx{3,5}RRRR Potential 24 95.83 4.16 leu3_azovi,hsp2_bovin,hsp1_didma,arnt_human,gcf_human,hsp2_hylla,usf1_human,usf2_human,cbf1_klula,arnt_mouse,hsp2_macmu,hsp2_macne,usf1_mouse,usf2_mouse,hsp1_notty,hsp2_ponpy,prt_perfv,arnt_rabit,arnt_rat,usf1_rabit,usf2_rat,usf_strpu,usf1_xenbo,cbf1_yeast cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RK]{2,4}[PL][RK]x{7,11}[RK][QL]KH Potential 2 100 0 hmen_artsf,hmin_drome nuc,nuc +RKRx{12,16}RRKK Potential 12 100 0 creb_bovin,creb_chlvr,crem_canfa,chd3_human,crea_human,creb_human,creb_hydat,crea_mouse,creb_mouse,crem_mouse,creb_rat,crem_rat nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 11 91.66 11 100 bas: 100 +KR[GPL]R[GPL]R[GLP]RK Potential 7 100 0 t2d1_drome,hmgc_human,hmgi_human,hmgy_human,hmgc_mouse,hmgy_mouse,prh_petcr nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 7 100 9 128.57 hook: 100 +KR{2,4}x{3,6}[RK]{2,4}x{0,2}KR Potential 2 100 0 t2d1_drome,prt2_scyca nuc,nuc +KHLKGR Potential 12 100 0 myb_bovin,myb_chick,myba_chick,mybb_chick,myb_human,myba_human,mybb_human,myb_mouse,myba_mouse,mybb_mouse,myb_xenla,myba_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RRxRxRKQ Potential 16 100 0 gbf1_arath,gbf2_arath,gbf3_arath,gsbd_drome,hmpr_drome,pax3_human,pax7_human,ocs1_maize,pax3_mouse,pax7_mouse,cpr1_petcr,cpr2_petcr,cpr3_petcr,taf1_tobac,emp1_wheat,hbpa_wheat nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 16 100 16 100 hbox: 37.5 bas: 62.5 +KRxRxxRRLK Potential 5 100 0 dbp_human,tef_human,dbp_mouse,dbp_rat,tef_rat nuc,nuc,nuc,nuc,nuc +KKRKRT Potential 8 100 0 br3a_chick,brn3_chick,un86_caeel,br3a_human,br3b_human,br3a_mouse,br3b_mouse,br3a_rat nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 8 100 8 100 hbox: 100 +KRGRGRPRK Potential 7 100 0 t2d1_drome,hmgc_human,hmgi_human,hmgy_human,hmgc_mouse,hmgy_mouse,prh_petcr nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 7 100 15 214.28 hook: 100 +RR[TS]x[QK][KR][KNS] Potential 41 100 0 vdr_bovin,tha_chick,thb_chick,vdr_chick,vdr_cotja,dnl4_human,rrb2_human,rrg1_human,rrg2_human,tha1_human,tha2_human,thb1_human,thb2_human,vdr_human,hmgt_mouse,rra_mouse,rrb_mouse,rrg1_mouse,rrg2_mouse,tha1_mouse,tha2_mouse,thb1_mouse,thb2_mouse,vdr_mouse,rra_notvi,rrb_notvi,tha2_rat,tha_ranca,thb1_rat,thb2_rat,thb_ranca,vdr_rat,h1s_strpu,tha1_sheep,thb1_sheep,rra_xenla,rrg1_xenla,rrg2_xenla,thaa_xenla,thab_xenla,vdr_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RxR{2,}?[QL]x[ST]R Potential 5 100 0 trsf_drome,gcf_human,rfx1_human,hsp1_tacac,prt1_thuth nuc,nuc,nuc,nuc,nuc +[RK]{2,4}x{2,4}[QLM][RK]x{2,3}[RK]KR Potential 5 100 0 ra14_canal,sdc3_caeel,spib_human,rag2_xenla,mcm3_yeast nuc,nuc,nuc,nuc,nuc +[DE]KK[PL][GL]K[GL] Potential 4 100 0 croc_drome,fre3_human,rbl2_human,fre3_mouse nuc,nuc,nuc,nuc +[QL]xKRxKxKK Potential 25 96 4 hme3_apime,hme6_apime,if2_aquae,hme1_brare,hme2_brare,hme3_brare,isl1_brare,isl2_brare,isl3_brare,hme1_chick,hme2_chick,isl1_chick,isl2_chick,hmen_drome,hmen_drovi,hmin_drome,hme1_human,hme2_human,isl1_human,hme1_mouse,hme2_mouse,is2a_oncts,is2b_oncts,isl3_oncts,isl2_rat nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 24 100 24 100 hbox: 100 +DK[QL]KK[QL] Potential 5 100 0 dpoa_human,myba_human,dpoa_mouse,myba_mouse,dpoa_rat nuc,nuc,nuc,nuc,nuc DNA_BIND 5 100 6 120 myb: 100 +KR[ST]RxxR{2,4}[QL]K Potential 6 100 0 ces2_caeel,dbp_human,tef_human,dbp_mouse,dbp_rat,tef_rat nuc,nuc,nuc,nuc,nuc,nuc +K[RK]{2,4}[ST]H Potential 29 96.55 3.44 myc_brare,myc1_cypca,myc2_cypca,myc_calja,myc_canfa,myc_carau,myc_chick,myc_felca,clk1_human,myc_human,myc_hylla,zep1_human,clk1_mouse,mcm3_mouse,myc_marmo,myc_mouse,zep1_mouse,myc_oncmy,p53_oryla,myc_pantr,myc_pig,myc_rat,myc_sheep,sye_theth,myc1_xenla,myc2_xenla,esp1_yeast,rpc2_yeast,snf6_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc +RH[RK]Hx{2,4}[RK]{2,4}[PL]R Potential 3 100 0 hap2_klula,php2_schpo,hap2_yeast nuc,nuc,nuc +R[RK]{2,4}x{15,19}[RK]{2,4}[QLM]K Potential 7 100 0 andr_human,hxcc_human,andr_mouse,dbx_mouse,andr_rabit,andr_rat,rme1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc +K{3,4}R{2,3} Potential 15 100 0 h2b_chith,t2d1_drome,atrx_human,nnp1_human,sn22_human,ssrp_human,t2d1_human,tcf1_human,zfy_human,atrx_mouse,ssrp_mouse,tcf1_mouse,h2b_pladu,ssrp_rat,h2b_ureca nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +R{2,3}xK{2,3}R[ST] Potential 12 100 0 oct1_chick,pdm1_drome,pdm2_drome,pdm2_drovi,oct1_human,oct2_human,oct1_mouse,oct2_mouse,oct2_pig,dpol_rcmvm,oct1_rat,oct1_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 11 91.66 11 100 hbox: 100 +RKR{3,5}[ST] Potential 4 100 0 mb11_copci,tat_sivmk,tat_sivml,yox1_yeast nuc,nuc,nuc,nuc +Q[RK][HRK][RK]xRR Potential 17 100 0 prtb_acigu,tra1_caebr,sus_drome,atrx_human,fre4_human,hsp2_hylla,atrx_mouse,hsp1_notty,hsp1_phaci,hsp1_plams,hsp1_sagim,rev_siva1,rev_sivag,rev_sivat,rev_sivs4,rev_sivsp,mcm2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +RRR{3,5}T Potential 5 100 0 prt1_bufja,prt2_bufja,hsp1_plain,prt_perfv,hsp1_sagim nuc,nuc,nuc,nuc,nuc +D[KR]x{0,1}[QL][RK]{2,3}R Potential 9 100 0 qin_avis3,ftf1_drome,mam_drome,ceba_human,cg2f_human,ceba_mouse,rag1_mouse,ceba_rat,rpc8_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +Px[PQLVMN][KR]{2,3}xKQ Potential 7 100 0 myb_bovin,myb_chick,cbf_human,myb_human,myb_mouse,h1c1_xenla,myb_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc +PKKKxRK Potential 7 100 0 dnb2_ade04,dnb2_ade07,dnb2_ade40,dnb2_ade41,baso_human,nil2_human,h1l_myttr nuc,nuc,nuc,nuc,nuc,nuc,nuc +KRx{10}KKKL Experimental 1 100 0 ifi3_mouse nuc +KRQRx{20}KKSKK Experimental 1 100 0 cenf_human nuc +RRRx{11}KRRK Experimental 1 100 0 cb80_human nuc +RKRIREDRKATTAQKVQQMKQRLNENERKRKR Experimental 1 0 100 ptn2_human cyt +KRKRRP Experimental 0 0 0 +PKKNRLRRP Experimental 0 0 0 +QRKRQK Experimental 0 0 0 +HRIEEKRKRTYETFKSI Experimental 0 0 0 +KKKYKLK Experimental 0 0 0 +KSKKKAQ Experimental 0 0 0 +LKRPRSPSS Experimental 0 0 0 +KRKx{22}KELQKQITK Experimental 0 0 0 +GKKKYKLKH Experimental 0 0 0 +KKKYKLK Experimental 0 0 0 +KSKKKAQ Experimental 0 0 0 +KKKRERLD Experimental 0 0 0 +RKKRKx{9}KAKKSK Experimental 0 0 0 +RRPSx{22}RRKRQ Experimental 0 0 0 +HKKKKIRTSPTFTTPKTLRLRRQPKYPRKSAPRRNKLDHY Experimental 0 0 0 +YLTQETNKVETYKEQPLKTPGKKKKGKP Experimental 0 0 0 +NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY Experimental 0 0 0 +MAPSAKATAAKKAVVKGTNGKKALKVRTSATFRLPKTLKLAR Experimental 0 0 0 +SANKVTKNKSNSSPYLNKRGKPGPDS Experimental 0 0 0 +[KR]XXKNKX{6,8}K[KR] Potential 12 100 0 det1_arath,bbf2_drome,cbp_human,hmgc_human,p300_human,cbp_mouse,h1l_myttr,hmgc_mouse,tf3a_ranpi,nucl_xenla,pho4_yeast,pr43_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc +KKx{15}KKRK Experimental 1 100 0 apn1_yeast nuc +RKRKK Experimental 36 100 0 br11_brare,pou1_brare,sgf3_bommo,zp12_brare,zp23_brare,zp47_brare,zp50_brare,cf1a_drome,sus_drome,trx_drome,brn1_human,brn4_human,chd3_human,if16_human,oc3n_human,oct6_human,t2d1_human,brn1_mouse,brn4_mouse,elf1_mouse,oc11_mouse,oc3n_mouse,oct6_mouse,oc3n_rat,oct6_rat,sk1a_rat,sk1i_rat,dpoa_schpo,hm16_xenla,hm19_xenla,hm20_xenla,po3a_xenla,po3b_xenla,pou1_xenla,pou2_xenla,sko1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc \ No newline at end of file
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/tools/predictnls/README.rst Fri Oct 11 04:35:15 2013 -0400 @@ -0,0 +1,104 @@ +Python re-implementation of predictNLS with Galaxy wrapper +========================================================== + +This Galaxy tool is copyright 2011-2013 by Peter Cock, The James Hutton Institute +(formerly SCRI, Scottish Crop Research Institute), UK. All rights reserved. +See the licence text below. + +The tool consists of a Galaxy interface definition (predictnls.xml), and a Python +script (predictnls.py) which re-implements the command line tool predictNLS. This +should match the behaviour of predictNLS v1.0.20 (July 2011), the current latest +release from the Rost Lab, see http://rostlab.org and their paper: + +Murat Cokol, Rajesh Nair, and Burkhard Rost. +Finding nuclear localization signals. +EMBO reports 1(5), 411–415, 2000 +http://dx.doi.org/10.1093/embo-reports/kvd092 + +This wrapper is available from the Galaxy Tool Shed at +http://toolshed.g2.bx.psu.edu/view/peterjc/tmhmm_and_signalp + + +Automatic Installation +====================== + +This Galaxy tool is self contained, and so should install automatically via the +Galaxy Tool Shed. See http://toolshed.g2.bx.psu.edu/view/peterjc/predictnls + + +Manual Installation +=================== + +There are just four files which should be moved under the Galaxy tools folder, +e.g. in a tools/protein_analysis filter: + +* predictlns.xml (the Galaxy tool definition) +* predictlns.py (the Python script) +* predictlns.txt (this README file) +* My_NLS_list (the default set of NLS motifs from the Rost Lab) + +You will also need to modify the tools_conf.xml file to tell Galaxy to offer the +tool. If you are using other protein analysis tools like TMHMM or SignalP, put +it next to them. Just add the line:: + + <tool file="protein_analysis/predictnls.xml" /> + +If you want to run the unit tests, also add this to tool_conf.xml.sample, and +copy the test files under test-data, then run:: + + ./run_functional_tests.sh -id predictnls + +That's it. + + +History +======= + +======= ====================================================================== +Version Changes +------- ---------------------------------------------------------------------- +v0.0.4 - Initial public release. +v0.0.5 - Treat non-zero return codes as errors. +v0.0.6 - Link to Tool Shed added to help text and this documentation. + - Use reStructuredText for this README file. + - Updated citation information (Cock et al. 2013). + - Development moved to GitHub, https://github.com/peterjc/pico_galaxy +======= ====================================================================== + + +Developers +========== + +This script and related tools are being developed on the following hg branch: +http://bitbucket.org/peterjc/galaxy-central/src/tools + +For making the "Galaxy Tool Shed" http://toolshed.g2.bx.psu.edu/ tarball use +the following command from the Galaxy root folder:: + + $ tar -czf predictnls.tar.gz tools/predictnls/README.rst tools/predictnls/predictnls.xml tools/predictnls/predictnls.py tools/predictnls/My_NLS_list test-data/four_human_proteins.fasta test-data/four_human_proteins.predictnls.tabular + +Check this worked:: + + $ tar -tzf predictnls.tar.gz + tools/predictnls/README.rst + tools/predictnls/predictnls.xml + tools/predictnls/predictnls.py + tools/predictnls/My_NLS_list + test-data/four_human_proteins.fasta + test-data/four_human_proteins.predictnls.tabular + + +Licence (GPL) +============= + +This tool is open source, licensed under the GNU GENERAL PUBLIC LICENSE +version 3 (GNU v3), see http://www.gnu.org/licenses/gpl.html + +The Python script is my reimplementation of the original Perl program from +the Rost Lab, which was released under the GPL v3. Therefore, as I consider +this to be a derivative work, this too is released under the GPL v3. + +Please note that the My_NLS_list should be an exact copy of the file of the +same name included with predictnls-1.0.7.tar.gz to predictnls-1.0.20.tar.gz +inclusive (the list was extended in v1.0.7 in August 2010, see the change log +included in those tar-balls), available from ftp://rostlab.org/predictnls/
