|
0
|
1 /* The MIT License
|
|
|
2
|
|
|
3 Copyright (c) 2003-2006, 2008, 2009, by Heng Li <lh3lh3@gmail.com>
|
|
|
4
|
|
|
5 Permission is hereby granted, free of charge, to any person obtaining
|
|
|
6 a copy of this software and associated documentation files (the
|
|
|
7 "Software"), to deal in the Software without restriction, including
|
|
|
8 without limitation the rights to use, copy, modify, merge, publish,
|
|
|
9 distribute, sublicense, and/or sell copies of the Software, and to
|
|
|
10 permit persons to whom the Software is furnished to do so, subject to
|
|
|
11 the following conditions:
|
|
|
12
|
|
|
13 The above copyright notice and this permission notice shall be
|
|
|
14 included in all copies or substantial portions of the Software.
|
|
|
15
|
|
|
16 THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
|
|
|
17 EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
|
|
|
18 MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND
|
|
|
19 NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS
|
|
|
20 BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN
|
|
|
21 ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN
|
|
|
22 CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE
|
|
|
23 SOFTWARE.
|
|
|
24 */
|
|
|
25
|
|
|
26 #include <stdlib.h>
|
|
|
27 #include <stdio.h>
|
|
|
28 #include <string.h>
|
|
|
29 #include <stdint.h>
|
|
|
30 #include "stdaln.h"
|
|
|
31
|
|
|
32 /* char -> 17 (=16+1) nucleotides */
|
|
|
33 unsigned char aln_nt16_table[256] = {
|
|
|
34 15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
|
|
35 15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
|
|
36 15,15,15,15, 15,15,15,15, 15,15,15,15, 15,16 /*'-'*/,15,15,
|
|
|
37 15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
|
|
38 15, 1,14, 4, 11,15,15, 2, 13,15,15,10, 15, 5,15,15,
|
|
|
39 15,15, 3, 6, 8,15, 7, 9, 0,12,15,15, 15,15,15,15,
|
|
|
40 15, 1,14, 4, 11,15,15, 2, 13,15,15,10, 15, 5,15,15,
|
|
|
41 15,15, 3, 6, 8,15, 7, 9, 0,12,15,15, 15,15,15,15,
|
|
|
42 15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
|
|
43 15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
|
|
44 15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
|
|
45 15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
|
|
46 15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
|
|
47 15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
|
|
48 15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
|
|
49 15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15
|
|
|
50 };
|
|
|
51 char *aln_nt16_rev_table = "XAGRCMSVTWKDYHBN-";
|
|
|
52
|
|
|
53 /* char -> 5 (=4+1) nucleotides */
|
|
|
54 unsigned char aln_nt4_table[256] = {
|
|
|
55 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
|
|
56 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
|
|
57 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 5 /*'-'*/, 4, 4,
|
|
|
58 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
|
|
59 4, 0, 4, 2, 4, 4, 4, 1, 4, 4, 4, 4, 4, 4, 4, 4,
|
|
|
60 4, 4, 4, 4, 3, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
|
|
61 4, 0, 4, 2, 4, 4, 4, 1, 4, 4, 4, 4, 4, 4, 4, 4,
|
|
|
62 4, 4, 4, 4, 3, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
|
|
63 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
|
|
64 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
|
|
65 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
|
|
66 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
|
|
67 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
|
|
68 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
|
|
69 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
|
|
70 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4
|
|
|
71 };
|
|
|
72 char *aln_nt4_rev_table = "AGCTN-";
|
|
|
73
|
|
|
74 /* char -> 22 (=20+1+1) amino acids */
|
|
|
75 unsigned char aln_aa_table[256] = {
|
|
|
76 21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
|
|
77 21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
|
|
78 21,21,21,21, 21,21,21,21, 21,21,20,21, 21,22 /*'-'*/,21,21,
|
|
|
79 21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
|
|
80 21, 0,21, 4, 3, 6,13, 7, 8, 9,21,11, 10,12, 2,21,
|
|
|
81 14, 5, 1,15, 16,21,19,17, 21,18,21,21, 21,21,21,21,
|
|
|
82 21, 0,21, 4, 3, 6,13, 7, 8, 9,21,11, 10,12, 2,21,
|
|
|
83 14, 5, 1,15, 16,21,19,17, 21,18,21,21, 21,21,21,21,
|
|
|
84 21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
|
|
85 21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
|
|
86 21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
|
|
87 21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
|
|
88 21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
|
|
89 21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
|
|
90 21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
|
|
91 21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21
|
|
|
92 };
|
|
|
93 char *aln_aa_rev_table = "ARNDCQEGHILKMFPSTWYV*X-";
|
|
|
94 /* 01234567890123456789012 */
|
|
|
95
|
|
|
96 /* translation table. They are useless in stdaln.c, but when you realize you need it, you need not write the table again. */
|
|
|
97 unsigned char aln_trans_table_eu[66] = {
|
|
|
98 11,11, 2, 2, 1, 1,15,15, 16,16,16,16, 9,12, 9, 9,
|
|
|
99 6, 6, 3, 3, 7, 7, 7, 7, 0, 0, 0, 0, 19,19,19,19,
|
|
|
100 5, 5, 8, 8, 1, 1, 1, 1, 14,14,14,14, 10,10,10,10,
|
|
|
101 20,20,18,18, 20,17, 4, 4, 15,15,15,15, 10,10,13,13, 21, 22
|
|
|
102 };
|
|
|
103 char *aln_trans_table_eu_char = "KKNNRRSSTTTTIMIIEEDDGGGGAAAAVVVVQQHHRRRRPPPPLLLL**YY*WCCSSSSLLFFX";
|
|
|
104 /* 01234567890123456789012345678901234567890123456789012345678901234 */
|
|
|
105 int aln_sm_blosum62[] = {
|
|
|
106 /* A R N D C Q E G H I L K M F P S T W Y V * X */
|
|
|
107 4,-1,-2,-2, 0,-1,-1, 0,-2,-1,-1,-1,-1,-2,-1, 1, 0,-3,-2, 0,-4, 0,
|
|
|
108 -1, 5, 0,-2,-3, 1, 0,-2, 0,-3,-2, 2,-1,-3,-2,-1,-1,-3,-2,-3,-4,-1,
|
|
|
109 -2, 0, 6, 1,-3, 0, 0, 0, 1,-3,-3, 0,-2,-3,-2, 1, 0,-4,-2,-3,-4,-1,
|
|
|
110 -2,-2, 1, 6,-3, 0, 2,-1,-1,-3,-4,-1,-3,-3,-1, 0,-1,-4,-3,-3,-4,-1,
|
|
|
111 0,-3,-3,-3, 9,-3,-4,-3,-3,-1,-1,-3,-1,-2,-3,-1,-1,-2,-2,-1,-4,-2,
|
|
|
112 -1, 1, 0, 0,-3, 5, 2,-2, 0,-3,-2, 1, 0,-3,-1, 0,-1,-2,-1,-2,-4,-1,
|
|
|
113 -1, 0, 0, 2,-4, 2, 5,-2, 0,-3,-3, 1,-2,-3,-1, 0,-1,-3,-2,-2,-4,-1,
|
|
|
114 0,-2, 0,-1,-3,-2,-2, 6,-2,-4,-4,-2,-3,-3,-2, 0,-2,-2,-3,-3,-4,-1,
|
|
|
115 -2, 0, 1,-1,-3, 0, 0,-2, 8,-3,-3,-1,-2,-1,-2,-1,-2,-2, 2,-3,-4,-1,
|
|
|
116 -1,-3,-3,-3,-1,-3,-3,-4,-3, 4, 2,-3, 1, 0,-3,-2,-1,-3,-1, 3,-4,-1,
|
|
|
117 -1,-2,-3,-4,-1,-2,-3,-4,-3, 2, 4,-2, 2, 0,-3,-2,-1,-2,-1, 1,-4,-1,
|
|
|
118 -1, 2, 0,-1,-3, 1, 1,-2,-1,-3,-2, 5,-1,-3,-1, 0,-1,-3,-2,-2,-4,-1,
|
|
|
119 -1,-1,-2,-3,-1, 0,-2,-3,-2, 1, 2,-1, 5, 0,-2,-1,-1,-1,-1, 1,-4,-1,
|
|
|
120 -2,-3,-3,-3,-2,-3,-3,-3,-1, 0, 0,-3, 0, 6,-4,-2,-2, 1, 3,-1,-4,-1,
|
|
|
121 -1,-2,-2,-1,-3,-1,-1,-2,-2,-3,-3,-1,-2,-4, 7,-1,-1,-4,-3,-2,-4,-2,
|
|
|
122 1,-1, 1, 0,-1, 0, 0, 0,-1,-2,-2, 0,-1,-2,-1, 4, 1,-3,-2,-2,-4, 0,
|
|
|
123 0,-1, 0,-1,-1,-1,-1,-2,-2,-1,-1,-1,-1,-2,-1, 1, 5,-2,-2, 0,-4, 0,
|
|
|
124 -3,-3,-4,-4,-2,-2,-3,-2,-2,-3,-2,-3,-1, 1,-4,-3,-2,11, 2,-3,-4,-2,
|
|
|
125 -2,-2,-2,-3,-2,-1,-2,-3, 2,-1,-1,-2,-1, 3,-3,-2,-2, 2, 7,-1,-4,-1,
|
|
|
126 0,-3,-3,-3,-1,-2,-2,-3,-3, 3, 1,-2, 1,-1,-2,-2, 0,-3,-1, 4,-4,-1,
|
|
|