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/tools/predictnls/predictnls.py Fri Oct 11 04:35:15 2013 -0400 @@ -0,0 +1,167 @@ +#!/usr/bin/env python + +#Copyright 2011-2013 by Peter Cock, James Hutton Institute (formerly SCRI), UK +# +#Licenced under the GPL (GNU General Public Licence) version 3. +# +#Based on Perl script predictNLS v1.3, copyright 2001-2005 and the later +#versions up to predictnls v1.0.20 (copright 2012), by Rajesh Nair +#(nair@rostlab.org) and Burkhard Rost (rost@rostlab.org), Rost Lab, +#Columbia University http://rostlab.org/ + +"""Batch mode predictNLS, for finding nuclear localization signals + +This is a Python script re-implementing the predictNLS method, originally +written in Perl, described here: + +Murat Cokol, Rajesh Nair, and Burkhard Rost. +Finding nuclear localization signals. +EMBO reports 1(5), 411-415, 2000 + +http://dx.doi.org/10.1093/embo-reports/kvd092 + +The original Perl script was designed to work on a single sequence at a time, +but offers quite detailed output, including HTML (webpage). + +This Python version is designed to work on a single FASTA file containing +multiple sequences, and produces a single tabular output file, with one line +per NLS found (i.e. zero or more rows per query sequence). + +It takes either two or three command line arguments: + +predictNLS_batch input_file output_file [nls_motif_file] + +The input file should be protein sequences in FASTA format, the output file +is tab separated plain text, and the NLS motif file defaults to using the +plain text My_NLS_list file located next to the script file, or in a data +subdirectory. + +For convience if using this outside Galaxy, the input filename can be '-' +to mean stdin, and likewise the output filename can be '-' to mean stdout. + +Tested with the My_NLS_list file included with predictnls-1.0.7.tar.gz to +predictnls-1.0.20.tar.gz inclusive (the list was extended in v1.0.7 in +August 2010, see the change log included in those tar-balls). + +The Rost Lab provide source code tar balls for predictNLS on the FTP site +ftp://rostlab.org/predictnls/ but for Debian or RedHat based Linux they +recommend their package repository instead, +https://rostlab.org/owiki/index.php/Packages +""" + +import os +import sys +import re + +def stop_err(msg, return_code=1): + sys.stderr.write(msg.rstrip() + "\n") + sys.exit(return_code) + +if len(sys.argv) == 4: + fasta_filename, tabular_filename, re_filename = sys.argv[1:] +elif len(sys.argv) == 3: + fasta_filename, tabular_filename = sys.argv[1:] + #Use os.path.realpath(...) to handle being called via a symlink + #Try under subdirectory data: + re_filename = os.path.join(os.path.dirname(os.path.realpath(sys.argv[0])), + "data", "My_NLS_list") + if not os.path.isfile(re_filename): + #Try in same directory as this script: + re_filename = os.path.join(os.path.dirname(os.path.realpath(sys.argv[0])), + "My_NLS_list") +else: + stop_err("Expect 2 or 3 arguments: input FASTA file, output tabular file, and NLS motif file") + +if not os.path.isfile(fasta_filename): + stop_err("Could not find FASTA input file: %s" % fasta_filename) + +if not os.path.isfile(re_filename): + stop_err("Could not find NLS motif file: %s" % re_filename) + +def load_re(filename): + """Parse the 5+ column tabular NLS motif file.""" + handle = open(filename, "rU") + for line in handle: + line = line.rstrip("\n") + if not line: + continue + parts = line.split("\t") + assert 5 <= len(parts), parts + regex, evidence, p_count, percent_nuc, precent_non_nuc = parts[0:5] + try: + regex = re.compile(regex) + p_count = int(p_count) + except ValueError: + stop_err("Bad data in line: %s" % line) + if 6 <= len(parts): + proteins = parts[5] + assert p_count == len(proteins.split(",")), line + else: + proteins = "" + assert p_count == 0 + if 7 <= len(parts): + domains = parts[6] + assert int(p_count) == len(domains.split(",")), line + else: + domains = "" + assert p_count == 0 + #There can be further columns (DNA binding?), but we don't use them. + yield regex, evidence, p_count, percent_nuc, proteins, domains + handle.close() + +def fasta_iterator(filename): + """Simple FASTA parser yielding tuples of (name, upper case sequence).""" + if filename == "-": + handle = sys.stdin + else: + handle = open(filename) + name, seq = "", "" + for line in handle: + if line.startswith(">"): + if name: + yield name, seq + #Take the first word only as the name: + name = line[1:].rstrip().split(None,1)[0] + seq = "" + elif name: + #Simple way would leave in any internal white space, + #seq += line.strip().upper() + seq += "".join(line.strip().upper().split()) + elif not line.strip(): + #Ignore blank lines before first record + pass + else: + raise ValueError("Bad FASTA line %r" % line) + if filename != "-": + handle.close() + if name: + yield name, seq + raise StopIteration + +motifs = list(load_re(re_filename)) +print "Looking for %i NLS motifs" % len(motifs) + +if tabular_filename == "-": + out_handle = sys.stdout +else: + out_handle = open(tabular_filename, "w") +out_handle.write("#ID\tNLS start\tNLS seq\tNLS pattern\tType\tProtCount\t%NucProt\tProtList\tProtLoci\n") +count = 0 +nls = 0 +for idn, seq in fasta_iterator(fasta_filename): + for regex, evidence, p_count, percent_nuc_prot, proteins, domains in motifs: + #Perl predictnls v1.0.17 (and older) take right most hit only, Bug #40 + #This has been fixed (v1.0.18 onwards, June 2011), so we return all the matches + for match in regex.finditer(seq): + #Perl predictnls v1.0.17 (and older) return NLS start position with zero + #but changed to one based counting in v1.0.18 (June 2011) onwards, Bug #38 + #We therefore also use one based couting, hence the start+1 here: + out_handle.write("%s\t%i\t%s\t%s\t%s\t%i\t%s\t%s\t%s\n" \ + % (idn, match.start()+1, match.group(), + regex.pattern, evidence, p_count, + percent_nuc_prot, proteins, domains)) + nls += 1 + count += 1 +if tabular_filename != "-": + out_handle.close() +print "Found %i NLS motifs in %i sequences" % (nls, count)
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/tools/predictnls/predictnls.xml Fri Oct 11 04:35:15 2013 -0400 @@ -0,0 +1,97 @@ +<tool id="predictnls" name="PredictNLS" version="0.0.6"> + <description>Find nuclear localization signals (NLSs) in protein sequences</description> + <command interpreter="python"> + predictnls.py $fasta_file $tabular_file + </command> + <stdio> + <!-- Assume anything other than zero is an error --> + <exit_code range="1:" /> + <exit_code range=":-1" /> + </stdio> + <inputs> + <param name="fasta_file" type="data" format="fasta" label="FASTA file of protein sequences"/> + </inputs> + <outputs> + <data name="tabular_file" format="tabular" label="predictNLS results" /> + </outputs> + <tests> + <test> + <param name="fasta_file" value="four_human_proteins.fasta"/> + <output name="tabular_file" file="four_human_proteins.predictnls.tabular"/> + </test> + </tests> + <requirements> + <requirement type="binary">predictnls</requirement> + </requirements> + <help> + +**What it does** + +This calls a Python re-implementation of the PredictNLS tool for prediction of +nuclear localization signals (NLSs), which works by looking for matches to +a known set of patterns (described using regular expressions). + +The input is a FASTA file of protein sequences, and the output is tabular with +these columns (multiple rows per protein): + +====== ========================================================================== +Column Description +------ -------------------------------------------------------------------------- + 1 Sequence identifier + 2 Start of NLS + 3 NLS sequence + 4 NLS pattern (regular expression) + 5 Number of reference proteins with this NLS + 6 Percentage of reference proteins with this NLS which are nuclear localized + 7 Comma separated list of reference proteins + 8 Comma separated list of reference proteins' localizations +====== ========================================================================== + +If a sequence has no predicted NLS, then there is no line in the output file +for it. This is a simplification of the text rich output from the command line +tool, to give a tabular file suitable for use within Galaxy. + +Information about potential DNA binding (shown in the original predictnls +tool) is not given. + +**Localizations** + +The following abbreviations are used (derived from SWISS-PROT): + +==== ======================= +Abbr Localization +---- ----------------------- +cyt Cytoplasm +pla Chloroplast +ret Eendoplasmic reticululm +ext Extracellular +gol Golgi +lys Lysosomal +mit Mitochondria +nuc Nuclear +oxi Peroxisom +vac Vacuolar +rip Periplasmic +==== ======================= + +**References** + +If you use this Galaxy tool in work leading to a scientific publication please +cite the following papers: + +Peter J.A. Cock, Björn A. Grüning, Konrad Paszkiewicz and Leighton Pritchard (2013). +Galaxy tools and workflows for sequence analysis with applications +in molecular plant pathology. PeerJ 1:e167 +http://dx.doi.org/10.7717/peerj.167 + +Murat Cokol, Rajesh Nair, and Burkhard Rost (2000). +Finding nuclear localization signals. +EMBO reports 1(5), 411–415 +http://dx.doi.org/10.1093/embo-reports/kvd092 + +See also http://rostlab.org + +This wrapper is available to install into other Galaxy Instances via the Galaxy +Tool Shed at http://toolshed.g2.bx.psu.edu/view/peterjc/predictnls + </help> +</tool>
--- a/tools/protein_analysis/My_NLS_list Wed Feb 20 11:39:06 2013 -0500 +++ /dev/null Thu Jan 01 00:00:00 1970 +0000 @@ -1,310 +0,0 @@ -RRMKWKK Experimental 77 100 0 hxa5_ambme,scr_apime,hx5l_brare,hxb4_brare,hxb5_brare,hxb6_brare,hxc5_brare,hxc6_brare,hxd4_brare,hxa4_chick,hxa7_cotja,hxb4_chick,hxb5_chick,hxb6_chick,hxd4_chick,hxd8_chick,hmdf_drome,scr_drome,hxb4_fugru,hxa4_human,hxa5_human,hxa6_human,hxa7_human,hxb4_human,hxb5_human,hxb6_human,hxb7_human,hxb8_human,hxc4_human,hxc5_human,hxc6_human,hxc8_human,hxd4_human,hxd8_human,ipf1_human,hxa4_mouse,hxa5_mouse,hxa6_mouse,hxa7_mouse,hxb4_mouse,hxb5_mouse,hxb6_mouse,hxb7_mouse,hxb8_mouse,hxc4_mouse,hxc5_mouse,hxc6_mouse,hxc8_mouse,hxd4_mouse,hxd8_mouse,ipf1_mesau,ipf1_mouse,hxc5_notvi,hxc6_notvi,hxb8_pig,hxa4_rat,hxa5_rat,hxa7_rat,hxb7_rat,hxb8_rat,hxc4_rat,hxc8_rat,ipf1_rat,hxa4_sheep,hxa5_salsa,hxa5_sheep,hxa7_sheep,hxc6_sheep,hb7a_xenla,hb7b_xenla,hm8_xenla,hxa7_xenla,hxb4_xenla,hxb5_xenla,hxb6_xenla,hxc5_xenla,hxc6_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RVHPYQR Experimental 0 0 0 -KRPACTLKPECVQQLLVCSQEAKK Experimental 0 0 0 -PKKKRKV Experimental 3 100 0 tala_povba,tala_povbk,tala_sv40 nuc,nuc,nuc -GKKRSKA Experimental 2 100 0 ppol_drome,h2b1_yeast nuc,nuc -KAKRQR Experimental 3 66.6666666666667 33.3333333333333 rel_avire,rel_chick,rel_melga cyt,nuc,nuc -RGRRRRQR Experimental 0 0 0 -RKRRR Experimental 20 85 15 ht31_arath,mb11_copci,sdc3_caeel,chd3_human,sn22_human,ve2_hpv04,ve2_hpv07,ve2_hpv40,atf3_mouse,rms5_neucr,h2b_patgr,rpb1_plafd,fre6_rat,spm1_rat,leu3_salty,prt2_scyca,tat_sivmk,tat_sivml,leu3_theaq,yox1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,mit,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,cyt,nuc -PPVKRERTS Experimental 0 0 0 -PYLNKRKGKP Experimental 0 0 0 -CYGSKNTGAKKRKIDDA Experimental 0 0 0 -KKKKRKREK Experimental 1 100 0 lef1_mouse nuc -KKKRRSREK Experimental 2 100 0 tcf1_human,tcf1_mouse nuc,nuc -KRx{7,9}PQPKKKP Experimental 6 100 0 p53_bovin,p53_cerae,p53_human,p53_macfa,p53_macmu,p53_spebe nuc,nuc,nuc,nuc,nuc,nuc -KVTKRKHDNEGSGSKRPK Experimental 1 100 0 ku70_human nuc -RLKKLKCSKx{19}KTKR Experimental 1 100 0 gal4_yeast nuc -RRERx{4}RPRKIPR Experimental 0 0 0 -KKKKKEEEGEGKKK Experimental 0 0 0 -PRPRKIPR Experimental 0 0 0 -PPRIYPQLPSAPT Experimental 0 0 0 -KDCVINKHHRNRCQYCRLQR Experimental 0 0 0 -KRx{9}KTKK Experimental 0 0 0 -APKRKSGVSKC Experimental 0 0 0 -RKKRRQRRR Experimental 17 100 0 tat_hv112,tat_hv1a2,tat_hv1b1,tat_hv1b5,tat_hv1br,tat_hv1c4,tat_hv1h2,tat_hv1jr,tat_hv1ma,tat_hv1mn,tat_hv1oy,tat_hv1pv,tat_hv1s1,tat_hv1sc,tat_hv1y2,tat_hv1z2,tat_hv1z6 nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RQARRNRRRRWR Experimental 26 100 0 rev_hv112,rev_hv1a2,rev_hv1b1,rev_hv1b8,rev_hv1bn,rev_hv1br,rev_hv1c4,rev_hv1el,rev_hv1h2,rev_hv1j3,rev_hv1jr,rev_hv1lw,rev_hv1ma,rev_hv1mn,rev_hv1nd,rev_hv1oy,rev_hv1pv,rev_hv1rh,rev_hv1s1,rev_hv1s3,rev_hv1sc,rev_hv1w2,rev_hv1y2,rev_hv1z2,rev_hv1z6,rev_hv1z8 nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -MPKTRRRPRRSQRKRPPT Experimental 0 0 0 -KRPMNAFIVWSRDQRRK Experimental 4 100 0 sry_calja,sry_gorgo,sry_human,sry_pig nuc,nuc,nuc,nuc -RPRRK Experimental 16 100 0 sox2_chick,sox3_chick,sry_calja,sry_caphi,sry_gorgo,sox2_human,sox3_human,sry_horse,sry_human,sox2_mouse,sox3_mouse,sx18_mouse,sry_pig,sox2_sheep,sry_sheep,sox3_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -KRPMNAFMVWAQAARRK Experimental 1 100 0 sx21_mouse nuc -PRRRK Experimental 1 100 0 sx21_mouse nuc -[KAR]TPIQKHWRPTVLTEGPPVKIRIETGEWE[KA] Experimental 0 0 0 -PPRKKRTVV Experimental 0 0 0 -YKRPCKRSFIRFI Experimental 0 0 0 -LKDVRKRKLGPGH Experimental 0 0 0 -KRPRP Experimental 4 100 0 ebn2_ebv,tala_povm3,tala_povma,tala_povmc nuc,nuc,nuc,nuc -RRSMKRK Experimental 7 100 0 vdr_bovin,vdr_chick,vdr_cotja,vdr_human,vdr_mouse,vdr_rat,vdr_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc -PAKRARRGYK Experimental 0 0 0 -RKCLQAGMNLEARKTKK Experimental 8 100 0 gcr_aotna,gcr_human,gcr_mouse,gcr_rat,gcr_sagoe,gcr_saibb,gcr_tupgb,gcr_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RRERNKMAAAKCRNRRR Experimental 5 100 0 fos_chick,fos_cypca,fos_human,fos_mouse,fos_rat nuc,nuc,nuc,nuc,nuc -KRMRNRIAASKCRKRKL Experimental 7 100 0 ap1_chick,ap1_cotja,ap1_human,ap1_mouse,ap1_pig,ap1_rat,ap1_serca nuc,nuc,nuc,nuc,nuc,nuc,nuc -KKSKKGRQEALERLKKA Experimental 3 100 0 dpoa_human,dpoa_mouse,dpoa_rat nuc,nuc,nuc -RKEWLTNFMEDRRQRKL Experimental 3 100 0 tp2a_human,tp2a_mouse,tp2a_rat nuc,nuc,nuc -KKQTTLAFKPIKKGKKR Experimental 2 100 0 tp2a_crigr,tp2a_human nuc,nuc -RKRKKMPASQRSKRRKT Experimental 0 0 0 -RAIKRRPGLDFDDDGEGNSKFLR Experimental 1 100 0 arnt_human nuc -SxGTKRSYxxM Experimental 0 0 0 -TKRSxxxM Experimental 1 100 0 cha4_yeast nuc -RIRKKLR Experimental 0 0 0 -KRAAEDDEDDDVDTKKQK Experimental 2 100 0 thya_bovin,thya_human nuc,nuc -GRKRKKRT Experimental 28 100 0 br11_brare,pou1_brare,sgf3_bommo,zp12_brare,zp23_brare,zp47_brare,zp50_brare,cf1a_drome,brn1_human,brn4_human,oc3n_human,oct6_human,brn1_mouse,brn4_mouse,oc11_mouse,oc3n_mouse,oct6_mouse,oc3n_rat,oct6_rat,sk1a_rat,sk1i_rat,hm16_xenla,hm19_xenla,hm20_xenla,po3a_xenla,po3b_xenla,pou1_xenla,pou2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -REKKEKEQKEKCA Experimental 0 0 0 -LEKKVKKKFDWCA Experimental 0 0 0 -TEKK[QG]KSILYDCA Experimental 0 0 0 -SDKKVRSRLIECA Experimental 0 0 0 -LKRKLQR Experimental 8 100 0 pax6_brare,pax6_chick,pax6_cotja,pax6_human,pax6_mouse,pax6_oryla,pax6_rat,pax6_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RRKGKEK Experimental 2 0 100 hd_human,hd_mouse cyt,cyt -CKRKTTNADRRKA Experimental 10 100 0 myod_brare,myod_chick,myod_cotja,myod_human,myod_mouse,myo1_oncmy,myod_pig,myod_rat,myod_sheep,myod_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -VNEAFETLKRC Experimental 7 100 0 myod_chick,myod_cotja,myod_human,myod_mouse,myod_pig,myod_rat,myod_sheep nuc,nuc,nuc,nuc,nuc,nuc,nuc -MPTEERVRKRKESNRESARRSRYRKAAHLK Experimental 0 0 0 -KVNSRKRRKEVPGPNGATEED Experimental 0 0 0 -PRRGPR Experimental 0 0 0 -PRGRRQPIPKARQP Experimental 0 0 0 -KRSAEGGNPPKPLKKLR Experimental 1 100 0 rb_rat nuc -KRKx{11}KKKSKK Experimental 3 100 0 ppol_bovin,ppol_human,ppol_rat nuc,nuc,nuc -EYLSRKGKLEL Experimental 0 0 0 -PKRPRDRHDGELGGRKRARG Experimental 0 0 0 -KRPAATKKAGQAKKKK Experimental 1 100 0 nupl_xenla nuc -KRKKEMANKSAPEAKKKK Experimental 1 100 0 nucl_chick nuc -RKRAFHGDDPFGEGPPDKK Experimental 3 100 0 dnbi_hsv11,dnbi_hsv1f,dnbi_hsv1k nuc,nuc,nuc -GGGx{3}KNRRx{6}RGGRN Experimental 1 100 0 nab2_yeast nuc -YNNQSSNFGPMKGGN Experimental 0 0 0 -PAAKRVKLD Experimental 4 100 0 myc_calja,myc_human,myc_hylla,myc_pantr nuc,nuc,nuc,nuc -KRPAEDMEEEQAFKRSR Experimental 1 100 0 rok_human nuc -SxGTKRSYxxM Experimental 0 0 0 -MNKIPIKDLLNPG Experimental 0 0 0 -PKKARED Experimental 3 100 0 tala_povm3,tala_povma,tala_povmc nuc,nuc,nuc -VSRKRPR Experimental 3 100 0 tala_povm3,tala_povma,tala_povmc nuc,nuc,nuc -APTKRKGS Experimental 0 0 0 -PNKKKRK Experimental 0 0 0 -EEDGPQKKKRRL Experimental 0 0 0 -PLLKKIKQ Experimental 4 100 0 myb_bovin,myb_chick,myb_human,myb_mouse nuc,nuc,nuc,nuc -PPQKKIKS Experimental 1 100 0 mycn_human nuc -PQPKKKP Experimental 6 100 0 p53_bovin,p53_cerae,p53_human,p53_macfa,p53_macmu,p53_spebe nuc,nuc,nuc,nuc,nuc,nuc -SKRVAKRKL Experimental 9 100 0 tha_chick,tha1_human,tha2_human,tha1_mouse,tha2_mouse,tha2_rat,tha_ranca,tha1_sheep,thab_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -IKYFKKFPKD Experimental 1 100 0 ski3_yeast nuc -KTRKHRG Experimental 0 0 0 -KHRKHPG Experimental 0 0 0 -PQSRKKLR Experimental 4 100 0 max_chick,max_human,max_mouse,max_xenla nuc,nuc,nuc,nuc -HRKYEAPRHx{6}PRKR Experimental 1 0 100 rl3_yeast cyt -KKEKKKSKK Experimental 0 0 0 -RKKRKR Potential 3 10 0 hm22_caeel,u2af_caebr,u2af_caeel nuc,nuc,nuc -RKKRRxR Potential 23 100 0 cx10_mouse,sp10_human,tat_hv112,tat_hv1a2,tat_hv1b1,tat_hv1b5,tat_hv1br,tat_hv1c4,tat_hv1el,tat_hv1h2,tat_hv1jr,tat_hv1ma,tat_hv1mn,tat_hv1nd,tat_hv1oy,tat_hv1pv,tat_hv1rh,tat_hv1s1,tat_hv1s3,tat_hv1sc,tat_hv1y2,tat_hv1z2,tat_hv1z6 nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[KR]KRKK Potential 50 100 0 br11_brare,brn1_human,brn1_mouse,brn4_human,brn4_mouse,cf1a_drome,chd3_human,cx10_mouse,dd16_human,dnl1_mouse,dpoa_schpo,elf1_mouse,h2b_agabi,h2b_caeel,h2b_caimo,h2b_chick,hm16_xenla,hm19_xenla,hm20_xenla,if16_human,lyar_mouse,mcm3_human,mcm3_mouse,oc11_mouse,oc3n_human,oc3n_mouse,oc3n_rat,oct6_human,oct6_mouse,oct6_rat,p53_salir,pang_drome,pap_canal,po3a_xenla,po3b_xenla,pou1_brare,pou1_xenla,pou2_xenla,prh_petcr,sgf3_bommo,sk1a_rat,sk1i_rat,sko1_yeast,sus_drome,t2d1_human,trx_drome,zp12_brare,zp23_brare,zp47_brare,zp50_brare nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RKRKR[KR] Potential 12 100 0 hmp1_bovin,hmp1_human,hmp1_melga,hmp1_mouse,hmp1_oncke,hmp1_oncmy,hmp1_pig,hmp1_rat,hmp1_sheep,hrx_human,pou2_brare,sko1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 12 100 10 83.33 hbox: 100 -KKRKR[KR] Potential 10 100 0 h2b_drohy,h2b_drome,h2b_patgr,hm22_caeel,po61_human,po61_mouse,po61_rat,pouc_brare,sn22_human,wc1_neucr nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -KKRRK Potential 9 100 0 skip_human,t2fa_human,cys3_neucr,rpb1_plafd,h2b_sipnu,h2bo_strpu,h2b1_xenla,h2b2_xenla,spt6_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[RK]R[MS]KxK[KR] Potential 163 100 0 hxa5_ambme,hxa9_ambme,hxb1_ambme,scr_apime,h114_brare,hox3_brafl,hx5l_brare,hxa1_brare,hxb4_brare,hxb5_brare,hxb6_brare,hxc5_brare,hxc6_brare,hxd4_brare,hxda_brare,hxdc_brare,hxa2_chick,hxa4_chick,hxa7_cotja,hxa9_cavpo,hxa9_chick,hxab_chick,hxb1_chick,hxb1_cypca,hxb3_chick,hxb4_chick,hxb5_chick,hxb6_chick,hxd3_chick,hxd4_chick,hxd8_chick,hxd9_chick,hxda_chick,hxdb_chick,hxdc_chick,vab7_caeel,hmab_drome,hmdf_drome,hmdl_drome,hmev_drome,hmft_drohy,hmft_drome,hmla_drome,hmpb_drome,hmux_drome,hmz1_drome,hmz2_drome,scr_drome,hxa9_fugru,hxb4_fugru,hxc9_fugru,evx1_human,evx2_human,hb9_human,hxa1_human,hxa2_human,hxa3_human,hxa4_human,hxa5_human,hxa6_human,hxa7_human,hxa9_human,hxaa_human,hxab_human,hxb1_human,hxb2_human,hxb3_human,hxb4_human,hxb5_human,hxb6_human,hxb7_human,hxb8_human,hxb9_human,hxc4_human,hxc5_human,hxc6_human,hxc8_human,hxc9_human,hxcb_human,hxcc_human,hxd3_human,hxd4_human,hxd8_human,hxd9_human,hxda_human,hxdb_human,hxdc_human,ipf1_human,evx1_mouse,evx2_mouse,hxa1_mouse,hxa2_mouse,hxa3_mouse,hxa4_mouse,hxa5_mouse,hxa6_mouse,hxa7_mouse,hxa9_mouse,hxaa_mouse,hxab_mouse,hxb1_mouse,hxb3_mouse,hxb4_mouse,hxb5_mouse,hxb6_mouse,hxb7_mouse,hxb8_mouse,hxb9_mouse,hxc4_mouse,hxc5_mouse,hxc6_mouse,hxc8_mouse,hxc9_mouse,hxca_mouse,hxcb_mouse,hxcc_mouse,hxd1_mouse,hxd3_mouse,hxd4_mouse,hxd8_mouse,hxd9_mouse,hxda_mouse,hxdb_mouse,hxdc_mouse,ipf1_mesau,ipf1_mouse,hxa2_notvi,hxc5_notvi,hxc6_notvi,hxdb_notvi,hxb8_pig,hxa2_rat,hxa4_rat,hxa5_rat,hxa7_rat,hxb7_rat,hxb8_rat,hxc4_rat,hxc8_rat,hxd3_rat,ipf1_rat,hxa4_sheep,hxa5_salsa,hxa5_sheep,hxa7_sheep,hxb2_salsa,hxc6_sheep,hxc9_sheep,hb7a_xenla,hb7b_xenla,hm8_xenla,hx3_xenla,hxa1_xenla,hxa7_xenla,hxb3_xenla,hxb4_xenla,hxb5_xenla,hxb6_xenla,hxb9_xenla,hxc5_xenla,hxc6_xenla,hxd1_xenla,pr05_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 162 99.38 162 100 hbox: 100 -PK[KR][KRP][RAK][KT][VSE] Potential 12 100 0 hmin_drome,tdg_mouse,tala_povba,tala_povbk,tala_povbo,tala_povjc,tala_povly,tala_sv40,h1a_xenla,h1b_xenla,h1c1_xenla,h1c2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -KR[MNSQ]R[MNSQ]R Potential 27 100 0 ap1_chick,ap1_cotja,rxra_chick,u2af_caebr,u2af_caeel,ap1_drome,usp_drome,h1l6_ensmi,ap1_human,ddx8_human,rxra_human,rxrb_human,rxrg_human,sfr3_human,ap1_mouse,rxra_mouse,rxrb_mouse,rxrg_mouse,usp_manse,ap1_pig,ap1_rat,rrxb_rat,rxra_rat,ap1_serca,rxra_xenla,rxrg_xenla,pop1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 21 77.77 21 100 znc: 61.9 bas: 38.09 -T[PLV]KRC Potential 18 100 0 myf5_bovin,myod_brare,myf5_chick,myod_chick,myod_cotja,myf5_human,myod_human,mpi3_mesau,myf5_mouse,myod_mouse,myf5_notvi,myo1_oncmy,mpi3_pig,myod_pig,myod_rat,cut1_schpo,myod_sheep,myf5_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[DE][ST][PL]KR[STC] Potential 16 100 0 myf5_bovin,myod_brare,myf5_chick,myod_chick,myod_cotja,dif_drome,myf5_human,myod_human,myf5_mouse,myod_mouse,myf5_notvi,myo1_oncmy,myod_pig,myod_rat,myod_sheep,myf5_xenla nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RRKx{3,5}R[DE]R{3,}?[PLV] Potential 24 100 0 myf5_bovin,myod_brare,myf5_chick,myf6_chick,myod_caebr,myod_caeel,myod_chick,myod_cotja,myod_drome,myf5_human,myf6_human,myod_human,myf5_mouse,myf6_mouse,myod_mouse,myf5_notvi,myo1_oncmy,myo2_oncmy,myod_pig,myf6_rat,myod_rat,myod_sheep,myf5_xenla,myod_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 24 100 24 100 bas: 100 -[ED]R{4,}?[ED] Potential 13 100 0 nr54_human,psf_human,usf1_human,usf2_human,ve2_hpv37,ve2_hpv48,usf1_mouse,usf2_mouse,usf1_rabit,usf2_rat,usf_strpu,usf1_xenbo,cbf1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 9 69.23 9 100 hlh: 11.11 bas: 88.88 -R{2,}?[QMN]R{3,}? Potential 57 100 0 hsp2_bovin,rev_hv112,rev_hv1a2,rev_hv1b1,rev_hv1b8,rev_hv1bn,rev_hv1br,rev_hv1c4,rev_hv1el,rev_hv1h2,rev_hv1j3,rev_hv1jr,rev_hv1lw,rev_hv1ma,rev_hv1mn,rev_hv1nd,rev_hv1oy,rev_hv1pv,rev_hv1rh,rev_hv1s1,rev_hv1s3,rev_hv1sc,rev_hv1w2,rev_hv1y2,rev_hv1z2,rev_hv1z6,rev_hv1z8,rev_hv2be,rev_hv2ca,rev_hv2d1,rev_hv2g1,rev_hv2kr,rev_hv2nz,rev_hv2ro,rev_hv2sb,rev_hv2st,tat_hv112,tat_hv1a2,tat_hv1b1,tat_hv1b5,tat_hv1br,tat_hv1c4,tat_hv1h2,tat_hv1jr,tat_hv1ma,tat_hv1mn,tat_hv1oy,tat_hv1pv,tat_hv1s1,tat_hv1sc,tat_hv1y2,tat_hv1z2,tat_hv1z6,ve2_hpv17,rev_sivcz,rev_sivm2,rev_sivmk nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -K{1,}?R{2,}?[QM]R{2,} Potential 21 100 0 rev_hv1j3,tat_hv112,tat_hv1a2,tat_hv1b1,tat_hv1b5,tat_hv1br,tat_hv1c4,tat_hv1el,tat_hv1h2,tat_hv1jr,tat_hv1ma,tat_hv1mn,tat_hv1nd,tat_hv1oy,tat_hv1pv,tat_hv1rh,tat_hv1s1,tat_hv1sc,tat_hv1y2,tat_hv1z2,tat_hv1z6 nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -R{2,}?PR{3,}? Potential 2 100 0 prt3_clupa,hsp1_orcor nuc,nuc -RRx{0,1}RRRRR Potential 56 100 0 hsp1_antla,hsp1_antst,hsp1_antsw,prt_antgr,prta_acist,prtb_acigu,gatb_bommo,hsp1_bovin,hsp2_bovin,cdp_canfa,hsp1_caefu,hsp_chick,hsp_cotja,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,ebn6_ebv,hsp1_horse,hsp2_horse,hsp3_horse,rev_hv2be,rev_hv2d1,rev_hv2kr,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_mouse,hsp1_murlo,hsp2_mouse,hsp1_notty,prt3_oncmy,prt4_oncmy,prt7_oncmy,prt9_oncmy,prtb_oncmy,hsp1_parbi,hsp1_pig,hsp1_psecu,hsp2_pig,hsp1_rabit,hsp1_rat,h2b1_strpu,h2b2_strpu,hsp1_sagim,hsp1_sarha,hsp1_sheep,prt1_sepof,prt2_sepof,prt3_scyca,rev_sivs4,rev_sivsp,hsp1_tacac,hsp1_trivu nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RxRSRSx{0,1}RxR Potential 52 100 0 hsp1_antla,hsp1_antst,hsp1_antsw,stp2_bovin,ve2_bpv4,hsp1_caefu,hsp2_calja,hsp_chick,hsp_cotja,sfr2_chick,u2af_caebr,u2af_caeel,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,sr55_drome,trsf_drome,u2af_drome,em1_ensmi,h1l6_ensmi,ddx8_human,sfr1_human,sfr2_human,sfr5_human,sfr6_human,sfr7_human,u2ag_human,ve2_hpv05,ve2_hpv08,ve2_hpv14,ve2_hpv17,ve2_hpv25,ve2_hpv37,ve2_hpv47,ve2_hpv49,ve2_hpv5b,hsp1_isoma,h1l_mytca,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_murlo,hsp1_notty,hsp1_parbi,hsp1_pergu,hsp1_psecu,sfr6_rabit,hsp1_sarha,hsp1_trivu nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -Rx{2,3}RRRRRR Potential 69 100 0 hsp1_alose,hsp1_antla,hsp1_antst,hsp1_antsw,prt_antgr,prtb_acigu,gatb_bommo,hsp1_bovin,hsp2_bovin,prt1_bufja,prt2_bufja,cdp_canfa,hsp1_caefu,hsp1_cavpo,hsp2_calja,hsp_chick,hsp_cotja,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,ebn6_ebv,hsp1_gorgo,hsp1_horse,hsp1_human,hsp2_horse,hsp3_horse,rev_hv2be,rev_hv2d1,ve2_hpv37,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_mouse,hsp1_murlo,hsp2_macmu,hsp2_macne,hsp1_notty,prt1_oncke,prt5_oncmy,prt6_oncmy,prt7_oncmy,prt8_oncmy,prt9_oncmy,h2b2_paran,h2b3_paran,hsp1_parbi,hsp1_phaci,hsp1_pig,hsp1_plagi,hsp1_plain,hsp1_plate,hsp1_psecu,hsp2_pig,hsp1_rabit,hsp1_rat,h2b2_strpu,hsp1_sagim,hsp1_sarha,hsp1_sheep,prt1_sepof,prt2_salir,prt2_sepof,prt3_salir,prt3_scyca,hsp1_tacac,hsp1_trivu nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RRRRRRx{0,2}R Potential 64 100 0 hsp1_alose,hsp1_antla,hsp1_antst,hsp1_antsw,prt_antgr,prta_acist,prtb_acigu,gatb_bommo,hsp1_bovin,hsp2_bovin,cdp_canfa,hsp1_caefu,hsp1_cavpo,hsp2_calja,hsp_chick,hsp_cotja,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,ebn6_ebv,hsp1_horse,hsp2_horse,hsp3_horse,rev_hv2be,rev_hv2d1,ve2_hpv37,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_mouse,hsp1_murlo,hsp2_macmu,hsp2_macne,hsp1_notty,prt1_oncke,prt5_oncmy,prt6_oncmy,prt7_oncmy,prt8_oncmy,prt9_oncmy,hsp1_parbi,hsp1_phaci,hsp1_plams,hsp1_psecu,hsp2_pig,hsp1_rabit,hsp1_rat,h2b1_strpu,h2b2_strpu,hsp1_sagim,hsp1_sarha,hsp1_sheep,prt1_sepof,prt2_salir,prt2_sepof,prt3_salir,prt3_scyca,rev_sivs4,rev_sivsp,hsp1_tacac,hsp1_trivu nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -KKKKR[KR] Potential 8 100 0 h2b_anoga,h2b_drohy,h2b_drome,pang_drome,nnp1_human,lef1_mouse,h2b_pladu,t2fa_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -KKKR[KR][VPL] Potential 8 100 0 tat_hv1u4,tala_povba,tala_povbk,tala_sv40,orc2_yeast,t2d1_drome,t2d1_human,zfy_human nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -R[MNQ]RRRRxR Potential 35 100 0 hsp2_bovin,hsp1_droau,rev_hv112,rev_hv1a2,rev_hv1b1,rev_hv1b8,rev_hv1bn,rev_hv1br,rev_hv1c4,rev_hv1el,rev_hv1h2,rev_hv1j3,rev_hv1jr,rev_hv1lw,rev_hv1ma,rev_hv1mn,rev_hv1nd,rev_hv1oy,rev_hv1pv,rev_hv1rh,rev_hv1s1,rev_hv1s3,rev_hv1sc,rev_hv1w2,rev_hv1y2,rev_hv1z2,rev_hv1z6,rev_hv1z8,rev_hv2be,rev_hv2ca,rev_hv2d1,rev_hv2g1,rev_sivcz,rev_sivm2,rev_sivmk nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -R[KR]RRRRxR Potential 41 100 0 hsp1_antla,hsp1_antst,hsp1_antsw,prt_antgr,gatb_bommo,hsp1_bovin,cdp_canfa,hsp1_caefu,hsp_cotja,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,hsp1_horse,ve2_hpv37,atf3_mouse,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_mouse,hsp1_murlo,hsp1_notty,prt7_oncmy,prt9_oncmy,hsp1_parbi,hsp1_phaci,hsp1_psecu,hsp1_rabit,hsp1_rat,hsp1_sarha,hsp1_sheep,prt1_sepof,prt2_scyca,prt2_sepof,prt3_scyca,rev_sivs4,rev_sivsp,hsp1_tacac,hsp1_trivu nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -R[GVLIP]RRRRxR Potential 8 100 0 prt_antgr,hsp1_droau,ebn6_ebv,hsp2_horse,hsp3_horse,hsp1_pig,hsp1_psecu,hsp1_sagim nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RRRRRR Potential 81 100 0 