127 -4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4, 1,-4,
|
|
|
128 0,-1,-1,-1,-2,-1,-1,-1,-1,-1,-1,-1,-1,-1,-2, 0, 0,-2,-1,-1,-4,-1
|
|
|
129 };
|
|
|
130
|
|
|
131 int aln_sm_blosum45[] = {
|
|
|
132 /* A R N D C Q E G H I L K M F P S T W Y V * X */
|
|
|
133 5,-2,-1,-2,-1,-1,-1, 0,-2,-1,-1,-1,-1,-2,-1, 1, 0,-2,-2, 0,-5, 0,
|
|
|
134 -2, 7, 0,-1,-3, 1, 0,-2, 0,-3,-2, 3,-1,-2,-2,-1,-1,-2,-1,-2,-5,-1,
|
|
|
135 -1, 0, 6, 2,-2, 0, 0, 0, 1,-2,-3, 0,-2,-2,-2, 1, 0,-4,-2,-3,-5,-1,
|
|
|
136 -2,-1, 2, 7,-3, 0, 2,-1, 0,-4,-3, 0,-3,-4,-1, 0,-1,-4,-2,-3,-5,-1,
|
|
|
137 -1,-3,-2,-3,12,-3,-3,-3,-3,-3,-2,-3,-2,-2,-4,-1,-1,-5,-3,-1,-5,-2,
|
|
|
138 -1, 1, 0, 0,-3, 6, 2,-2, 1,-2,-2, 1, 0,-4,-1, 0,-1,-2,-1,-3,-5,-1,
|
|
|
139 -1, 0, 0, 2,-3, 2, 6,-2, 0,-3,-2, 1,-2,-3, 0, 0,-1,-3,-2,-3,-5,-1,
|
|
|
140 0,-2, 0,-1,-3,-2,-2, 7,-2,-4,-3,-2,-2,-3,-2, 0,-2,-2,-3,-3,-5,-1,
|
|
|
141 -2, 0, 1, 0,-3, 1, 0,-2,10,-3,-2,-1, 0,-2,-2,-1,-2,-3, 2,-3,-5,-1,
|
|
|
142 -1,-3,-2,-4,-3,-2,-3,-4,-3, 5, 2,-3, 2, 0,-2,-2,-1,-2, 0, 3,-5,-1,
|
|
|
143 -1,-2,-3,-3,-2,-2,-2,-3,-2, 2, 5,-3, 2, 1,-3,-3,-1,-2, 0, 1,-5,-1,
|
|
|
144 -1, 3, 0, 0,-3, 1, 1,-2,-1,-3,-3, 5,-1,-3,-1,-1,-1,-2,-1,-2,-5,-1,
|
|
|
145 -1,-1,-2,-3,-2, 0,-2,-2, 0, 2, 2,-1, 6, 0,-2,-2,-1,-2, 0, 1,-5,-1,
|
|
|
146 -2,-2,-2,-4,-2,-4,-3,-3,-2, 0, 1,-3, 0, 8,-3,-2,-1, 1, 3, 0,-5,-1,
|
|
|
147 -1,-2,-2,-1,-4,-1, 0,-2,-2,-2,-3,-1,-2,-3, 9,-1,-1,-3,-3,-3,-5,-1,
|
|
|
148 1,-1, 1, 0,-1, 0, 0, 0,-1,-2,-3,-1,-2,-2,-1, 4, 2,-4,-2,-1,-5, 0,
|
|
|
149 0,-1, 0,-1,-1,-1,-1,-2,-2,-1,-1,-1,-1,-1,-1, 2, 5,-3,-1, 0,-5, 0,
|
|
|
150 -2,-2,-4,-4,-5,-2,-3,-2,-3,-2,-2,-2,-2, 1,-3,-4,-3,15, 3,-3,-5,-2,
|
|
|
151 -2,-1,-2,-2,-3,-1,-2,-3, 2, 0, 0,-1, 0, 3,-3,-2,-1, 3, 8,-1,-5,-1,
|
|
|
152 0,-2,-3,-3,-1,-3,-3,-3,-3, 3, 1,-2, 1, 0,-3,-1, 0,-3,-1, 5,-5,-1,
|
|
|
153 -5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5, 1,-5,
|
|
|
154 0,-1,-1,-1,-2,-1,-1,-1,-1,-1,-1,-1,-1,-1,-1, 0, 0,-2,-1,-1,-5,-1
|
|
|
155 };
|
|
|
156
|
|
|
157 int aln_sm_nt[] = {
|
|
|
158 /* X A G R C M S V T W K D Y H B N */
|
|
|
159 -2,-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,
|
|
|
160 -2, 2,-1, 1,-2, 1,-2, 0,-2, 1,-2, 0,-2, 0,-2, 0,
|
|
|
161 -2,-1, 2, 1,-2,-2, 1, 0,-2,-2, 1, 0,-2,-2, 0, 0,
|
|
|
162 -2, 1, 1, 1,-2,-1,-1, 0,-2,-1,-1, 0,-2, 0, 0, 0,
|
|
|
163 -2,-2,-2,-2, 2, 1, 1, 0,-1,-2,-2,-2, 1, 0, 0, 0,
|
|
|
164 -2, 1,-2,-1, 1, 1,-1, 0,-2,-1,-2, 0,-1, 0, 0, 0,
|
|
|
165 -2,-2, 1,-1, 1,-1, 1, 0,-2,-2,-1, 0,-1, 0, 0, 0,
|
|
|
166 -2, 0, 0, 0, 0, 0, 0, 0,-2, 0, 0, 0, 0, 0, 0, 0,
|
|
|
167 -2,-2,-2,-2,-1,-2,-2,-2, 2, 1, 1, 0, 1, 0, 0, 0,
|
|
|
168 -2, 1,-2,-1,-2,-1,-2, 0, 1, 1,-1, 0,-1, 0, 0, 0,
|
|
|
169 -2,-2, 1,-1,-2,-2,-1, 0, 1,-1, 1, 0,-1, 0, 0, 0,
|
|
|
170 -2, 0, 0, 0,-2, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
|
|
|
171 -2,-2,-2,-2, 1,-1,-1, 0, 1,-1,-1, 0, 1, 0, 0, 0,
|
|
|
172 -2, 0,-2, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
|
|
|
173 -2,-2, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
|
|
|
174 -2, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0
|
|
|
175 };
|
|
|
176
|
|
|
177 int aln_sm_read[] = {
|
|
|
178 /* X A G R C M S V T W K D Y H B N */
|
|
|
179 -17,-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,
|
|
|
180 -17, 2,-17, 1,-17, 1,-17, 0,-17, 1,-17, 0,-17, 0,-17, 0,
|
|
|
181 -17,-17, 2, 1,-17,-17, 1, 0,-17,-17, 1, 0,-17,-17, 0, 0,
|
|
|
182 -17, 1, 1, 1,-17,-17,-17, 0,-17,-17,-17, 0,-17, 0, 0, 0,
|
|
|
183 -17,-17,-17,-17, 2, 1, 1, 0,-17,-17,-17,-17, 1, 0, 0, 0,
|
|
|
184 -17, 1,-17,-17, 1, 1,-17, 0,-17,-17,-17, 0,-17, 0, 0, 0,
|
|
|
185 -17,-17, 1,-17, 1,-17, 1, 0,-17,-17,-17, 0,-17, 0, 0, 0,
|
|
|
186 -17, 0, 0, 0, 0, 0, 0, 0,-17, 0, 0, 0, 0, 0, 0, 0,
|
|
|
187 -17,-17,-17,-17,-17,-17,-17,-17, 2, 1, 1, 0, 1, 0, 0, 0,
|
|
|
188 -17, 1,-17,-17,-17,-17,-17, 0, 1, 1,-17, 0,-17, 0, 0, 0,
|
|
|
189 -17,-17, 1,-17,-17,-17,-17, 0, 1,-17, 1, 0,-17, 0, 0, 0,
|
|
|
190 -17, 0, 0, 0,-17, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
|
|
|
191 -17,-17,-17,-17, 1,-17,-17, 0, 1,-17,-17, 0, 1, 0, 0, 0,
|
|
|
192 -17, 0,-17, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
|
|
|
193 -17,-17, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
|
|
|
194 -17, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0
|
|
|
195 };
|
|
|
196
|
|
|
197 int aln_sm_hs[] = {
|
|
|
198 /* A G C T N */
|
|
|
199 91, -31,-114,-123, -44,
|
|
|
200 -31, 100,-125,-114, -42,
|
|
|
201 -123,-125, 100, -31, -42,
|
|
|
202 -114,-114, -31, 91, -42,
|
|
|
203 -44, -42, -42, -42, -43
|
|
|
204 };
|
|
|
205
|
|
|
206 int aln_sm_maq[] = {
|
|
|
207 11, -19, -19, -19, -13,
|
|
|
208 -19, 11, -19, -19, -13,
|
|
|
209 -19, -19, 11, -19, -13,
|
|
|
210 -19, -19, -19, 11, -13,
|
|
|
211 -13, -13, -13, -13, -13
|
|
|
212 };
|
|
|
213
|
|
|
214 int aln_sm_blast[] = {
|
|
|
215 1, -3, -3, -3, -2,
|
|
|
216 -3, 1, -3, -3, -2,
|
|
|
217 -3, -3, 1, -3, -2,
|
|
|
218 -3, -3, -3, 1, -2,
|
|
|
219 -2, -2, -2, -2, -2
|
|
|
220 };
|
|
|
221
|
|
|
222 /********************/
|
|
|
223 /* START OF align.c */
|
|
|
224 /********************/
|
|
|
225
|
|
|
226 AlnParam aln_param_blast = { 5, 2, 2, aln_sm_blast, 5, 50 };
|
|
|
227 AlnParam aln_param_bwa = { 26, 9, 5, aln_sm_maq, 5, 50 };
|
|
|
228 AlnParam aln_param_nt2nt = { 8, 2, 2, aln_sm_nt, 16, 75 };
|
|
|
229 AlnParam aln_param_rd2rd = { 1, 19, 19, aln_sm_read, 16, 75 };
|
|
|
230 AlnParam aln_param_aa2aa = { 10, 2, 2, aln_sm_blosum62, 22, 50 };
|
|
|
231
|
|
|
232 AlnAln *aln_init_AlnAln()
|
|
|
233 {
|
|
|
234 AlnAln *aa;
|
|
|
235 aa = (AlnAln*)malloc(sizeof(AlnAln));
|
|
|
236 aa->path = 0;
|
|
|
237 aa->out1 = aa->out2 = aa->outm = 0;
|
|
|
238 aa->path_len = 0;
|
|
|
239 return aa;
|
|
|
240 }
|
|
|
241 void aln_free_AlnAln(AlnAln *aa)
|
|
|
242 {
|
|
|
243 free(aa->path); free(aa->cigar32);
|
|
|
244 free(aa->out1); free(aa->out2); free(aa->outm);
|
|
|
245 free(aa);
|
|
|
246 }
|
|
|
247
|
|
|
248 /***************************/
|
|
|
249 /* START OF common_align.c */
|
|
|
250 /***************************/
|
|
|
251
|
|
|
252 #define LOCAL_OVERFLOW_THRESHOLD 32000
|
|
|
253 #define LOCAL_OVERFLOW_REDUCE 16000
|
|
|
254 #define NT_LOCAL_SCORE int
|
|
|
255 #define NT_LOCAL_SHIFT 16
|
|
|
256 #define NT_LOCAL_MASK 0xffff
|
|
|
257
|
|
|
258 #define SET_INF(s) (s).M = (s).I = (s).D = MINOR_INF;
|
|
|
259
|
|
|
260 #define set_M(MM, cur, p, sc) \
|
|
|
261 { \
|
|
|
262 if ((p)->M >= (p)->I) { \
|
|
|
263 if ((p)->M >= (p)->D) { \
|
|
|
264 (MM) = (p)->M + (sc); (cur)->Mt = FROM_M; \
|
|
|
265 } else { \
|
|
|
266 (MM) = (p)->D + (sc); (cur)->Mt = FROM_D; \
|
|
|
267 } \
|
|
|
268 } else { \
|
|
|
269 if ((p)->I > (p)->D) { \
|
|
|
270 (MM) = (p)->I + (sc); (cur)->Mt = FROM_I; \
|
|
|
271 } else { \
|
|
|
272 (MM) = (p)->D + (sc); (cur)->Mt = FROM_D; \
|
|
|
273 } \
|
|
|
274 } \
|
|
|
275 }
|
|
|
276 #define set_I(II, cur, p) \
|
|
|
277 { \
|
|
|
278 if ((p)->M - gap_open > (p)->I) { \
|
|
|
279 (cur)->It = FROM_M; \
|
|
|
280 (II) = (p)->M - gap_open - gap_ext; \
|
|
|
281 } else { \
|
|
|
282 (cur)->It = FROM_I; \
|
|
|
283 (II) = (p)->I - gap_ext; \
|
|
|
284 } \
|
|
|
285 }
|
|
|
286 #define set_end_I(II, cur, p) \
|
|
|
287 { \
|
|
|
288 if (gap_end >= 0) { \
|
|
|
289 if ((p)->M - gap_open > (p)->I) { \
|
|
|
290 (cur)->It = FROM_M; \
|
|
|
291 (II) = (p)->M - gap_open - gap_end; \