hsp1_alose,hsp1_antla,hsp1_antst,hsp1_antsw,prt_antgr,prta_acist,prtb_acigu,gatb_bommo,hsp1_bovin,hsp2_bovin,prt1_bufja,prt2_bufja,cdp_canfa,hsp1_caefu,hsp1_cavpo,hsp2_calja,hsp_chick,hsp_cotja,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,ebn6_ebv,hsp1_gorgo,fre4_human,hsp1_horse,hsp1_human,hsp1_hylla,hsp2_horse,hsp3_horse,rev_hv2be,rev_hv2d1,ve2_hpv37,h2b2_lytpi,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_mouse,hsp1_murlo,hsp2_macmu,hsp2_macne,hsp1_notty,prt1_oncke,prt5_oncmy,prt6_oncmy,prt7_oncmy,prt8_oncmy,prt9_oncmy,h2b1_paran,h2b2_paran,h2b3_paran,hsp1_parbi,hsp1_phaci,hsp1_pig,hsp1_plagi,hsp1_plain,hsp1_plams,hsp1_plate,hsp1_psecu,hsp2_pig,hsp1_rabit,hsp1_rat,h2b1_strpu,h2b2_strpu,hsp1_sagim,hsp1_sarha,hsp1_sheep,prt1_salir,prt1_sepof,prt2_salir,prt2_scyca,prt2_sepof,prt3_salir,prt3_scyca,rev_sivs4,rev_sivsp,hsp1_tacac,hsp1_trivu,mcm2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RRRRRxRR Potential 37 100 0 hsp1_antst,prt_antgr,gatb_bommo,hsp1_bovin,cdp_canfa,hsp1_caefu,hsp2_calja,hsp_cotja,hsp1_didma,hsp1_horse,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_mouse,prt2_mugja,hsp1_notty,hsp1_ornan,prt7_oncmy,prt9_oncmy,hsp1_phaci,hsp1_psecu,hsp2_pig,prt_perfv,hsp1_rabit,hsp1_rat,hsp1_sheep,prt1_saror,prt1_sepof,prt2_salir,prt2_sepof,prt3_scyca,hsp1_tacac,hsp1_trivu,prt1_thuth,prt2_thuth nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RRxRRRRR Potential 35 100 0 hsp1_antst,prt_antgr,gatb_bommo,hsp1_bovin,hsp2_bovin,cdp_canfa,hsp1_caefu,hsp_cotja,hsp1_didma,hsp1_droau,hsp1_horse,hsp2_horse,hsp3_horse,rev_hv2be,rev_hv2d1,rev_hv2kr,hsp1_mouse,hsp2_mouse,prt3_oncmy,prt4_oncmy,prt7_oncmy,prt9_oncmy,prtb_oncmy,hsp1_pig,hsp1_psecu,hsp2_pig,hsp1_rabit,hsp1_rat,hsp1_sagim,hsp1_sheep,prt1_sepof,prt2_sepof,prt3_scyca,hsp1_tacac,hsp1_trivu nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[KR][KR][KR][KR][KR][KR][KR] Potential 74 100 0 h2b_astru,hsp1_antla,hsp1_antst,hsp1_antsw,prt_antgr,prta_acist,prtb_acigu,gatb_bommo,hsp1_bovin,cdp_canfa,hm22_caeel,hsp1_caefu,hsp_chick,hsp_cotja,brm_drome,h2b_drohy,h2b_drome,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,pang_drome,sus_drome,ebn6_ebv,dd16_human,gcf_human,hsp1_horse,rev_hv2be,rev_hv2d1,sn22_human,sp10_human,t2d1_human,t2fa_human,h2b2_lytpi,cx10_mouse,h2b_margl,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_murlo,lef1_mouse,hsp1_notty,wc1_neucr,h2b1_paran,h2b2_paran,h2b3_paran,h2b_patgr,h2b_pladu,hsp1_parbi,hsp1_psecu,prh_petcr,rpb1_plafd,dkc1_rat,fre6_rat,h2b1_strpu,h2b2_strpu,h2b_sipnu,h2bl_strpu,h2bn_strpu,h2bo_strpu,hmgh_strpu,hsp1_sarha,hsp1_sheep,prt1_sepof,prt2_scyca,prt2_sepof,prt3_scyca,rev_sivs4,rev_sivsp,hsp1_tacac,hsp1_trivu,h2b_ureca nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RRxxKRK Potential 25 100 0 h2b_acrfo,vdr_bovin,vdr_chick,vdr_cotja,elf1_drome,t2fa_drome,twst_drome,dnl4_human,ets1_human,ets2_human,moz_human,rag1_human,vdr_human,ve2_hpv48,ets2_lytva,ets1_mouse,ets2_mouse,vdr_mouse,ets1_rat,vdr_rat,et1a_xenla,et1b_xenla,et2a_xenla,et2b_xenla,vdr_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[KR]{2,3}xxKR[KR][QLM] Potential 31 100 0 ctcf_chick,tha_chick,thb_chick,elf1_drome,ak95_human,ctcf_human,nol1_human,tha1_human,tha2_human,thb1_human,thb2_human,ve1_hpv33,ve2_hpv48,mx1_mouse,tha1_mouse,tha2_mouse,thb1_mouse,thb2_mouse,ak95_rat,mx1_rat,tha2_rat,tha_ranca,thb1_rat,thb2_rat,thb_ranca,cc21_schpo,tha1_sheep,thb1_sheep,thaa_xenla,thab_xenla,pus4_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RR[TS]x[QK][KR][KN] Potential 35 100 0 vdr_bovin,tha_chick,thb_chick,vdr_chick,vdr_cotja,dnl4_human,rrb2_human,rrg1_human,rrg2_human,tha1_human,tha2_human,thb1_human,thb2_human,vdr_human,rra_mouse,rrb_mouse,rrg1_mouse,rrg2_mouse,tha1_mouse,tha2_mouse,vdr_mouse,rra_notvi,rrb_notvi,tha2_rat,tha_ranca,thb_ranca,vdr_rat,tha1_sheep,thb1_sheep,rra_xenla,rrg1_xenla,rrg2_xenla,thaa_xenla,thab_xenla,vdr_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 34 97.14 34 100 znc: 100 -KRxRxRx{2,6}RKRK Potential 16 100 0 ap1_chick,ap1_cotja,junb_cypca,jund_chick,ap1_drome,ap1_human,junb_human,jund_human,ap1_mouse,junb_mouse,jund_mouse,ap1_pig,ap1_rat,junb_rat,jund_rat,ap1_serca nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 16 100 15 93.75 bas: 100 -KKKKKx{3,6}KK Potential 11 100 0 t2d2_drome,t2fa_drome,atrx_human,chd4_human,rdp_human,ssrp_human,rdp_mouse,ssrp_mouse,ssrp_rat,ra16_yeast,sen1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RxRxRxRxRxRxK Potential 7 100 0 ebn2_ebv,ddx8_human,sfr5_human,ve2_hpv05,ve2_hpv14,ve2_hpv5b,rdp_mouse nuc,nuc,nuc,nuc,nuc,nuc,nuc -RxRxRxRxRxR Potential 74 97.29 2.7 hsp1_alose,hsp1_antla,hsp1_antst,hsp1_antsw,hsp1_bovin,hsp1_caefu,hsp_cotja,sfr2_chick,u2af_caebr,u2af_caeel,dab_drome,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,sr55_drome,stc_drome,trsf_drome,u2af_drome,ebn1_ebv,ebn2_ebv,ddx8_human,hsp1_horse,hsp1_human,rdp_human,sfr1_human,sfr2_human,sfr5_human,sfr6_human,smd1_human,u2ag_human,ve2_hpv05,ve2_hpv08,ve2_hpv14,ve2_hpv17,ve2_hpv25,ve2_hpv49,ve2_hpv5b,hsp1_isoma,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_mouse,hsp1_murlo,hsp2_mouse,rdp_mouse,hsp1_notty,hsp1_orcor,hsp1_ornan,prt7_oncmy,prt9_oncmy,hsp1_pantr,hsp1_parbi,hsp1_pergu,hsp1_psecu,hsp2_pig,hsp1_rabit,hsp1_rat,vtnc_rabit,hsp1_sagim,hsp1_sarha,hsp1_sheep,prt1_sepof,prt2_sepof,prt3_scyca,rev_sivag,rev_sivai,rev_sivat,rev_sivs4,rev_sivsp,hsp1_trivu,snf2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,ext,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[GAPLV]RKRKKR Potential 29 100 0 chd3_human,br11_brare,pou1_brare,sgf3_bommo,zp12_brare,zp23_brare,zp47_brare,zp50_brare,cf1a_drome,brn1_human,brn4_human,oc3n_human,oct6_human,brn1_mouse,brn4_mouse,oc11_mouse,oc3n_mouse,oct6_mouse,oc3n_rat,oct6_rat,sk1a_rat,sk1i_rat,hm16_xenla,hm19_xenla,hm20_xenla,po3a_xenla,po3b_xenla,pou1_xenla,pou2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 28 96.55 28 100 hbox: 100 -RRRKKR Potential 10 100 0 oct1_chick,pdm1_drome,pdm2_drome,pdm2_drovi,oct1_human,oct2_human,oct1_mouse,oct2_mouse,oct2_pig,oct1_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 10 100 10 100 hbox: 100 -RKx{7,12}RK[STMNQ]KK Potential 16 100 0 gcr_aotna,gcr_cavpo,aant_hdvit,aant_hdvl1,aant_hdvna,aant_hdvwo,gcr_human,gcr_mouse,gcr_oncmy,gcr_parol,gcr_rat,gcr_sagoe,gcr_saibb,gcr_tupgb,gcr_xenla,rox1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 12 75 12 100 znc: 91.66 hmg: 8.33 -KRKx{2,4}DRRK Potential 21 100 0 myf5_bovin,myod_brare,myf5_chick,myf6_chick,myod_chick,myod_cotja,myf5_human,myf6_human,myod_human,myf5_mouse,myf6_mouse,myod_mouse,myf5_notvi,myo1_oncmy,myo2_oncmy,myod_pig,myf6_rat,myod_rat,myod_sheep,myf5_xenla,myod_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -R[GA][IVLP]KRR Potential 7 100 0 bimb_emeni,arnt_human,arnt_mouse,arnt_rabit,arnt_rat,rag1_rabit,smd3_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc -R[IVLP][IVLP]KRR Potential 10 100 0 cbfb_human,npl1_human,sp10_human,hap2_klula,cbfb_mouse,h2b2_paran,h2b3_paran,cbfb_rat,php2_schpo,hap2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RRER[MNQ]Kx{4,8}R[MNQ]RRR Potential 13 100 0 fos_chick,fos_cypca,fra2_chick,fos_fugru,fos_human,fosb_human,fra2_human,fos_mouse,fosb_mouse,fra2_mouse,fos_rat,fra2_rat,fos_tetfl nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 13 100 13 100 bas: 100 -RER[MNQ]Kx{4,8}R[MNQ]RR Potential 16 100 0 fos_chick,fos_cypca,fra2_chick,fos_fugru,fos_human,fosb_human,fra1_human,fra2_human,fos_mouse,fosb_mouse,fra1_mouse,fra2_mouse,fos_rat,fra1_rat,fra2_rat,fos_tetfl nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 16 100 16 100 bas: 100 -KKxRx{3,5}R[PVL]K Potential 4 100 0 dpoa_human,dpoa_mouse,dpoa_rat,ly14_yeast nuc,nuc,nuc,nuc -R[MNQ]x{4,8}R[MNQ]RR Potential 26 100 0 area_aspor,hsp2_bovin,fos_chick,fos_cypca,fra2_chick,fos_fugru,atf5_human,cebg_human,fos_human,fosb_human,fra1_human,fra2_human,mycn_human,rev_hv1c4,ve2_hpv17,ve2_hpv25,cebg_mouse,fos_mouse,fosb_mouse,fra1_mouse,fra2_mouse,cebg_rat,fos_rat,fra1_rat,fra2_rat,fos_tetfl nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 21 80.76 18 85.71 bas: 100 -KKx{1,7}K[PL][PLIV]KK Potential 13 100 0 h2b_arath,tp2a_crigr,ddx5_human,p15_human,tp2a_human,p15_mouse,tp2a_mouse,h1_psami,p15_rat,tp2a_rat,h1e_strpu,h1_tetpy,tfs2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[DE]R{2,4}xRK[PL] Potential 4 100 0 tp2a_crigr,tp2a_human,tp2a_mouse,tp2a_rat nuc,nuc,nuc,nuc -KRKx{0,8}KR[PL]K Potential 3 100 0 ku70_human,orc1_klula,prt4_scyca nuc,nuc,nuc -KRKx{5,10}KK[PL]K Potential 6 100 0 hrx_human,rag1_human,ku70_mouse,rag1_mouse,h1_paran,cych_xenla nuc,nuc,nuc,nuc,nuc,nuc -R[STCMNQ]R[STCMNQ]KR Potential 5 100 0 atfa_human,crep_human,atf2_mouse,atf2_rat,b7_ustma nuc,nuc,nuc,nuc,nuc -KK[MNQSTC]R[MNQSTC]K[MNQSTC] Potential 12 100 0 ppar_cavpo,ppar_human,ppas_human,ppat_human,ppar_mouse,ppas_mouse,ppat_mouse,ppar_rat,ppat_rabit,ppar_xenla,ppas_xenla,ppat_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 12 100 12 100 znc: 100 -RR[PLIV]RKxK Potential 3 100 0 hp1_drome,hp1_drovi,moz_human nuc,nuc,nuc -RRxKRxK[PLV] Potential 7 100 0 sdc3_caeel,fd4_drome,hn3g_human,fkh4_mouse,fkh5_mouse,hn3g_mouse,hn3g_rat nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 6 85.71 6 100 fork: 100 -[PL]KxxKRR Potential 19 100 0 e2f1_chick,hm18_caeel,ve1_ccpv1,suhw_droan,e2f1_human,e2f3_human,npl4_human,sn22_human,ve1_hpv11,ve1_hpv44,ve1_hpv6a,ve1_hpv6b,hsf3_lycpe,e2f1_mouse,e2f3_mouse,npl1_mouse,ve1_pcpv1,e2f1_rat,ly14_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[DE]KxRRK[MNQ] Potential 23 100 0 gcr_aotna,prgr_chick,andr_human,gcr_human,mcr_human,prgr_human,andr_mouse,gcr_mouse,prgr_mouse,gcr_oncmy,gcr_parol,andr_rabit,andr_rat,gcr_rat,mcr_rat,prgr_rabit,gcr_sagoe,gcr_saibb,prgr_sheep,gcr_tupgb,mcr_tupgb,gcr_xenla,mcr_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 23 100 23 100 znc: 100 -[DE]K[NIF]RR[DEK][STMNQ] Potential 24 100 0 gcr_aotna,gcr_cavpo,prgr_chick,andr_human,gcr_human,mcr_human,prgr_human,andr_mouse,gcr_mouse,prgr_mouse,gcr_oncmy,gcr_parol,andr_rabit,andr_rat,gcr_rat,mcr_rat,prgr_rabit,gcr_sagoe,gcr_saibb,prgr_sheep,gcr_tupgb,mcr_tupgb,gcr_xenla,mcr_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 24 100 24 100 znc: 100 -[YFW]RRRR[PL] Potential 8 100 0 yb1_chick,rxrb_human,tfe3_human,yb1_human,rxrb_mouse,yb1_mouse,yb1_xenla,yb3_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RKR[PLQMN]R[PLQMN]R Potential 16 100 0 ap1_chick,ap1_cotja,junb_cypca,jund_chick,ap1_drome,ap1_human,junb_human,jund_human,ap1_mouse,junb_mouse,jund_mouse,ap1_pig,ap1_rat,junb_rat,jund_rat,ap1_serca nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 16 100 15 93.75 bas: 100 -K[PLMN]RRK[MNQ] Potential 3 100 0 sx19_brare,slp1_drome,son1_yeast nuc,nuc,nuc -RR[PLQMN]xRRRR Potential 10 100 0 hsp2_bovin,yb1_chick,hsp2_horse,hsp3_horse,rev_hv2be,rev_hv2d1,rev_hv2kr,yb1_human,yb1_mouse,prt5_oncmy nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RxKKKK[DE] Potential 12 100 0 rrb2_human,rrg1_human,rrg2_human,rra_mouse,rrb_mouse,rrg1_mouse,rrg2_mouse,u2r1_mouse,rrb_notvi,rra_xenla,rrg1_xenla,rrg2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[DE]RxKKKK Potential 15 100 0 ssrp_chick,t2d4_drome,ddx8_human,rrb2_human,rrg1_human,rrg2_human,rra_mouse,rrb_mouse,rrg1_mouse,rrg2_mouse,rra_notvi,rrb_notvi,rra_xenla,rrg1_xenla,rrg2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RRxR[PVL]RK Potential 13 100 0 gbf1_arath,gbf2_arath,gbf3_arath,gsbd_drome,gsbp_drome,hmpr_drome,moz_human,ocs1_maize,cpr1_petcr,cpr3_petcr,taf1_tobac,emp1_wheat,hbpa_wheat nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 24 92.3 24 100 hbox: 25 bas: 75 -RRR[LP]xxR[PLQ] Potential 6 100 0 zfx_bovin,tra1_caeel,zfx_human,zfx1_mouse,zfx2_mouse,ra54_yeast nuc,nuc,nuc,nuc,nuc,nuc -[DE]RKRR[DEPLQ] Potential 15 100 0 max_brare,max_chick,brm_drome,trsf_drome,max_human,sn22_human,sn24_human,wrn_human,max_mouse,scp1_mesau,max_rat,scp1_rat,mlh_tetth,max_xenla,dpoe_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[KR][DE][KR][DE]xx[KR]{4,}? Potential 5 100 0 tala_bfdv,aant_hdvs1,aant_hdvs2,cenc_human,snf5_yeast nuc,nuc,nuc,nuc,nuc -[PL]R[DE]K[DE]R Potential 2 100 0 dp30_caeel,mpi3_mouse nuc,nuc -[PL][KR]{5,7}[PL] Potential 12 100 0 dnb2_ade05,zfx_bovin,myba_chick,chd4_human,zfx_human,zfy_human,mbp1_klula,tdg_mouse,zfx1_mouse,zfx2_mouse,p53_salir,tf3a_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[KR]{2,}?