|
|
|
292 } else { \
|
|
|
293 (cur)->It = FROM_I; \
|
|
|
294 (II) = (p)->I - gap_end; \
|
|
|
295 } \
|
|
|
296 } else set_I(II, cur, p); \
|
|
|
297 }
|
|
|
298 #define set_D(DD, cur, p) \
|
|
|
299 { \
|
|
|
300 if ((p)->M - gap_open > (p)->D) { \
|
|
|
301 (cur)->Dt = FROM_M; \
|
|
|
302 (DD) = (p)->M - gap_open - gap_ext; \
|
|
|
303 } else { \
|
|
|
304 (cur)->Dt = FROM_D; \
|
|
|
305 (DD) = (p)->D - gap_ext; \
|
|
|
306 } \
|
|
|
307 }
|
|
|
308 #define set_end_D(DD, cur, p) \
|
|
|
309 { \
|
|
|
310 if (gap_end >= 0) { \
|
|
|
311 if ((p)->M - gap_open > (p)->D) { \
|
|
|
312 (cur)->Dt = FROM_M; \
|
|
|
313 (DD) = (p)->M - gap_open - gap_end; \
|
|
|
314 } else { \
|
|
|
315 (cur)->Dt = FROM_D; \
|
|
|
316 (DD) = (p)->D - gap_end; \
|
|
|
317 } \
|
|
|
318 } else set_D(DD, cur, p); \
|
|
|
319 }
|
|
|
320
|
|
|
321 typedef struct
|
|
|
322 {
|
|
|
323 unsigned char Mt:3, It:2, Dt:2;
|
|
|
324 } dpcell_t;
|
|
|
325
|
|
|
326 typedef struct
|
|
|
327 {
|
|
|
328 int M, I, D;
|
|
|
329 } dpscore_t;
|
|
|
330
|
|
|
331 /* build score profile for accelerating alignment, in theory */
|
|
|
332 void aln_init_score_array(unsigned char *seq, int len, int row, int *score_matrix, int **s_array)
|
|
|
333 {
|
|
|
334 int *tmp, *tmp2, i, k;
|
|
|
335 for (i = 0; i != row; ++i) {
|
|
|
336 tmp = score_matrix + i * row;
|
|
|
337 tmp2 = s_array[i];
|
|
|
338 for (k = 0; k != len; ++k)
|
|
|
339 tmp2[k] = tmp[seq[k]];
|
|
|
340 }
|
|
|
341 }
|
|
|
342 /***************************
|
|
|
343 * banded global alignment *
|
|
|
344 ***************************/
|
|
|
345 int aln_global_core(unsigned char *seq1, int len1, unsigned char *seq2, int len2, const AlnParam *ap,
|
|
|
346 path_t *path, int *path_len)
|
|
|
347 {
|
|
|
348 register int i, j;
|
|
|
349 dpcell_t **dpcell, *q;
|
|
|
350 dpscore_t *curr, *last, *s;
|
|
|
351 path_t *p;
|
|
|
352 int b1, b2, tmp_end;
|
|
|
353 int *mat, end, max;
|
|
|
354 unsigned char type, ctype;
|
|
|
355
|
|
|
356 int gap_open, gap_ext, gap_end, b;
|
|
|
357 int *score_matrix, N_MATRIX_ROW;
|
|
|
358
|
|
|
359 /* initialize some align-related parameters. just for compatibility */
|
|
|
360 gap_open = ap->gap_open;
|
|
|
361 gap_ext = ap->gap_ext;
|
|
|
362 gap_end = ap->gap_end;
|
|
|
363 b = ap->band_width;
|
|
|
364 score_matrix = ap->matrix;
|
|
|
365 N_MATRIX_ROW = ap->row;
|
|
|
366
|
|
|
367 if (len1 == 0 || len2 == 0) {
|
|
|
368 *path_len = 0;
|
|
|
369 return 0;
|
|
|
370 }
|
|
|
371 /* calculate b1 and b2 */
|
|
|
372 if (len1 > len2) {
|
|
|
373 b1 = len1 - len2 + b;
|
|
|
374 b2 = b;
|
|
|
375 } else {
|
|
|
376 b1 = b;
|
|
|
377 b2 = len2 - len1 + b;
|
|
|
378 }
|
|
|
379 if (b1 > len1) b1 = len1;
|
|
|
380 if (b2 > len2) b2 = len2;
|
|
|
381 --seq1; --seq2;
|
|
|
382
|
|
|
383 /* allocate memory */
|
|
|
384 end = (b1 + b2 <= len1)? (b1 + b2 + 1) : (len1 + 1);
|
|
|
385 dpcell = (dpcell_t**)malloc(sizeof(dpcell_t*) * (len2 + 1));
|
|
|
386 for (j = 0; j <= len2; ++j)
|
|
|
387 dpcell[j] = (dpcell_t*)malloc(sizeof(dpcell_t) * end);
|
|
|
388 for (j = b2 + 1; j <= len2; ++j)
|
|
|
389 dpcell[j] -= j - b2;
|
|
|
390 curr = (dpscore_t*)malloc(sizeof(dpscore_t) * (len1 + 1));
|
|
|
391 last = (dpscore_t*)malloc(sizeof(dpscore_t) * (len1 + 1));
|
|
|
392
|
|
|
393 /* set first row */
|
|
|
394 SET_INF(*curr); curr->M = 0;
|
|
|
395 for (i = 1, s = curr + 1; i < b1; ++i, ++s) {
|
|
|
396 SET_INF(*s);
|
|
|
397 set_end_D(s->D, dpcell[0] + i, s - 1);
|
|
|
398 }
|
|
|
399 s = curr; curr = last; last = s;
|
|
|
400
|
|
|
401 /* core dynamic programming, part 1 */
|
|
|
402 tmp_end = (b2 < len2)? b2 : len2 - 1;
|
|
|
403 for (j = 1; j <= tmp_end; ++j) {
|
|
|
404 q = dpcell[j]; s = curr; SET_INF(*s);
|
|
|
405 set_end_I(s->I, q, last);
|
|
|
406 end = (j + b1 <= len1 + 1)? (j + b1 - 1) : len1;
|
|
|
407 mat = score_matrix + seq2[j] * N_MATRIX_ROW;
|
|
|
408 ++s; ++q;
|
|
|
409 for (i = 1; i != end; ++i, ++s, ++q) {
|
|
|
410 set_M(s->M, q, last + i - 1, mat[seq1[i]]); /* this will change s->M ! */
|
|
|
411 set_I(s->I, q, last + i);
|
|
|
412 set_D(s->D, q, s - 1);
|
|
|
413 }
|
|
|
414 set_M(s->M, q, last + i - 1, mat[seq1[i]]);
|
|
|
415 set_D(s->D, q, s - 1);
|
|
|
416 if (j + b1 - 1 > len1) { /* bug fixed, 040227 */
|
|
|
417 set_end_I(s->I, q, last + i);
|
|
|
418 } else s->I = MINOR_INF;
|
|
|
419 s = curr; curr = last; last = s;
|
|
|
420 }
|
|
|
421 /* last row for part 1, use set_end_D() instead of set_D() */
|
|
|
422 if (j == len2 && b2 != len2 - 1) {
|
|
|
423 q = dpcell[j]; s = curr; SET_INF(*s);
|
|
|
424 set_end_I(s->I, q, last);
|
|
|
425 end = (j + b1 <= len1 + 1)? (j + b1 - 1) : len1;
|
|
|
426 mat = score_matrix + seq2[j] * N_MATRIX_ROW;
|
|
|
427 ++s; ++q;
|
|
|
428 for (i = 1; i != end; ++i, ++s, ++q) {
|
|
|
429 set_M(s->M, q, last + i - 1, mat[seq1[i]]); /* this will change s->M ! */
|
|
|
430 set_I(s->I, q, last + i);
|
|
|
431 set_end_D(s->D, q, s - 1);
|
|
|
432 }
|
|
|
433 set_M(s->M, q, last + i - 1, mat[seq1[i]]);
|
|
|
434 set_end_D(s->D, q, s - 1);
|
|
|
435 if (j + b1 - 1 > len1) { /* bug fixed, 040227 */
|
|
|
436 set_end_I(s->I, q, last + i);
|
|
|
437 } else s->I = MINOR_INF;
|
|
|
438 s = curr; curr = last; last = s;
|
|
|
439 ++j;
|
|
|
440 }
|
|
|
441
|
|
|
442 /* core dynamic programming, part 2 */
|
|
|
443 for (; j <= len2 - b2 + 1; ++j) {
|
|
|
444 SET_INF(curr[j - b2]);
|
|
|
445 mat = score_matrix + seq2[j] * N_MATRIX_ROW;
|
|
|
446 end = j + b1 - 1;
|
|
|
447 for (i = j - b2 + 1, q = dpcell[j] + i, s = curr + i; i != end; ++i, ++s, ++q) {
|
|
|
448 set_M(s->M, q, last + i - 1, mat[seq1[i]]);
|
|
|
449 set_I(s->I, q, last + i);
|
|
|
450 set_D(s->D, q, s - 1);
|
|
|
451 }
|
|
|
452 set_M(s->M, q, last + i - 1, mat[seq1[i]]);
|
|
|
453 set_D(s->D, q, s - 1);
|
|
|
454 s->I = MINOR_INF;
|
|
|
455 s = curr; curr = last; last = s;
|
|
|
456 }
|
|
|
457
|
|
|
458 /* core dynamic programming, part 3 */
|
|
|
459 for (; j < len2; ++j) {
|
|
|
460 SET_INF(curr[j - b2]);
|
|
|
461 mat = score_matrix + seq2[j] * N_MATRIX_ROW;
|
|
|
462 for (i = j - b2 + 1, q = dpcell[j] + i, s = curr + i; i < len1; ++i, ++s, ++q) {
|
|
|
463 set_M(s->M, q, last + i - 1, mat[seq1[i]]);
|
|
|
464 set_I(s->I, q, last + i);
|
|
|
465 set_D(s->D, q, s - 1);
|
|
|
466 }
|
|
|
467 set_M(s->M, q, last + len1 - 1, mat[seq1[i]]);
|
|
|
468 set_end_I(s->I, q, last + i);
|
|
|
469 set_D(s->D, q, s - 1);
|
|
|
470 s = curr; curr = last; last = s;
|
|
|
471 }
|
|
|
472 /* last row */
|
|
|
473 if (j == len2) {
|
|
|
474 SET_INF(curr[j - b2]);
|
|
|
475 mat = score_matrix + seq2[j] * N_MATRIX_ROW;
|
|
|
476 for (i = j - b2 + 1, q = dpcell[j] + i, s = curr + i; i < len1; ++i, ++s, ++q) {
|
|
|
477 set_M(s->M, q, last + i - 1, mat[seq1[i]]);
|
|
|
478 set_I(s->I, q, last + i);
|
|
|
479 set_end_D(s->D, q, s - 1);
|
|
|
480 }
|
|
|
481 set_M(s->M, q, last + len1 - 1, mat[seq1[i]]);
|
|
|
482 set_end_I(s->I, q, last + i);
|
|
|
483 set_end_D(s->D, q, s - 1);
|
|
|
484 s = curr; curr = last; last = s;
|
|
|
485 }
|
|
|
486
|
|
|
487 /* backtrace */
|
|
|
488 i = len1; j = len2;
|
|
|
489 q = dpcell[j] + i;
|
|
|
490 s = last + len1;
|
|
|
491 max = s->M; type = q->Mt; ctype = FROM_M;
|
|
|
492 if (s->I > max) { max = s->I; type = q->It; ctype = FROM_I; }
|
|
|
493 if (s->D > max) { max = s->D; type = q->Dt; ctype = FROM_D; }