[PL]x{1,4}[KR]{2,}?x{1,5}K{3,}? Potential 11 100 0 h2b_arath,hmga_chite,tf3a_ictpu,phi3_mytca,h1_paran,h1d_strpu,prt4_scyca,h1_tigca,h5a_xenla,h5b_xenla,nupl_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -K[GA]K[AG]KK[AG] Potential 5 100 0 tp2a_crigr,t2fa_drome,tp2a_mouse,cebb_rat,tp2a_rat nuc,nuc,nuc,nuc,nuc -[KR][KR]x[KR][KR][KR]x[KR][KR] Potential 54 98.14 1.85 h2b_agabi,h2b_anoga,prt_antgr,hsp1_bovin,hsp2_bovin,cdp_canfa,hsp1_caefu,brm_drome,hsp1_didma,hsp1_droau,t2d2_drome,twst_drome,rms5_emeni,aant_hdvam,aant_hdvd3,aant_hdvit,aant_hdvl1,aant_hdvm1,aant_hdvm2,aant_hdvna,aant_hdvwo,ell2_human,gcf_human,hsp1_horse,pwp1_human,rev_hv2be,rev_hv2d1,rev_hv2kr,sn22_human,h2b1_maize,h2b2_maize,h2b3_maize,h2b4_maize,h2b5_maize,hsp1_mouse,u2r1_mouse,hsp1_orcor,prt7_oncmy,prt9_oncmy,hsp1_phaci,hsp1_pig,hsp1_psecu,rpb1_plafd,hsp1_rabit,hsp1_rat,hsp1_sagim,hsp1_sheep,prt1_sepof,prt2_sepof,prt3_scyca,hsp1_trivu,h2b1_wheat,pr08_yeast,sen1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,mit,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[RK][PLIV][KR][RK]{2,4}[PLVI]R Potential 5 100 0 ht31_arath,cg2f_human,prt3_oncmy,prt4_oncmy,prtb_oncmy nuc,nuc,nuc,nuc,nuc -KR[PLV][GA]KRK[PL] Potential 19 100 0 tha_chick,thb_chick,tha1_human,tha2_human,thb1_human,thb2_human,tha1_mouse,tha2_mouse,thb1_mouse,thb2_mouse,tha2_rat,tha_ranca,thb1_rat,thb2_rat,thb_ranca,tha1_sheep,thb1_sheep,thaa_xenla,thab_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[DE][KR]RR[KR][FYW] Potential 6 100 0 crep_human,tfe3_human,tfeb_human,atf2_mouse,tfe3_mouse,atf2_rat nuc,nuc,nuc,nuc,nuc,nuc -Rx[KR][KR][KR]xxRKKR Potential 2 100 0 dd16_human,sth1_yeast nuc,nuc -KRxxKKxK[DE] Potential 3 100 0 xpa_chick,chd3_human,snf2_yeast nuc,nuc,nuc -[DE]KR[MQN]R[MQN]R Potential 13 100 0 rxra_chick,usp_drome,rxra_human,rxrb_human,rxrg_human,rxra_mouse,rxrb_mouse,rxrg_mouse,usp_manse,rrxb_rat,rxra_rat,rxra_xenla,rxrg_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 13 100 13 100 znc: 100 -K[RK]{3,5}x{11,18}[RK]Kx{2,3}K Experimental 31 100 0 scii_chick,tp2b_chick,tp2b_crilo,orc2_drome,ssrp_drome,t2fa_drome,ac15_human,atf3_human,chd3_human,moz_human,tp2b_human,dpoa_leido,ac15_mouse,atf3_mouse,lyar_mouse,phi1_myted,tdg_mouse,tp2b_mouse,h1_paran,dkc1_rat,prt4_scyca,apn1_yeast,cbf5_yeast,dpod_yeast,fkb3_yeast,nop5_yeast,pus3_yeast,ra16_yeast,rok1_yeast,sen1_yeast,tea1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -DR[MN]KKKKE Potential 11 100 0 rrb2_human,rrg1_human,rrg2_human,rra_mouse,rrb_mouse,rrg1_mouse,rrg2_mouse,rrb_notvi,rra_xenla,rrg1_xenla,rrg2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RK[PL][PLV]KK[RKH] Potential 5 100 0 tp2b_chick,tp2b_crilo,tp2b_mouse,rap1_yeast,spt5_yeast nuc,nuc,nuc,nuc,nuc -RK[IVE]W[ML][TQR]N[HF] Potential 9 100 0 tp2a_chick,tp2b_chick,tp2b_crilo,top2_drome,tp2a_human,tp2b_human,tp2a_mouse,tp2b_mouse,tp2a_rat nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -R[RK]{2,4}[PL][RK][MNQ]R Potential 10 100 0 junb_cypca,jund_chick,hsp1_droau,junb_human,jund_human,xbp1_human,junb_mouse,jund_mouse,junb_rat,jund_rat nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 9 90 8 88.88 bas: 100 -R{2,3}K{3,4}[PLRKE] Potential 15 100 0 creb_bovin,creb_chlvr,crem_canfa,bbf2_drome,atf1_human,creb_human,relb_human,atf1_mouse,crea_mouse,creb_mouse,relb_mouse,creb_rat,crem_rat,dpol_rcmvm,orc5_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 11 73.33 11 100 bas: 100 -R[KR]{3,4}K[DE] Potential 30 100 0 h2b_astru,creb_bovin,creb_chlvr,crem_canfa,bbf2_drome,sus_drome,atf1_human,atf6_human,crea_human,creb_human,if16_human,zep2_human,atf1_mouse,crea_mouse,creb_mouse,crem_mouse,h2b_margl,h2b3_psami,h2b4_psami,h2b_patgr,creb_rat,crem_rat,h2b_sipnu,h2bl_strpu,h2bn_strpu,h2bo_strpu,hmgh_strpu,orc5_yeast,sko1_yeast,sof1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -K[MNQ]RR[PLVI]K[PL] Potential 44 100 0 br11_brare,pou1_brare,sgf3_bommo,zp12_brare,zp23_brare,zp47_brare,zp50_brare,brn3_chick,oct1_chick,un86_caeel,cf1a_drome,ipou_drome,pdm1_drome,pdm2_drome,pdm2_drovi,br3a_human,br3b_human,br3c_human,brn1_human,brn4_human,oc3n_human,oct1_human,oct2_human,oct6_human,br3a_mouse,br3b_mouse,br3c_mouse,brn1_mouse,brn4_mouse,oc11_mouse,oc3n_mouse,oct1_mouse,oct2_mouse,oct6_mouse,oct2_pig,oc3n_rat,oct6_rat,sk1a_rat,sk1i_rat,oct1_xenla,po3a_xenla,po3b_xenla,pou1_xenla,pou2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[GA]KxKKK[MNQ] Potential 3 100 0 tfs2_human,tfs2_mouse,mrf1_yeast nuc,nuc,nuc -[PVLI][RK][RK][RK][RK][RK][QMN]K Potential 4 100 0 msl1_drome,no56_human,zep1_human,zep1_mouse nuc,nuc,nuc,nuc -R[GA]x{0,2}[GA]R[GA]x[GA]R[GA] Potential 19 100 0 nucl_chick,ebn1_ebv,ebn2_ebv,ews_human,p80c_human,smd1_human,smd3_human,tfeb_human,fbrl_leima,ews_mouse,fbrl_mouse,nucl_mesau,nfil_pig,5e5_rat,fbrl_rat,fbrl_schpo,nucl_xenla,nsr1_yeast,snf2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[GA][KR]KRx[KR][GA] Potential 11 100 0 dpod_bovin,h2b_caeel,ppol_drome,dpod_human,pmsc_human,dpod_mesau,dpod_mouse,dpod_rat,spm1_rat,dpod_soybn,h2b1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -R[RK]K[RK]KR Potential 5 100 0 prh_arath,hm22_caeel,u2af_caebr,u2af_caeel,dpol_rcmvm nuc,nuc,nuc,nuc,nuc -[PLV]K[RK]x[QMN][RK]R Potential 16 100 0 dnb2_ade05,wt1_allmi,dp27_caeel,gsbd_drome,gsbp_drome,hmpr_drome,pax3_human,pax7_human,wt1_human,pax3_mouse,pax7_mouse,wt1_mouse,wt1_pig,wt1_rat,wt1_smima,nuf1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[PLQMNKR]K[KR][KR]RxK[PLQMNKR] Potential 5 100 0 h2b_chith,sn22_human,lef1_mouse,u2r1_mouse,rpb1_plafd nuc,nuc,nuc,nuc,nuc -[PLQMKR]R[KR][QM][KR]RxK Potential 11 100 0 axia_brare,sgf1_bommo,fkh_drome,hn3a_human,hn3g_human,hn3a_mouse,hn3b_mouse,hn3g_mouse,hn3a_rat,hn3b_rat,hn3g_rat nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 11 100 11 100 fork: 100 -KRx[DE][KR][KR]xK Potential 2 100 0 xpa_chick,snf2_yeast nuc,nuc -R[QMPL]RR[DE]R Potential 9 100 0 cebd_human,cebe_human,cebg_human,cebd_mouse,cebg_mouse,cebd_rat,cebe_rat,cebg_rat,u2af_schpo nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 8 88.88 7 87.5 bas: 100 -[PLV]RK[ST]R[DE]K Potential 14 100 0 cebb_chick,ceb_drome,ceb_drovi,ceba_human,cebb_human,cebd_human,cebe_human,ceba_mouse,cebb_mouse,cebd_mouse,ceba_rat,cebb_rat,cebd_rat,cebe_rat nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 14 100 13 92.85 bas: 100 -[STQM]RKRK[STQM] Potential 7 100 0 prh_arath,elt2_caeel,ga15_crilo,tp2a_crigr,ga15_human,zn46_human,ga15_mouse nuc,nuc,nuc,nuc,nuc,nuc,nuc -[STQM]RKRR[STQM] Potential 1 100 0 mklp_human nuc -[STQM]RRRK[STQM] Potential 4 100 0 prt_antgr,ve2_hpv38,cpr2_petcr,msn4_yeast nuc,nuc,nuc,nuc -[PL][RK][RK][KR][GAPL][RK][STQM] Potential 8 100 0 sx11_chick,hmux_drome,hmux_drops,sry_gorgo,sry_horse,sry_human,ve2_hpv5b,tala_povmk nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -K[KR][QMN][RK]R[QMN]R Potential 4 100 0 hnfb_human,hnfb_mouse,hnfb_pig,hnfb_rat nuc,nuc,nuc,nuc DNA_BIND 4 100 4 100 hbox: 100 -[PLQ]K[RK]x{1,2}[RK]x{3,6}[RK][RK]x{1,2}[RK]x{1,2}[RK][RK] Potential 22 100 0 h1_anapl,prt_antgr,h101_chick,h103_chick,h110_chick,h11l_chick,h11r_chick,h1_chick,h1_echcr,h1a_human,moz_human,h11_mouse,h15_mouse,h1l_myttr,phi1_myted,h1_oncmy,h1_paran,h1_saltr,h1e_strpu,h5a_xenla,h5b_xenla,gcn4_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -K[PL]K{2,3}x{1,3}[RK]{2,4}x{6,9}K[KR] Potential 24 100 0 h1_anapl,hg17_bovin,h101_chick,h103_chick,h110_chick,h11l_chick,h11r_chick,h1_chick,h1a_chite,h1b_chite,hg15_chick,hg17_chick,h1_drome,h13_glyba,chd4_human,hg17_human,t2d4_human,hg17_mouse,h1_oncmy,h1_paran,hg17_pig,hg17_rat,ap1_schpo,h1_saltr nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[PL][RK][RK][DEP]R[RK][FYW] Potential 4 100 0 zep2_human,agie_rat,maz3_schco,u2af_schpo nuc,nuc,nuc,nuc -[KR][KR][QMN]R[RK][QMN]R Potential 6 100 0 hnfb_human,pmx1_human,hnfb_mouse,pmx1_mouse,hnfb_pig,hnfb_rat nuc,nuc,nuc,nuc,nuc,nuc -R[KR][RK]x{0,2}[RK]x{0,2}[RK]x{3,5}[RK]x{0,2}[RK][RK][RK][RK][PMQL] Potential 22 100 0 ap1_chick,ap1_cotja,junb_cypca,jund_chick,prt2_clupa,ap1_drome,ap1_human,hsp2_horse,hsp3_horse,junb_human,jund_human,ap1_mouse,junb_mouse,jund_mouse,prt5_oncmy,prt6_oncmy,ap1_pig,ap1_rat,junb_rat,jund_rat,ap1_serca,prt1_salir nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 16 72.72 15 93.75 bas: 100 -KR[RK][RK]x{2,4}[RK]x{0,2}Rx{3,5}[RK]x{0,2}[RK]x{0,2}[RK][RK]K Potential 4 100 0 prt_antgr,crep_human,atf2_mouse,atf2_rat nuc,nuc,nuc,nuc -[RK]{3,}?x{8,16}[RK]{4,}? Potential 193 97.92 2.07 hsp1_antla,hsp1_antst,hsp1_antsw,prt_antgr,prta_acist,prtb_acigu,creb_bovin,hsp1_bovin,if2_borbu,pap_bovin,prt1_bufja,prt2_bufja,stp2_bovin,ap1_chick,ap1_cotja,creb_chlvr,crem_canfa,hsp1_caefu,hsp1_cavpo,hsp2_calja,hsp_chick,hsp_cotja,ince_chick,junb_cypca,jund_chick,nucl_chick,prt1_clupa,prt2_clupa,prt3_clupa,ap1_drome,ato_drome,bbf2_drome,brm_drome,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,ssrp_drome,sus_drome,suwa_drome,t2fa_drome,trsf_drome,h1l6_ensmi,nira_emeni,prt1_esolu,hsp2_gorgo,aant_hdvam,aant_hdvd3,aant_hdvit,aant_hdvl1,aant_hdvm1,aant_hdvm2,aant_hdvna,aant_hdvwo,ak95_human,ap1_human,cb80_human,cbf_human,chd3_human,crea_human,creb_human,creb_hydat,crep_human,dpoe_human,gcf_human,hsp1_hylla,hsp2_horse,hsp2_human,hsp2_hylla,hsp3_horse,junb_human,jund_human,moz_human,ngp1_human,nr54_human,psf_human,sfr4_human,sn22_human,sp10_human,t2d1_human,t2fa_human,u2af_human,ve2_hpv04,ve2_hpv41,ve2_hpv60,hsp1_isoma,tf3a_ictpu,ap1_mouse,atf2_mouse,crea_mouse,creb_mouse,crem_mouse,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_mouse,hsp1_murlo,hsp2_macmu,hsp2_macne,hsp2_mouse,ifi3_mouse,junb_mouse,jund_mouse,lyar_mouse,phi1_myted,prt2_mugja,u2af_mouse,hsp1_notty,nit4_neucr,p53_oryla,prt1_oncke,prt2_oncmy,prt3_oncmy,prt4_oncmy,prt5_oncmy,prt6_oncmy,prt7_oncmy,prt8_oncmy,prt9_oncmy,prta_oncmy,prtb_oncmy,a33_plewa,ap1_pig,can3_pig,h2b1_paran,hsp1_parbi,hsp1_pergu,hsp1_phaci,hsp1_pig,hsp1_plagi,hsp1_plain,hsp1_plams,hsp1_plate,hsp1_psecu,hsp2_panpa,hsp2_pantr,hsp2_pig,hsp2_ponpy,prt_perfv,rm14_parte,ak95_rat,ap1_rat,atf2_rat,creb_rat,crem_rat,hsp1_rat,hsp2_rat,junb_rat,jund_rat,ap1_schpo,ap1_serca,h2b1_strpu,hsp1_sagim,hsp1_sarha,hsp1_sheep,prt1_salir,prt1_saror,prt1_scyca,prt1_sepof,prt2_salir,prt2_scyca,prt2_sepof,prt3_salir,prt3_scyca,prt4_scyca,hsp1_tacac,hsp1_trivu,prt1_thuth,prt2_thuth,rm14_tetpy,cych_xenla,pap1_xenla,pap2_xenla,rag1_xenla,sph1_xenla,t2fa_xenla,apn1_yeast,cac1_yeast,cha4_yeast,cyp1_yeast,dbp7_yeast,ly14_yeast,mtr4_yeast,rad5_yeast,reb1_yeast,rok1_yeast,ru1c_yeast,sen1_yeast,sko1_yeast,sof1_yeast,tea1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,mit,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,mit,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[KR]{2}x{0,1}[KR]{2,4}x{25,34}K{2,4}x{1,2}K Potential 155 97.42 2.58 dnb2_ade02,dnb2_ade05,h1_anapl,hxa5_ambme,scr_apime,sr53_arath,hx5l_brare,hxb4_brare,hxb5_brare,hxb6_brare,hxc5_brare,hxd4_brare,zfx_bovin,h101_chick,h103_chick,h110_chick,h11_caeel,h11l_chick,h11r_chick,h12_caeel,h1_chick,h1a_chite,h1o_chith,h5_caimo,h5_chick,hxa4_chick,hxa7_cotja,hxb4_chick,hxb5_chick,hxb6_chick,hxd4_chick,sr72_canfa,tp2a_crigr,hmdf_drome,hmft_drohy,no60_drome,rrp1_drome,scr_drome,suwa_drome,t2fa_drome,hxb4_fugru,atrx_human,h10_human,h1a_human,h1b_human,h1c_human,h1d_human,hxa4_human,hxa5_human,hxa6_human,hxa7_human,hxb4_human,hxb5_human,hxb6_human,hxb7_human,hxc5_human,hxd4_human,if16_human,mec2_human,no56_human,p80c_human,phi0_holtu,sfr4_human,sn24_human,sr72_human,stp2_human,t2d1_human,tat_hv2ca,tat_hv2d1,tat_hv2kr,tat_hv2nz,tat_hv2ro,tat_hv2sb,tat_hv2st,tp2a_human,zfx_human,zfy_human,tf3a_ictpu,h1_lytpi,atrx_mouse,cenc_mouse,form_mouse,h10_mouse,h11_mouse,h12_mouse,h13_mouse,h14_mouse,h15_mouse,h1l_myttr,hxa4_mouse,hxa5_mouse,hxa6_mouse,hxa7_mouse,hxb4_mouse,hxb5_mouse,hxb6_mouse,hxb7_mouse,hxc5_mouse,hxd4_mouse,lyar_mouse,phi1_myted,phi3_mytca,rt02_marpo,tp2a_mouse,zfa_mouse,zfx1_mouse,zfx2_mouse,zfy1_mouse,zfy2_mouse,hxc5_notvi,dpoa_oxytr,h1_oncmy,h1_paran,h10_rat,h12_rat,hxa4_rat,hxa5_rat,hxb7_rat,hxd3_rat,mec2_rat,h1_saltr,h1b_strpu,h1d_strpu,h1e_strpu,h1g_strpu,hxa4_sheep,hxa5_salsa,hxa7_sheep,tat_sivm1,b4_xenla,h1b_xenla,h1c1_xenla,h1c2_xenla,h5a_xenla,h5b_xenla,hb7a_xenla,hb7b_xenla,hxa7_xenla,hxb4_xenla,hxb5_xenla,hxc5_xenla,t2fa_xenla,cbf5_yeast,dpoa_yeast,drs1_yeast,nop2_yeast,nop4_yeast,nop5_yeast,r101_yeast,rad2_yeast,sen1_yeast,tf3b_yeast,top2_yeast,uga3_yeast,ume6_yeast nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,mit,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[KR]{4}x{20,24}K{1,4}xK Experimental 161 97.52 2.48 ath5_arath,ath6_arath,cop1_arath,h5_ansan,hxa5_ambme,hxad_ambme,scr_apime,sr5c_arath,sys_aquae,hx5l_brare,hxad_brare,hxb4_brare,hxb5_brare,hxb6_brare,hxc5_brare,hxc6_brare,hxd4_brare,hxdc_brare,h5_caimo,h5_chick,hmg1_chick,hmga_chick,hxa4_chick,hxa7_cotja,hxab_chick,hxb4_chick,hxb5_chick,hxb6_chick,hxd4_chick,hxd8_chick,hxdb_chick,hxdc_chick,hxdd_chick,ince_chick,sr54_canal,tp2a_crigr,tp2b_chick,tp2b_crilo,hmab_drome,hmdf_drome,hmft_drohy,hmft_drome,hmux_drome,no60_drome,scr_drome,ssrp_drome,t2d2_drome,t2fa_drome,hxb4_fugru,atrx_human,dd16_human,elf1_human,hxa4_human,hxa5_human,hxa6_human,hxa7_human,hxab_human,hxad_human,hxb4_human,hxb5_human,hxb6_human,hxb7_human,hxb8_human,hxbd_human,hxc4_human,hxc5_human,hxc6_human,hxc8_human,hxcb_human,hxcd_human,hxd4_human,hxd8_human,hxdb_human,hxdc_human,hxdd_human,mcm3_human,no56_human,ri14_human,rms1_human,sn24_human,ssrp_human,tp2a_human,tp2b_human,u2af_human,zep1_human,zn46_human,atrx_mouse,elf1_mouse,hes3_mouse,hxa4_mouse,hxa5_mouse,hxa6_mouse,hxa7_mouse,hxab_mouse,hxad_mouse,hxb4_mouse,hxb5_mouse,hxb6_mouse,hxb7_mouse,hxb8_mouse,hxbd_mouse,hxc4_mouse,hxc5_mouse,hxc6_mouse,hxc8_mouse,hxcc_mouse,hxd4_mouse,hxd8_mouse,hxdb_mouse,hxdc_mouse,hxdd_mouse,ldb1_mouse,lyar_mouse,mcm3_mouse,phi1_myted,relb_mouse,tp2a_mouse,tp2b_mouse,u2af_mouse,zep1_mouse,hxc5_notvi,hxc6_notvi,hxdb_notvi,dpoa_oxyno,rms5_penur,dkc1_rat,hes3_rat,hxa4_rat,hxa5_rat,hxb7_rat,hxb8_rat,hxc4_rat,hxc8_rat,hxd3_rat,ssrp_rat,hxa4_sheep,hxa5_salsa,hxa5_sheep,hxa7_sheep,hxc6_sheep,prt4_scyca,hb7a_xenla,hb7b_xenla,hxa7_xenla,hxb4_xenla,hxb5_xenla,hxc5_xenla,hxc6_xenla,ldb1_xenla,sph1_xenla,ubf2_xenla,dpog_yeast,mat2_yeast,msn4_yeast,nop5_yeast,pr05_yeast,rpc2_yeast,sen1_yeast,stp1_yeast,tf3b_yeast,yox1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,pla,,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,mit,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,mit,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[RK]{2,4}x{1,2}[RK]x{0,2}[RK]x{3,5}[RK]x{0,2}[RK][RK]{2,4}[PL] Potential 