|
|
|
494
|
|
|
495 p = path;
|
|
|
496 p->ctype = ctype; p->i = i; p->j = j; /* bug fixed 040408 */
|
|
|
497 ++p;
|
|
|
498 do {
|
|
|
499 switch (ctype) {
|
|
|
500 case FROM_M: --i; --j; break;
|
|
|
501 case FROM_I: --j; break;
|
|
|
502 case FROM_D: --i; break;
|
|
|
503 }
|
|
|
504 q = dpcell[j] + i;
|
|
|
505 ctype = type;
|
|
|
506 switch (type) {
|
|
|
507 case FROM_M: type = q->Mt; break;
|
|
|
508 case FROM_I: type = q->It; break;
|
|
|
509 case FROM_D: type = q->Dt; break;
|
|
|
510 }
|
|
|
511 p->ctype = ctype; p->i = i; p->j = j;
|
|
|
512 ++p;
|
|
|
513 } while (i || j);
|
|
|
514 *path_len = p - path - 1;
|
|
|
515
|
|
|
516 /* free memory */
|
|
|
517 for (j = b2 + 1; j <= len2; ++j)
|
|
|
518 dpcell[j] += j - b2;
|
|
|
519 for (j = 0; j <= len2; ++j)
|
|
|
520 free(dpcell[j]);
|
|
|
521 free(dpcell);
|
|
|
522 free(curr); free(last);
|
|
|
523
|
|
|
524 return max;
|
|
|
525 }
|
|
|
526 /*************************************************
|
|
|
527 * local alignment combined with banded strategy *
|
|
|
528 *************************************************/
|
|
|
529 int aln_local_core(unsigned char *seq1, int len1, unsigned char *seq2, int len2, const AlnParam *ap,
|
|
|
530 path_t *path, int *path_len, int _thres, int *_subo)
|
|
|
531 {
|
|
|
532 register NT_LOCAL_SCORE *s;
|
|
|
533 register int i;
|
|
|
534 int q, r, qr, tmp_len, qr_shift;
|
|
|
535 int **s_array, *score_array;
|
|
|
536 int e, f;
|
|
|
537 int is_overflow, of_base;
|
|
|
538 NT_LOCAL_SCORE *eh, curr_h, last_h, curr_last_h;
|
|
|
539 int j, start_i, start_j, end_i, end_j;
|
|
|
540 path_t *p;
|
|
|
541 int score_f, score_r, score_g;
|
|
|
542 int start, end, max_score;
|
|
|
543 int thres, *suba, *ss;
|
|
|
544
|
|
|
545 int gap_open, gap_ext, b;
|
|
|
546 int *score_matrix, N_MATRIX_ROW;
|
|
|
547
|
|
|
548 /* initialize some align-related parameters. just for compatibility */
|
|
|
549 gap_open = ap->gap_open;
|
|
|
550 gap_ext = ap->gap_ext;
|
|
|
551 b = ap->band_width;
|
|
|
552 score_matrix = ap->matrix;
|
|
|
553 N_MATRIX_ROW = ap->row;
|
|
|
554 thres = _thres > 0? _thres : -_thres;
|
|
|
555
|
|
|
556 if (len1 == 0 || len2 == 0) return -1;
|
|
|
557
|
|
|
558 /* allocate memory */
|
|
|
559 suba = (int*)malloc(sizeof(int) * (len2 + 1));
|
|
|
560 eh = (NT_LOCAL_SCORE*)malloc(sizeof(NT_LOCAL_SCORE) * (len1 + 1));
|
|
|
561 s_array = (int**)malloc(sizeof(int*) * N_MATRIX_ROW);
|
|
|
562 for (i = 0; i != N_MATRIX_ROW; ++i)
|
|
|
563 s_array[i] = (int*)malloc(sizeof(int) * len1);
|
|
|
564 /* initialization */
|
|
|
565 aln_init_score_array(seq1, len1, N_MATRIX_ROW, score_matrix, s_array);
|
|
|
566 q = gap_open;
|
|
|
567 r = gap_ext;
|
|
|
568 qr = q + r;
|
|
|
569 qr_shift = (qr+1) << NT_LOCAL_SHIFT;
|
|
|
570 tmp_len = len1 + 1;
|
|
|
571 start_i = start_j = end_i = end_j = 0;
|
|
|
572 for (i = 0, max_score = 0; i != N_MATRIX_ROW * N_MATRIX_ROW; ++i)
|
|
|
573 if (max_score < score_matrix[i]) max_score = score_matrix[i];
|
|
|
574 /* convert the coordinate */
|
|
|
575 --seq1; --seq2;
|
|
|
576 for (i = 0; i != N_MATRIX_ROW; ++i) --s_array[i];
|
|
|
577
|
|
|
578 /* forward dynamic programming */
|
|
|
579 for (i = 0, s = eh; i != tmp_len; ++i, ++s) *s = 0;
|
|
|
580 score_f = 0;
|
|
|
581 is_overflow = of_base = 0;
|
|
|
582 suba[0] = 0;
|
|
|
583 for (j = 1, ss = suba + 1; j <= len2; ++j, ++ss) {
|
|
|
584 int subo = 0;
|
|
|
585 last_h = f = 0;
|
|
|
586 score_array = s_array[seq2[j]];
|
|
|
587 if (is_overflow) { /* adjust eh[] array if overflow occurs. */
|
|
|
588 /* If LOCAL_OVERFLOW_REDUCE is too small, optimal alignment might be missed.