51 100 0 ap1_chick,ap1_cotja,hsp2_calja,irf1_chick,junb_cypca,jund_chick,prt1_clupa,prt2_clupa,yb1_chick,ap1_drome,hsp1_droau,t2fa_drome,ap1_human,cbp_human,hsp2_horse,hsp3_horse,junb_human,jund_human,no56_human,p300_human,sn22_human,ssrp_human,yb1_human,tf3a_ictpu,ap1_mouse,cbp_mouse,irf1_mouse,junb_mouse,jund_mouse,scp1_mesau,yb1_mouse,prt2_oncmy,prt3_oncmy,prt4_oncmy,prt5_oncmy,prt6_oncmy,prta_oncmy,prtb_oncmy,ap1_pig,hsp2_pig,ap1_rat,irf1_rat,junb_rat,jund_rat,scp1_rat,ap1_serca,prt1_salir,prt4_scyca,sss2_scyca,yb1_xenla,yb3_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -R[RK]x{4,6}[RK][RK]x[RK]x{1,3}[RK][RK][PLQ] Potential 18 100 0 ces2_caeel,h5_caimo,hmgi_human,hmgy_human,nnp1_human,no56_human,tef_human,hmgy_mouse,u2r1_mouse,hsp1_orcor,prt3_oncmy,prt4_oncmy,prtb_oncmy,hsp2_pig,top2_plafk,tef_rat,sss1_scyca,sss2_scyca nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[RK]{3,}?x[RK]x[RK]x{4,9}[RK]{3,}? Potential 88 100 0 hsp1_antst,hsp1_antsw,prt_antgr,hsp1_bovin,ap1_chick,ap1_cotja,hsp1_caefu,hsp_cotja,junb_cypca,jund_chick,prt3_clupa,u2af_caebr,u2af_caeel,ap1_drome,bbf2_drome,hsp1_dasro,hsp1_dasvi,hsp1_didma,hsp1_droau,t2fa_drome,trsf_drome,u2ag_drome,h1l6_ensmi,prt1_esolu,ap1_human,atf3_human,chd3_human,gcf_human,hsp1_horse,junb_human,jund_human,sp10_human,xbp1_human,ap1_mouse,atf3_mouse,hsp1_macag,hsp1_maceu,hsp1_macgi,hsp1_macrg,hsp1_macru,hsp1_mouse,hsp1_murlo,junb_mouse,jund_mouse,prt2_mugja,requ_mouse,hsp1_notty,prt1_oncke,prt2_oncmy,prt3_oncmy,prt4_oncmy,prt5_oncmy,prt6_oncmy,prt7_oncmy,prt8_oncmy,prt9_oncmy,prta_oncmy,prtb_oncmy,ap1_pig,hsp1_parbi,hsp1_phaci,hsp1_pig,hsp1_plagi,hsp1_plain,hsp1_plate,hsp1_psecu,prt_perfv,ap1_rat,hsp1_rabit,hsp1_rat,junb_rat,jund_rat,ap1_serca,hsp1_sagim,hsp1_sarha,hsp1_sheep,prt1_saror,prt1_sepof,prt2_salir,prt2_scyca,prt2_sepof,prt4_scyca,hsp1_trivu,prt1_thuth,prt2_thuth,dbp7_yeast,rad4_yeast,sen1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[GA]Rx[RK]x[RK][RK]x[QM] Potential 14 100 0 apte_drome,eya_drome,hmgc_human,rag1_human,dbx_mouse,hmgc_mouse,cys3_neucr,prh_petcr,rag1_rabit,rev_sivai,rev_sivam,rev_sivgb,dbp7_yeast,dpoe_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[PL][RK]{2,3}K[PLI][RK]x[PLI]xK Potential 2 100 0 ra17_schpo,gcn5_yeast nuc,nuc -[PLV]K[RK]x[RK][RK][RK][PL] Potential 15 100 0 dnb2_ade05,ve1_ccpv1,h10_human,no56_human,pu1_human,ve1_hpv11,ve1_hpv44,ve1_hpv6a,ve1_hpv6b,h10_mouse,pu1_mouse,tdg_mouse,ve1_pcpv1,h10_rat,hbpa_wheat nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[PL][PL]x[KR]R[DE][KR][QST] Potential 4 100 0 adf1_drome,gat1_human,gat1_mouse,gat1_rat nuc,nuc,nuc,nuc -[PLQ][KR]x{3,4}KKRK Potential 10 100 0 h2b_caimo,h2b_chick,pap_canal,h2b0_human,h2b_human,h2b1_mouse,h2b2_mouse,lyar_mouse,p53_oryla,hsf_schpo nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -R[PL]xx[KR]{2,}?xx[KR]V Potential 25 100 0 hsp2_alose,prt1_clupa,prt2_clupa,tf2d_chick,hsp2_horse,hsp3_horse,tf2d_human,tf2d_mesau,tf2d_mouse,prt1_oncke,prt2_oncmy,prt5_oncmy,prt6_oncmy,prt7_oncmy,prt8_oncmy,prt9_oncmy,prta_oncmy,prt1_salir,prt2_salir,prt3_salir,tf2d_strpu,tf2d_trifl,tf2d_triga,tf2d_xenla,est1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -R[RK]x[KR]x[RK]{2,}?[DE] Potential 132 100 0 hxa5_ambme,hxb1_ambme,scr_apime,h114_brare,hox3_brafl,hx5l_brare,hxa1_brare,hxb4_brare,hxb5_brare,hxb6_brare,hxc5_brare,hxc6_brare,hxd4_brare,pax6_brare,ctcf_chick,hxa4_chick,hxa7_cotja,hxb1_chick,hxb1_cypca,hxb3_chick,hxb4_chick,hxb5_chick,hxb6_chick,hxd3_chick,hxd4_chick,hxd8_chick,pax6_chick,pax6_cotja,un30_caeel,brm_drome,croc_drome,hmdf_drome,hmft_drohy,hmft_drome,hmux_drome,hmz1_drome,scr_drome,sus_drome,t2d2_drome,hxb4_fugru,ak95_human,cg2f_human,chd3_human,ctcf_human,fre3_human,hxa1_human,hxa3_human,hxa4_human,hxa5_human,hxa6_human,hxa7_human,hxb1_human,hxb3_human,hxb4_human,hxb5_human,hxb6_human,hxb7_human,hxb8_human,hxc4_human,hxc5_human,hxc6_human,hxc8_human,hxd3_human,hxd4_human,hxd8_human,ipf1_human,pax6_human,cx10_mouse,fre3_mouse,gsh2_mouse,gshi_mouse,hxa1_mouse,hxa3_mouse,hxa4_mouse,hxa5_mouse,hxa6_mouse,hxa7_mouse,hxb1_mouse,hxb3_mouse,hxb4_mouse,hxb5_mouse,hxb6_mouse,hxb7_mouse,hxb8_mouse,hxc4_mouse,hxc5_mouse,hxc6_mouse,hxc8_mouse,hxd1_mouse,hxd3_mouse,hxd4_mouse,hxd8_mouse,ipf1_mesau,ipf1_mouse,pax6_mouse,hxc5_notvi,hxc6_notvi,pax6_oryla,dpod_plafk,hxb8_pig,ak95_rat,hxa4_rat,hxa5_rat,hxa7_rat,hxb7_rat,hxb8_rat,hxc4_rat,hxc8_rat,hxd3_rat,ipf1_rat,pax6_rat,h2b1_strpu,h2b2_strpu,hxa4_sheep,hxa5_salsa,hxa5_sheep,hxa7_sheep,hxc6_sheep,hb7a_xenla,hb7b_xenla,hm8_xenla,hxa1_xenla,hxa7_xenla,hxb3_xenla,hxb4_xenla,hxb5_xenla,hxb6_xenla,hxc5_xenla,hxc6_xenla,hxd1_xenla,pax6_xenla,snf2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 119 90.15 116 97.47 hbox: 100 -Rx[KR][KR]K[PLQM]R Potential 6 100 0 ht31_arath,chd4_human,myba_human,tdg_mouse,cys3_neucr,top2_schpo nuc,nuc,nuc,nuc,nuc,nuc -K[KR][KR]RR[KR] Potential 28 100 0 h2b_astru,prt_antgr,prta_acist,brm_drome,atrx_human,mcm3_human,sn22_human,ssrp_human,h2b2_lytpi,atrx_mouse,cbf_mouse,h2b_margl,mcm3_mouse,ssrp_mouse,wc1_neucr,h2b1_paran,h2b2_paran,h2b3_paran,h2b_patgr,h2b_pladu,rpb1_plafd,ssrp_rat,h2bl_strpu,h2bn_strpu,hmgh_strpu,prt1_scyca,prt2_scyca,h2b_ureca nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -KKRR[DE]K Potential 3 100 0 pop1_caeel,ak95_human,ak95_rat nuc,nuc,nuc -KKRRxK Potential 12 100 0 h2b_astru,h2b_chith,pop1_caeel,ato_drome,ak95_human,t2eb_human,vbp1_human,hsf8_lycpe,h2b_margl,u2r1_mouse,ak95_rat,h2bn_strpu nuc,nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc -Kx[PLV][RK][RK]RK Potential 4 100 0 h1_echcr,stp2_mouse,stp2_rat,rpc8_yeast nuc,nuc,nuc,nuc -RRR[PL]RK Potential 5 100 0 myod_caebr,myod_caeel,myod_drome,sum1_lytva,5e5_rat nuc,nuc,nuc,nuc,nuc -[PL]RKRK[PL] Potential 3 100 0 apte_drome,ski_human,cha4_yeast nuc,nuc,nuc -R[RK]{3,}?[DE]K Potential 12 100 0 atf5_human,roa2_human,usf1_human,usf2_human,zep2_human,usf1_mouse,usf2_mouse,usf1_rabit,usf2_rat,usf_strpu,usf1_xenbo,mat2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 10 83.33 10 100 hbox: 10 bas: 90 -[PL]xxKR[IV]K[PL][DE] Potential 5 100 0 myc_calja,myc_human,myc_hylla,myc_pantr,gcn5_yeast nuc,nuc,nuc,nuc,nuc -G{2,4}[RK]x{1,3}G{3} Potential 37 100 0 ddx9_bovin,fus_bovin,hfh2_chick,nucl_chick,ceb_drome,ets4_drome,sr55_drome,cdn1_felca,ak95_human,dnbi_hsv11,dnbi_hsv1k,fbrl_human,mec2_human,nucl_human,roa2_human,rol_human,tyy1_human,ddx9_mouse,fbrl_mouse,nucl_mesau,nucl_mouse,sx21_mouse,tyy1_mouse,h2a1_pea,h2a2_pea,5e5_rat,mec2_rat,nucl_rat,sya_rhime,fbrl_schpo,gar2_schpo,grp1_sinal,grp2_sinal,fbrl_tetth,fbrl_xenla,nucl_xenla,ro22_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[KR]G{2,}?xxG{3,}?[RK] Potential 15 100 0 u2ag_drome,dnbi_hsv11,dnbi_hsv1k,fbrl_human,hme1_human,p72_human,u2ag_human,fbrl_leima,fbrl_mouse,nucl_mesau,fbrl_schpo,grp1_sinal,grp2_sinal,fbrl_xenla,nucl_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[DE][RK]{2,4}[GA]R[PL][GA] Potential 2 100 0 rok_human,dbp2_schpo nuc,nuc -[DE][RK]{3,}?x[KR]{2,}?[PL] Potential 3 100 0 yema_drome,ru1a_human,tf3a_ranpi nuc,nuc,nuc -KxxKxKxKxxxxxRKK Potential 8 100 0 ran_brare,ran_chick,ran_human,ran_mouse,rant_mouse,spi1_schpo,gsp1_yeast,gsp2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -KxKxKxxxxxRKK Potential 11 100 0 ran_brare,ran_chick,atrx_human,ran_human,atrx_mouse,ran_mouse,rant_mouse,requ_mouse,spi1_schpo,gsp1_yeast,gsp2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[RK]x[RK]x[KR]x{4,6}RKK Potential 16 100 0 ran_brare,ince_chick,ran_chick,atrx_human,dd16_human,ran_human,atrx_mouse,hx1a_maize,ran_mouse,rant_mouse,requ_mouse,prt2_scyca,spi1_schpo,apn1_yeast,gsp1_yeast,gsp2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[RK]{4,}?[QMNPL][RK]x{3,4}[RK]{2} Potential 18 100 0 prt1_clupa,prt2_clupa,prt3_clupa,hsp1_droau,prt1_esolu,atrx_human,gcf_human,prt1_oncke,prt2_oncmy,prt3_oncmy,prt4_oncmy,prt5_oncmy,prt6_oncmy,prt9_oncmy,prta_oncmy,prtb_oncmy,prt1_salir,prt2_salir nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[MI]VWSRD[HEQ]RRK Potential 8 100 0 sry_calja,sry_gorgo,sry_halgr,sry_horse,sry_human,sry_macfa,sry_melme,sry_pig nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 8 100 8 100 hmg: 100 -[TS][RK]KK[VLI]R[PL] Potential 4 100 0 hat4_arath,pu1_human,spib_human,pu1_mouse nuc,nuc,nuc,nuc -N[QR]RQ[RK][EG]KR[IVLS] Potential 26 100 0 hmp1_bovin,pou2_brare,oct1_chick,pdm1_drome,pdm2_drome,pdm2_drovi,hmp1_human,oc3a_human,oc3b_human,oct1_human,oct2_human,hmp1_melga,hmp1_mouse,oc11_mouse,oct1_mouse,oct2_mouse,oct3_mouse,hmp1_oncke,hmp1_oncmy,hmp1_pig,oct2_pig,hmp1_rat,sk1a_rat,sk1i_rat,hmp1_sheep,oct1_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 26 100 26 100 hbox: 100 -K[IVQM]RR[VI][STK]L Potential 49 100 0 br11_brare,hmp1_bovin,pou1_brare,sgf3_bommo,zp12_brare,zp23_brare,zp47_brare,zp50_brare,brn3_chick,oct1_chick,un86_caeel,cf1a_drome,ipou_drome,pdm1_drome,pdm2_drome,pdm2_drovi,br3a_human,br3b_human,br3c_human,brn1_human,brn4_human,hmp1_human,oc3n_human,oct1_human,oct2_human,oct6_human,br3a_mouse,br3b_mouse,br3c_mouse,brn1_mouse,brn4_mouse,hmp1_mouse,oc11_mouse,oc3n_mouse,oct1_mouse,oct2_mouse,oct6_mouse,oct2_pig,hmp1_rat,oc3n_rat,oct6_rat,sk1a_rat,sk1i_rat,hmp1_sheep,oct1_xenla,po3a_xenla,po3b_xenla,pou1_xenla,pou2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -WKQ[KR]RKF Potential 18 100 0 tha_chick,thb_chick,tha1_human,tha2_human,thb1_human,tha1_mouse,tha2_mouse,thb1_mouse,thb2_mouse,tha2_rat,tha_ranca,thb1_rat,thb2_rat,thb_ranca,tha1_sheep,thb1_sheep,thaa_xenla,thab_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[LF][STK][VIQM][KR]R[QMVI][STK]L Potential 52 100 0 br11_brare,hmp1_bovin,pou1_brare,sgf3_bommo,zp12_brare,zp23_brare,zp47_brare,zp50_brare,brn3_chick,oct1_chick,un86_caeel,cf1a_drome,ipou_drome,pdm1_drome,pdm2_drome,pdm2_drovi,br3a_human,br3b_human,br3c_human,brn1_human,brn4_human,hmp1_human,oc3a_human,oc3b_human,oc3n_human,oct1_human,oct2_human,oct6_human,br3a_mouse,br3b_mouse,br3c_mouse,brn1_mouse,brn4_mouse,hmp1_mouse,oc11_mouse,oc3n_mouse,oct1_mouse,oct2_mouse,oct3_mouse,oct6_mouse,oct2_pig,hmp1_rat,oc3n_rat,oct6_rat,sk1a_rat,sk1i_rat,hmp1_sheep,oct1_xenla,po3a_xenla,po3b_xenla,pou1_xenla,pou2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -QNRRxKx[RK][RK][DQE] Potential 110 100 0 hxa5_ambme,scr_apime,h114_brare,hox3_brafl,hx5l_brare,hxb4_brare,hxb5_brare,hxb6_brare,hxc5_brare,hxc6_brare,hxd4_brare,hxa2_chick,hxa4_chick,hxa7_cotja,hxb3_chick,hxb4_chick,hxb5_chick,hxb6_chick,hxd3_chick,hxd4_chick,hxd8_chick,vab7_caeel,hmdf_drome,hmev_drome,hmft_drohy,hmft_drome,hmpb_drome,hmux_drome,hmz1_drome,scr_drome,hxb4_fugru,evx1_human,evx2_human,hxa2_human,hxa3_human,hxa4_human,hxa5_human,hxa6_human,hxa7_human,hxb2_human,hxb3_human,hxb4_human,hxb5_human,hxb6_human,hxb7_human,hxb8_human,hxc4_human,hxc5_human,hxc6_human,hxc8_human,hxd3_human,hxd4_human,hxd8_human,ipf1_human,evx1_mouse,evx2_mouse,gsh2_mouse,gshi_mouse,hxa2_mouse,hxa3_mouse,hxa4_mouse,hxa5_mouse,hxa6_mouse,hxa7_mouse,hxb3_mouse,hxb4_mouse,hxb5_mouse,hxb6_mouse,hxb7_mouse,hxb8_mouse,hxc4_mouse,hxc5_mouse,hxc6_mouse,hxc8_mouse,hxd3_mouse,hxd4_mouse,hxd8_mouse,ipf1_mesau,ipf1_mouse,hxa2_notvi,hxc5_notvi,hxc6_notvi,hxa2_rat,hxa4_rat,hxa5_rat,hxa7_rat,hxb7_rat,hxb8_rat,hxc4_rat,hxc8_rat,hxd3_rat,ipf1_rat,hxa4_sheep,hxa5_salsa,hxa5_sheep,hxa7_sheep,hxb2_salsa,hxc6_sheep,hb7a_xenla,hb7b_xenla,hm8_xenla,hx3_xenla,hxa7_xenla,hxb3_xenla,hxb4_xenla,hxb5_xenla,hxb6_xenla,hxc5_xenla,hxc6_xenla,mix1_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 110 100 110 100 hbox: 100 -[QMN]R[RK]xKx[RK][RK] Potential 265 99.622641509434 0.377358490566038 hxa5_ambme,hxa9_ambme,hxad_ambme,hxb1_ambme,rt11_acaca,scr_apime,br11_brare,gsc_brare,h114_brare,hmma_brare,hmmb_brare,hmmc_brare,hmmd_brare,hmx1_bovin,hox3_brafl,hx5l_brare,hxa1_brare,hxad_brare,hxb4_brare,hxb5_brare,hxb6_brare,hxc5_brare,hxc6_brare,hxd4_brare,hxda_brare,hxdc_brare,hxdd_brare,pax6_brare,pou1_brare,pou2_brare,sgf3_bommo,zp12_brare,zp23_brare,zp47_brare,zp50_brare,gsc_chick,hm18_caeel,hmd1_chick,hmx1_chick,hmx2_chick,hmx2_cotja,hxa2_chick,hxa4_chick,hxa7_cotja,hxa9_cavpo,hxa9_chick,hxab_chick,hxb1_chick,hxb1_cypca,hxb3_chick,hxb4_chick,hxb5_chick,hxb6_chick,hxd3_chick,hxd4_chick,hxd8_chick,hxd9_chick,hxda_chick,hxdb_chick,hxdc_chick,hxdd_chick,li11_caeel,mec3_caebr,mec3_caeel,mec3_caevu,oct1_chick,pax6_chick,pax6_cotja,un30_caeel,vab7_caeel,cf1a_drome,gsc_drome,hmab_drome,hmdf_drome,hmdl_drome,hmes_drome,hmev_drome,hmft_drohy,hmft_drome,hmla_drome,hmpb_drome,hmsh_drome,hmux_drome,hmz1_drome,hmz2_drome,pdm1_drome,pdm2_drome,pdm2_drovi,scr_drome,hxa9_fugru,hxb4_fugru,hxc9_fugru,brn1_human,brn4_human,cdx1_human,cdx2_human,evx1_human,evx2_human,hb9_human,hmx1_human,hxa1_human,hxa2_human,hxa3_human,hxa4_human,hxa5_human,hxa6_human,hxa7_human,hxa9_human,hxaa_human,hxab_human,hxad_human,hxb1_human,hxb2_human,hxb3_human,hxb4_human,hxb5_human,hxb6_human,hxb7_human,hxb8_human,hxb9_human,hxbd_human,hxc4_human,hxc5_human,hxc6_human,hxc8_human,hxc9_human,hxcb_human,hxcc_human,hxcd_human,hxd3_human,hxd4_human,hxd8_human,hxd9_human,hxda_human,hxdb_human,hxdc_human,hxdd_human,ipf1_human,oc3a_human,oc3b_human,oc3n_human,oct1_human,oct2_human,oct6_human,pax6_human,pmx1_human,rms1_human,brn1_mouse,brn4_mouse,cdx1_mouse,cdx2_mesau,cdx2_mouse,cdx4_mouse,cx10_mouse,evx1_mouse,evx2_mouse,gsc_mouse,gsh2_mouse,gshi_mouse,hmx1_mouse,hmx2_mouse,hxa1_mouse,hxa2_mouse,hxa3_mouse,hxa4_mouse,hxa5_mouse,hxa6_mouse,hxa7_mouse,hxa9_mouse,hxaa_mouse,hxab_mouse,hxad_mouse,hxb1_mouse,hxb3_mouse,hxb4_mouse,hxb5_mouse,hxb6_mouse,hxb7_mouse,hxb8_mouse,hxb9_mouse,hxbd_mouse,hxc4_mouse,hxc5_mouse,hxc6_mouse,hxc8_mouse,hxc9_mouse,hxca_mouse,hxcb_mouse,hxcc_mouse,hxd1_mouse,hxd3_mouse,hxd4_mouse,hxd8_mouse,hxd9_mouse,hxda_mouse,hxdb_mouse,hxdc_mouse,hxdd_mouse,ipf1_mesau,ipf1_mouse,msx3_mouse,oc11_mouse,oc3n_mouse,oct1_mouse,oct2_mouse,oct3_mouse,oct6_mouse,pax6_mouse,pmx1_mouse,hxa2_notvi,hxc5_notvi,hxc6_notvi,hxdb_notvi,pax6_oryla,hxb8_pig,oct2_pig,cdx1_rat,hxa2_rat,hxa4_rat,hxa5_rat,hxa7_rat,hxb7_rat,hxb8_rat,hxc4_rat,hxc8_rat,hxd3_rat,ipf1_rat,msx2_rat,oc3n_rat,oct6_rat,pax6_rat,sk1a_rat,sk1i_rat,hxa4_sheep,hxa5_salsa,hxa5_sheep,hxa7_sheep,hxb2_salsa,hxc6_sheep,hxc9_sheep,rev_sivm1,gsca_xenla,gscb_xenla,hb7a_xenla,hb7b_xenla,hm8_xenla,hx3_xenla,hxa1_xenla,hxa7_xenla,hxb3_xenla,hxb4_xenla,hxb5_xenla,hxb6_xenla,hxb9_xenla,hxc5_xenla,hxc6_xenla,hxd1_xenla,mix1_xenla,oct1_xenla,pax6_xenla,po3a_xenla,po3b_xenla,pou1_xenla,pou2_xenla,pho2_yeast nuc,nuc,nuc,nuc,mit,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 262 98.86 262 100 hbox: 100 -LKKIKQ Potential 4 100 0 myb_bovin,myb_chick,myb_human,myb_mouse nuc,nuc,nuc,nuc -KxKRQR Potential 10 90 10 rel_avire,rel_chick,vab7_caeel,hmev_drome,evx1_human,evx2_human,evx1_mouse,evx2_mouse,rel_melga,hx3_xenla cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -R[PL]xGx[KR][KR]xK Potential 11 100 0 p53_brare,elg_drome,elk1_human,erf_human,etv2_human,sapa_human,sapb_human,elk1_mouse,erf_mouse,etv2_mouse,sapa_mouse nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 10 90.9 10 100 ets: 100 -KRKx{10,14}[KR]{3,}?x[KR]K Potential 24 100 0 myf5_bovin,ppol_bovin,myf5_chick,myf6_chick,myog_chick,myog_cotja,ppol_chick,myf5_human,myf6_human,myog_human,ppol_human,sum1_lytva,myf5_mouse,myf6_mouse,myog_mouse,ppol_mouse,myf5_notvi,myog_pig,myf6_rat,myog_rat,ppol_rat,myf5_xenla,ppol_xenla,pr08_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RxRRx{4,6}RKK Potential 14 100 0 p53_bovin,p53_cerae,p53_equas,p53_felca,p53_horse,p53_human,p53_macfa,p53_macmu,p53_mouse,p53_rabit,p53_rat,p53_sheep,prt2_scyca,mcm2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -KR{3,}?[LVI] Potential 21 100 0 hxad_ambme,hxad_brare,hxdd_chick,sdc3_caeel,atrx_human,hxad_human,hxcd_human,hxdd_human,ki67_human,ve2_hpv26,ve2_hpv58,ve2_hpv60,atrx_mouse,hxad_mouse,hxcd_mouse,hxdd_mouse,dpod_schpo,ra16_schpo,lama_xenla,rad5_yeast,rox3_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -K[PL]K{3,}?xKK Potential 4 100 0 aant_hdvam,chd4_human,ell_human,t2d4_human nuc,nuc,nuc,nuc -[RK]H[RK]xxx[RK]{2,4}xR Potential 11 100 0 hsp2_horse,hsp3_horse,hap2_klula,hsp2_macmu,hsp2_macne,hsp2_mouse,hsp1_notty,hsp2_pig,hsp2_rat,php2_schpo,hap2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RRxRxKxKQ Potential 5 100 0 ath5_arath,ath6_arath,hat4_arath,hat5_arath,hat7_arath nuc,nuc,nuc,nuc,nuc DNA_BIND 5 100 5 100 hbox: 100 -KRx{1,3}Hx{3,5}R[LQ]RR Potential 20 100 0 myc_astvu,myc_brare,myc1_cypca,myc2_cypca,myc_calja,myc_canfa,myc_carau,myc_chick,myc_felca,myc_human,myc_hylla,myc_marmo,myc_mouse,myc_oncmy,myc_pantr,myc_pig,myc_rat,myc_sheep,myc1_xenla,myc2_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 20 100 20 100 bas: 100 -GR[RK]{2,4}xx[RK][QL] Potential 3 100 0 prh_arath,hsp2_hylla,tat_hv1s3 nuc,nuc,nuc -RRKx{5,7}RRR Potential 31 100 0 myf5_bovin,myod_brare,prt1_bufja,prt2_bufja,myf5_chick,myf6_chick,myod_caebr,myod_caeel,myod_chick,myod_cotja,myod_drome,hsp2_gorgo,hsp2_human,myf5_human,myf6_human,myod_human,myf5_mouse,myf6_mouse,myod_mouse,myf5_notvi,myo1_oncmy,myo2_oncmy,hsp2_panpa,hsp2_pantr,hsp2_ponpy,myod_pig,myf6_rat,myod_rat,myod_sheep,myf5_xenla,myod_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -PKRPx{5,8}Lx{2,4}RxKxK Potential 4 100 0 ssrp_chick,ssrp_human,ssrp_mouse,ssrp_rat nuc,nuc,nuc,nuc DNA_BIND 4 100 4 100 hmg: 100 -KKPx{6,9}Kx{1,3}RK Potential 14 100 0 h11_arath,h1_anapl,h101_chick,h103_chick,h110_chick,h11l_chick,h11r_chick,h1_chick,pop1_caeel,h1l_myttr,ku70_mouse,p53_mouse,h2am_rat,t2fa_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -KKRKR[ST] Potential 15 100 0 br3a_chick,brn3_chick,u2af_caebr,u2af_caeel,un86_caeel,br3a_human,br3b_human,h2b0_human,h2b_human,br3a_mouse,br3b_mouse,h2b1_mouse,h2b2_mouse,br3a_rat,h2b_saltr nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RK[RK][QML][RK]xR Potential 18 100 0 ap1_chick,ap1_cotja,junb_cypca,jund_chick,ap1_drome,msl1_drome,ap1_human,junb_human,jund_human,ap1_mouse,junb_mouse,jund_mouse,ap1_pig,ap1_rat,junb_rat,jund_rat,ap1_serca,tfc5_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 16 88.88 15 93.75 bas: 100 -K[RK]{2,}?[QL]x{3,8}R{3} Potential 23 100 0 tha_chick,thb_chick,ato_drome,trsf_drome,nr54_human,tha1_human,tha2_human,thb1_human,thb2_human,tha1_mouse,tha2_mouse,thb1_mouse,thb2_mouse,tha2_rat,tha_ranca,thb1_rat,thb2_rat,prt1_scyca,tha1_sheep,thb1_sheep,thaa_xenla,thab_xenla,cha4_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -[QL]K{2,4}x{8,12}[RK][QL][RK][QL]KR Potential 9 100 0 brn3_chick,un86_caeel,ipou_drome,br3a_human,br3b_human,br3c_human,br3a_mouse,br3b_mouse,br3c_mouse nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 9 100 9 100 hbox: 100 -[RK]K{2,4}x[RK][QL][RK][PL] Potential 5 100 0 rag1_chick,ez_drome,t2d1_drome,no56_human,rag1_oncmy nuc,nuc,nuc,nuc,nuc -RRRK[STC]K Potential 2 100 0 nira_emeni,nit4_neucr nuc,nuc -Rx{2,3}Hx{3,5}RRRR Potential 24 95.83 4.16 leu3_azovi,hsp2_bovin,hsp1_didma,arnt_human,gcf_human,hsp2_hylla,usf1_human,usf2_human,cbf1_klula,arnt_mouse,hsp2_macmu,hsp2_macne,usf1_mouse,usf2_mouse,hsp1_notty,hsp2_ponpy,prt_perfv,arnt_rabit,arnt_rat,usf1_rabit,usf2_rat,usf_strpu,usf1_xenbo,cbf1_yeast cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RK]{2,4}[PL][RK]x{7,11}[RK][QL]KH Potential 2 100 0 hmen_artsf,hmin_drome nuc,nuc -RKRx{12,16}RRKK Potential 12 100 0 creb_bovin,creb_chlvr,crem_canfa,chd3_human,crea_human,creb_human,creb_hydat,crea_mouse,creb_mouse,crem_mouse,creb_rat,crem_rat nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 11 91.66 11 100 bas: 100 -KR[GPL]R[GPL]R[GLP]RK Potential 7 100 0 t2d1_drome,hmgc_human,hmgi_human,hmgy_human,hmgc_mouse,hmgy_mouse,prh_petcr nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 7 100 9 128.57 hook: 100 -KR{2,4}x{3,6}[RK]{2,4}x{0,2}KR Potential 2 100 0 t2d1_drome,prt2_scyca nuc,nuc -KHLKGR Potential 12 100 0 myb_bovin,myb_chick,myba_chick,mybb_chick,myb_human,myba_human,mybb_human,myb_mouse,myba_mouse,mybb_mouse,myb_xenla,myba_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RRxRxRKQ Potential 16 100 0 gbf1_arath,gbf2_arath,gbf3_arath,gsbd_drome,hmpr_drome,pax3_human,pax7_human,ocs1_maize,pax3_mouse,pax7_mouse,cpr1_petcr,cpr2_petcr,cpr3_petcr,taf1_tobac,emp1_wheat,hbpa_wheat nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 16 100 16 100 hbox: 37.5 bas: 62.5 -KRxRxxRRLK Potential 5 100 0 dbp_human,tef_human,dbp_mouse,dbp_rat,tef_rat nuc,nuc,nuc,nuc,nuc -KKRKRT Potential 8 100 0 br3a_chick,brn3_chick,un86_caeel,br3a_human,br3b_human,br3a_mouse,br3b_mouse,br3a_rat nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 8 100 8 100 hbox: 100 -KRGRGRPRK Potential 7 100 0 t2d1_drome,hmgc_human,hmgi_human,hmgy_human,hmgc_mouse,hmgy_mouse,prh_petcr nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 7 100 15 214.28 hook: 100 -RR[TS]x[QK][KR][KNS] Potential 41 100 0 vdr_bovin,tha_chick,thb_chick,vdr_chick,vdr_cotja,dnl4_human,rrb2_human,rrg1_human,rrg2_human,tha1_human,tha2_human,thb1_human,thb2_human,vdr_human,hmgt_mouse,rra_mouse,rrb_mouse,rrg1_mouse,rrg2_mouse,tha1_mouse,tha2_mouse,thb1_mouse,thb2_mouse,vdr_mouse,rra_notvi,rrb_notvi,tha2_rat,tha_ranca,thb1_rat,thb2_rat,thb_ranca,vdr_rat,h1s_strpu,tha1_sheep,thb1_sheep,rra_xenla,rrg1_xenla,rrg2_xenla,thaa_xenla,thab_xenla,vdr_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RxR{2,}?[QL]x[ST]R Potential 5 100 0 trsf_drome,gcf_human,rfx1_human,hsp1_tacac,prt1_thuth nuc,nuc,nuc,nuc,nuc -[RK]{2,4}x{2,4}[QLM][RK]x{2,3}[RK]KR Potential 5 100 0 ra14_canal,sdc3_caeel,spib_human,rag2_xenla,mcm3_yeast nuc,nuc,nuc,nuc,nuc -[DE]KK[PL][GL]K[GL] Potential 4 100 0 croc_drome,fre3_human,rbl2_human,fre3_mouse nuc,nuc,nuc,nuc -[QL]xKRxKxKK Potential 25 96 4 hme3_apime,hme6_apime,if2_aquae,hme1_brare,hme2_brare,hme3_brare,isl1_brare,isl2_brare,isl3_brare,hme1_chick,hme2_chick,isl1_chick,isl2_chick,hmen_drome,hmen_drovi,hmin_drome,hme1_human,hme2_human,isl1_human,hme1_mouse,hme2_mouse,is2a_oncts,is2b_oncts,isl3_oncts,isl2_rat nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 24 100 24 100 hbox: 100 -DK[QL]KK[QL] Potential 5 100 0 dpoa_human,myba_human,dpoa_mouse,myba_mouse,dpoa_rat nuc,nuc,nuc,nuc,nuc DNA_BIND 5 100 6 120 myb: 100 -KR[ST]RxxR{2,4}[QL]K Potential 6 100 0 ces2_caeel,dbp_human,tef_human,dbp_mouse,dbp_rat,tef_rat nuc,nuc,nuc,nuc,nuc,nuc -K[RK]{2,4}[ST]H Potential 29 96.55 3.44 myc_brare,myc1_cypca,myc2_cypca,myc_calja,myc_canfa,myc_carau,myc_chick,myc_felca,clk1_human,myc_human,myc_hylla,zep1_human,clk1_mouse,mcm3_mouse,myc_marmo,myc_mouse,zep1_mouse,myc_oncmy,p53_oryla,myc_pantr,myc_pig,myc_rat,myc_sheep,sye_theth,myc1_xenla,myc2_xenla,esp1_yeast,rpc2_yeast,snf6_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,cyt,nuc,nuc,nuc,nuc,nuc -RH[RK]Hx{2,4}[RK]{2,4}[PL]R Potential 3 100 0 hap2_klula,php2_schpo,hap2_yeast nuc,nuc,nuc -R[RK]{2,4}x{15,19}[RK]{2,4}[QLM]K Potential 7 100 0 andr_human,hxcc_human,andr_mouse,dbx_mouse,andr_rabit,andr_rat,rme1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc -K{3,4}R{2,3} Potential 15 100 0 h2b_chith,t2d1_drome,atrx_human,nnp1_human,sn22_human,ssrp_human,t2d1_human,tcf1_human,zfy_human,atrx_mouse,ssrp_mouse,tcf1_mouse,h2b_pladu,ssrp_rat,h2b_ureca nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -R{2,3}xK{2,3}R[ST] Potential 12 100 0 oct1_chick,pdm1_drome,pdm2_drome,pdm2_drovi,oct1_human,oct2_human,oct1_mouse,oct2_mouse,oct2_pig,dpol_rcmvm,oct1_rat,oct1_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc DNA_BIND 11 91.66 11 100 hbox: 100 -RKR{3,5}[ST] Potential 4 100 0 mb11_copci,tat_sivmk,tat_sivml,yox1_yeast nuc,nuc,nuc,nuc -Q[RK][HRK][RK]xRR Potential 17 100 0 prtb_acigu,tra1_caebr,sus_drome,atrx_human,fre4_human,hsp2_hylla,atrx_mouse,hsp1_notty,hsp1_phaci,hsp1_plams,hsp1_sagim,rev_siva1,rev_sivag,rev_sivat,rev_sivs4,rev_sivsp,mcm2_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -RRR{3,5}T Potential 5 100 0 prt1_bufja,prt2_bufja,hsp1_plain,prt_perfv,hsp1_sagim nuc,nuc,nuc,nuc,nuc -D[KR]x{0,1}[QL][RK]{2,3}R Potential 9 100 0 qin_avis3,ftf1_drome,mam_drome,ceba_human,cg2f_human,ceba_mouse,rag1_mouse,ceba_rat,rpc8_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -Px[PQLVMN][KR]{2,3}xKQ Potential 7 100 0 myb_bovin,myb_chick,cbf_human,myb_human,myb_mouse,h1c1_xenla,myb_xenla nuc,nuc,nuc,nuc,nuc,nuc,nuc -PKKKxRK Potential 7 100 0 dnb2_ade04,dnb2_ade07,dnb2_ade40,dnb2_ade41,baso_human,nil2_human,h1l_myttr nuc,nuc,nuc,nuc,nuc,nuc,nuc -KRx{10}KKKL Experimental 1 100 0 ifi3_mouse nuc -KRQRx{20}KKSKK Experimental 1 100 0 cenf_human nuc -RRRx{11}KRRK Experimental 1 100 0 cb80_human nuc -RKRIREDRKATTAQKVQQMKQRLNENERKRKR Experimental 1 0 100 ptn2_human cyt -KRKRRP Experimental 0 0 0 -PKKNRLRRP Experimental 0 0 0 -QRKRQK Experimental 0 0 0 -HRIEEKRKRTYETFKSI Experimental 0 0 0 -KKKYKLK Experimental 0 0 0 -KSKKKAQ Experimental 0 0 0 -LKRPRSPSS Experimental 0 0 0 -KRKx{22}KELQKQITK Experimental 0 0 0 -GKKKYKLKH Experimental 0 0 0 -KKKYKLK Experimental 0 0 0 -KSKKKAQ Experimental 0 0 0 -KKKRERLD Experimental 0 0 0 -RKKRKx{9}KAKKSK Experimental 0 0 0 -RRPSx{22}RRKRQ Experimental 0 0 0 -HKKKKIRTSPTFTTPKTLRLRRQPKYPRKSAPRRNKLDHY Experimental 0 0 0 -YLTQETNKVETYKEQPLKTPGKKKKGKP Experimental 0 0 0 -NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY Experimental 0 0 0 -MAPSAKATAAKKAVVKGTNGKKALKVRTSATFRLPKTLKLAR Experimental 0 0 0 -SANKVTKNKSNSSPYLNKRGKPGPDS Experimental 0 0 0 -[KR]XXKNKX{6,8}K[KR] Potential 12 100 0 det1_arath,bbf2_drome,cbp_human,hmgc_human,p300_human,cbp_mouse,h1l_myttr,hmgc_mouse,tf3a_ranpi,nucl_xenla,pho4_yeast,pr43_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc -KKx{15}KKRK Experimental 1 100 0 apn1_yeast nuc -RKRKK Experimental 36 100 0 br11_brare,pou1_brare,sgf3_bommo,zp12_brare,zp23_brare,zp47_brare,zp50_brare,cf1a_drome,sus_drome,trx_drome,brn1_human,brn4_human,chd3_human,if16_human,oc3n_human,oct6_human,t2d1_human,brn1_mouse,brn4_mouse,elf1_mouse,oc11_mouse,oc3n_mouse,oct6_mouse,oc3n_rat,oct6_rat,sk1a_rat,sk1i_rat,dpoa_schpo,hm16_xenla,hm19_xenla,hm20_xenla,po3a_xenla,po3b_xenla,pou1_xenla,pou2_xenla,sko1_yeast nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc,nuc \ No newline at end of file
--- a/tools/protein_analysis/predictnls.py Wed Feb 20 11:39:06 2013 -0500 +++ /dev/null Thu Jan 01 00:00:00 1970 +0000 @@ -1,167 +0,0 @@ -#!/usr/bin/env python - -#Copyright 2011-2013 by Peter Cock, James Hutton Institute (formerly SCRI), UK -# -#Licenced under the GPL (GNU General Public Licence) version 3. -# -#Based on Perl script predictNLS v1.3, copyright 2001-2005 and the later -#versions up to predictnls v1.0.20 (copright 2012), by Rajesh Nair -#(nair@rostlab.org) and Burkhard Rost (rost@rostlab.org), Rost Lab, -#Columbia University http://rostlab.org/ - -"""Batch mode predictNLS, for finding nuclear localization signals - -This is a Python script re-implementing the predictNLS method, originally -written in Perl, described here: - -Murat Cokol, Rajesh Nair, and Burkhard Rost. -Finding nuclear localization signals. -EMBO reports 1(5), 411-415, 2000 - -http://dx.doi.org/10.1093/embo-reports/kvd092 - -The original Perl script was designed to work on a single sequence at a time, -but offers quite detailed output, including HTML (webpage). - -This Python version is designed to work on a single FASTA file containing -multiple sequences, and produces a single tabular output file, with one line -per NLS found (i.e. zero or more rows per query sequence). - -It takes either two or three command line arguments: - -predictNLS_batch input_file output_file [nls_motif_file] - -The input file should be protein sequences in FASTA format, the output file -is tab separated plain text, and the NLS motif file defaults to using the -plain text My_NLS_list file located next to the script file, or in a data -subdirectory. - -For convience if using this outside Galaxy, the input filename can be '-' -to mean stdin, and likewise the output filename can be '-' to mean stdout. - -Tested with the My_NLS_list file included with predictnls-1.0.7.tar.gz to -predictnls-1.0.20.tar.gz inclusive (the list was extended in v1.0.7 in -August 2010, see the change log included in those tar-balls). - -The Rost Lab provide source code tar balls for predictNLS on the FTP site -ftp://rostlab.org/predictnls/ but for Debian or RedHat based Linux they -recommend their package repository instead, -https://rostlab.org/owiki/index.php/Packages -""" - -import os -import sys -import re - -def stop_err(msg, return_code=1): - sys.stderr.write(msg.rstrip() + "\n") - sys.exit(return_code) - -if len(sys.argv) == 4: - fasta_filename, tabular_filename, re_filename = sys.argv[1:] -elif len(sys.argv) == 3: - fasta_filename, tabular_filename = sys.argv[1:] - #Use os.path.realpath(...) to handle being called via a symlink - #Try under subdirectory data: - re_filename = os.path.join(os.path.dirname(os.path.realpath(sys.argv[0])), - "data", "My_NLS_list") - if not os.path.isfile(re_filename): - #Try in same directory as this script: - re_filename = os.path.join(os.path.dirname(os.path.realpath(sys.argv[0])), - "My_NLS_list") -else: - stop_err("Expect 2 or 3 arguments: input FASTA file, output tabular file, and NLS motif file") - -if not os.path.isfile(fasta_filename): - stop_err("Could not find FASTA input file: %s" % fasta_filename) - -if not os.path.isfile(re_filename): - stop_err("Could not find NLS motif file: %s" % re_filename) - -def load_re(filename): - """Parse the 5+ column tabular NLS motif file.""" - handle = open(filename, "rU") - for line in handle: - line = line.rstrip("\n") - if not line: - continue - parts = line.split("\t") - assert 5 <= len(parts), parts - regex, evidence, p_count, percent_nuc, precent_non_nuc = parts[0:5] - try: - regex = re.compile(regex) - p_count = int(p_count) - except ValueError: - stop_err("Bad data in line: %s" % line) - if 6 <= len(parts): - proteins = parts[5] - assert p_count == len(proteins.split(",")), line - else: - proteins = "" - assert p_count == 0 - if 7 <= len(parts): - domains = parts[6] - assert int(p_count) == len(domains.split(",")), line - else: - domains = "" - assert p_count == 0 - #There can be further columns (DNA binding?), but we don't use them. - yield regex, evidence, p_count, percent_nuc, proteins, domains - handle.close() - -def fasta_iterator(filename): - """Simple FASTA parser yielding tuples of (name, upper case sequence).""" - if filename == "-": - handle = sys.stdin - else: - handle = open(filename) - name, seq = "", "" - for line in handle: - if line.startswith(">"): - if name: - yield name, seq - #Take the first word only as the name: - name = line[1:].rstrip().split(None,1)[0] - seq = "" - elif name: - #Simple way would leave in any internal white space, - #seq += line.strip().upper() - seq += "".join(line.strip().upper().split()) - elif not line.strip(): - #Ignore blank lines before first record - pass - else: - raise ValueError("Bad FASTA line %r" % line) - if filename != "-": - handle.close() - if name: - yield name, seq - raise StopIteration - -motifs = list(load_re(re_filename)) -print "Looking for %i NLS motifs" % len(motifs) - -if tabular_filename == "-": - out_handle = sys.stdout -else: - out_handle = open(tabular_filename, "w") -out_handle.write("#ID\tNLS start\tNLS seq\tNLS pattern\tType\tProtCount\t%NucProt\tProtList\tProtLoci\n") -count = 0 -nls = 0 -for idn, seq in fasta_iterator(fasta_filename): - for regex, evidence, p_count, percent_nuc_prot, proteins, domains in motifs: - #Perl predictnls v1.0.17 (and older) take right most hit only, Bug #40 - #This has been fixed (v1.0.18 onwards, June 2011), so we return all the matches - for match in regex.finditer(seq): - #Perl predictnls v1.0.17 (and older) return NLS start position with zero - #but changed to one based counting in v1.0.18 (June 2011) onwards, Bug #38 - #We therefore also use one based couting, hence the start+1 here: - out_handle.write("%s\t%i\t%s\t%s\t%s\t%i\t%s\t%s\t%s\n" \ - % (idn, match.start()+1, match.group(), - regex.pattern, evidence, p_count, - percent_nuc_prot, proteins, domains)) - nls += 1 - count += 1 -if tabular_filename != "-": - out_handle.close() -print "Found %i NLS motifs in %i sequences" % (nls, count)
--- a/tools/protein_analysis/predictnls.txt Wed Feb 20 11:39:06 2013 -0500 +++ /dev/null Thu Jan 01 00:00:00 1970 +0000 @@ -1,92 +0,0 @@ -Python re-implementation of predictNLS with Galaxy wrapper -========================================================== - -This Galaxy tool is copyright 2011-2013 by Peter Cock, The James Hutton Institute -(formerly SCRI, Scottish Crop Research Institute), UK. All rights reserved. -See the licence text below. - -The tool consists of a Galaxy interface definition (predictnls.xml), and a Python -script (predictnls.py) which re-implements the command line tool predictNLS. This -should match the behaviour of predictNLS v1.0.20 (July 2011), the current latest -release from the Rost Lab, see http://rostlab.org and their paper: - -Murat Cokol, Rajesh Nair, and Burkhard Rost. -Finding nuclear localization signals. -EMBO reports 1(5), 411–415, 2000 -http://dx.doi.org/10.1093/embo-reports/kvd092 - - -Automatic Installation -====================== - -This Galaxy tool is self contained, and so should install automatically via the -Galaxy Tool Shed. See http://toolshed.g2.bx.psu.edu/view/peterjc/predictnls - - -Manual Installation -=================== - -There are just four files which should be moved under the Galaxy tools folder, -e.g. in a tools/protein_analysis filter: - -* predictlns.xml (the Galaxy tool definition) -* predictlns.py (the Python script) -* predictlns.txt (this README file) -* My_NLS_list (the default set of NLS motifs from the Rost Lab) - -You will also need to modify the tools_conf.xml file to tell Galaxy to offer the -tool. If you are using other protein analysis tools like TMHMM or SignalP, put -it next to them. Just add the line: - -<tool file="protein_analysis/predictnls.xml" /> - -If you want to run the unit tests, also add this to tool_conf.xml.sample, and -copy the test files under test-data, then run: - -./run_functional_tests.sh -id predictnls - -That's it. - - -History -======= - -v0.0.4 - Initial public release - - -Developers -========== - -This script and related tools are being developed on the following hg branch: -http://bitbucket.org/peterjc/galaxy-central/src/tools - -For making the "Galaxy Tool Shed" http://community.g2.bx.psu.edu/ tarball use -the following command from the Galaxy root folder: - -$ tar -czf predictnls.tar.gz tools/protein_analysis/predictnls.xml tools/protein_analysis/predictnls.py tools/protein_analysis/predictnls.txt tools/protein_analysis/My_NLS_list test-data/four_human_proteins.fasta test-data/four_human_proteins.predictnls.tabular - -Check this worked: - -$ tar -tzf predictnls.tar.gz -tools/protein_analysis/predictnls.xml -tools/protein_analysis/predictnls.py -tools/protein_analysis/predictnls.txt -tools/protein_analysis/My_NLS_list -test-data/four_human_proteins.fasta -test-data/four_human_proteins.predictnls.tabular - - -Licence (GPL) -============= - -This tool is open source, licensed under the GNU GENERAL PUBLIC LICENSE -version 3 (GNU v3), see http://www.gnu.org/licenses/gpl.html - -The Python script is my reimplementation of the original Perl program from -the Rost Lab, which was released under the GPL v3. Therefore, as I consider -this to be a derivative work, this too is released under the GPL v3. - -Please note that the My_NLS_list should be an exact copy of the file of the -same name included with predictnls-1.0.7.tar.gz to predictnls-1.0.20.tar.gz -inclusive (the list was extended in v1.0.7 in August 2010, see the change log -included in those tar-balls), available from ftp://rostlab.org/predictnls/
--- a/tools/protein_analysis/predictnls.xml Wed Feb 20 11:39:06 2013 -0500 +++ /dev/null Thu Jan 01 00:00:00 1970 +0000 @@ -1,82 +0,0 @@ -<tool id="predictnls" name="PredictNLS" version="0.0.4"> - <description>Find nuclear localization signals (NLSs) in protein sequences</description> - <command interpreter="python"> - predictnls.py $fasta_file $tabular_file - </command> - <inputs> - <param name="fasta_file" type="data" format="fasta" label="FASTA file of protein sequences"/> - </inputs> - <outputs> - <data name="tabular_file" format="tabular" label="predictNLS results" /> - </outputs> - <tests> - <test> - <param name="fasta_file" value="four_human_proteins.fasta"/> - <output name="tabular_file" file="four_human_proteins.predictnls.tabular"/> - </test> - </tests> - <requirements> - <requirement type="binary">predictnls</requirement> - </requirements> - <help> - -**What it does** - -This calls a Python re-implementation of the PredictNLS tool for prediction of -nuclear localization signals (NLSs), which works by looking for matches to -a known set of patterns (described using regular expressions). - -The input is a FASTA file of protein sequences, and the output is tabular with -these columns (multiple rows per protein): - -====== ========================================================================== -Column Description ------- -------------------------------------------------------------------------- - 1 Sequence identifier - 2 Start of NLS - 3 NLS sequence - 4 NLS pattern (regular expression) - 5 Number of reference proteins with this NLS - 6 Percentage of reference proteins with this NLS which are nuclear localized - 7 Comma separated list of reference proteins - 8 Comma separated list of reference proteins' localizations -====== ========================================================================== - -If a sequence has no predicted NLS, then there is no line in the output file -for it. This is a simplification of the text rich output from the command line -tool, to give a tabular file suitable for use within Galaxy. - -Information about potential DNA binding (shown in the original predictnls -tool) is not given. - -**Localizations** - -The following abbreviations are used (derived from SWISS-PROT): - -==== ======================= -Abbr Localization ----- ----------------------- -cyt Cytoplasm -pla Chloroplast -ret Eendoplasmic reticululm -ext Extracellular -gol Golgi -lys Lysosomal -mit Mitochondria -nuc Nuclear -oxi Peroxisom -vac Vacuolar -rip Periplasmic -==== ======================= - -**References** - -Murat Cokol, Rajesh Nair, and Burkhard Rost. -Finding nuclear localization signals. -EMBO reports 1(5), 411–415, 2000 -http://dx.doi.org/10.1093/embo-reports/kvd092 - -http://rostlab.org - - </help> -</tool>