|
|
|
589 * If it is too large, this block will be excuted frequently and therefore
|
|
|
590 * slow down the whole program.
|
|
|
591 * Acually, smaller LOCAL_OVERFLOW_REDUCE might also help to reduce the
|
|
|
592 * number of assignments because it sets some cells to zero when overflow
|
|
|
593 * happens. */
|
|
|
594 int tmp, tmp2;
|
|
|
595 score_f -= LOCAL_OVERFLOW_REDUCE;
|
|
|
596 of_base += LOCAL_OVERFLOW_REDUCE;
|
|
|
597 is_overflow = 0;
|
|
|
598 for (i = 1, s = eh; i <= tmp_len; ++i, ++s) {
|
|
|
599 tmp = *s >> NT_LOCAL_SHIFT; tmp2 = *s & NT_LOCAL_MASK;
|
|
|
600 if (tmp2 < LOCAL_OVERFLOW_REDUCE) tmp2 = 0;
|
|
|
601 else tmp2 -= LOCAL_OVERFLOW_REDUCE;
|
|
|
602 if (tmp < LOCAL_OVERFLOW_REDUCE) tmp = 0;
|
|
|
603 else tmp -= LOCAL_OVERFLOW_REDUCE;
|
|
|
604 *s = (tmp << NT_LOCAL_SHIFT) | tmp2;
|
|
|
605 }
|
|
|
606 }
|
|
|
607 for (i = 1, s = eh; i != tmp_len; ++i, ++s) {
|
|
|
608 /* prepare for calculate current h */
|
|
|
609 curr_h = (*s >> NT_LOCAL_SHIFT) + score_array[i];
|
|
|
610 if (curr_h < 0) curr_h = 0;
|
|
|
611 if (last_h > 0) { /* initialize f */
|
|
|
612 f = (f > last_h - q)? f - r : last_h - qr;
|
|
|
613 if (curr_h < f) curr_h = f;
|
|
|
614 }
|
|
|
615 if (*(s+1) >= qr_shift) { /* initialize e */
|
|
|
616 curr_last_h = *(s+1) >> NT_LOCAL_SHIFT;
|
|
|
617 e = ((*s & NT_LOCAL_MASK) > curr_last_h - q)? (*s & NT_LOCAL_MASK) - r : curr_last_h - qr;
|
|
|
618 if (curr_h < e) curr_h = e;
|
|
|
619 *s = (last_h << NT_LOCAL_SHIFT) | e;
|
|
|
620 } else *s = last_h << NT_LOCAL_SHIFT; /* e = 0 */
|
|
|
621 last_h = curr_h;
|
|
|
622 if (subo < curr_h) subo = curr_h;
|
|
|
623 if (score_f < curr_h) {
|
|
|
624 score_f = curr_h; end_i = i; end_j = j;
|
|
|
625 if (score_f > LOCAL_OVERFLOW_THRESHOLD) is_overflow = 1;
|
|
|
626 }
|
|
|
627 }
|
|
|
628 *s = last_h << NT_LOCAL_SHIFT;
|
|
|
629 *ss = subo + of_base;
|
|
|
630 }
|
|
|
631 score_f += of_base;
|
|
|
632
|
|
|
633 if (score_f < thres) { /* no matching residue at all, 090218 */
|
|
|
634 *path_len = 0;
|
|
|
635 goto end_func;
|
|
|
636 }
|
|
|
637 if (path == 0) goto end_func; /* skip path-filling */
|
|
|
638
|
|
|
639 /* reverse dynamic programming */
|
|
|
640 for (i = end_i, s = eh + end_i; i >= 0; --i, --s) *s = 0;
|
|
|
641 if (end_i == 0 || end_j == 0) goto end_func; /* no local match */
|
|
|
642 score_r = score_matrix[seq1[end_i] * N_MATRIX_ROW + seq2[end_j]];
|
|
|
643 is_overflow = of_base = 0;
|
|
|
644 start_i = end_i; start_j = end_j;
|
|
|
645 eh[end_i] = ((NT_LOCAL_SCORE)(qr + score_r)) << NT_LOCAL_SHIFT; /* in order to initialize f and e, 040408 */
|
|
|
646 start = end_i - 1;
|
|
|
647 end = end_i - 3;
|
|
|
648 if (end <= 0) end = 0;
|
|
|
649
|
|
|
650 /* second pass DP can be done in a band, speed will thus be enhanced */
|
|
|
651 for (j = end_j - 1; j != 0; --j) {
|
|
|
652 last_h = f = 0;
|
|
|
653 score_array = s_array[seq2[j]];
|
|
|
654 if (is_overflow) { /* adjust eh[] array if overflow occurs. */
|
|
|
655 int tmp, tmp2;
|
|
|
656 score_r -= LOCAL_OVERFLOW_REDUCE;
|
|
|
657 of_base += LOCAL_OVERFLOW_REDUCE;
|
|
|
658 is_overflow = 0;
|
|
|
659 for (i = start, s = eh + start + 1; i >= end; --i, --s) {
|
|
|
660 tmp = *s >> NT_LOCAL_SHIFT; tmp2 = *s & NT_LOCAL_MASK;
|
|
|
661 if (tmp2 < LOCAL_OVERFLOW_REDUCE) tmp2 = 0;
|
|
|
662 else tmp2 -= LOCAL_OVERFLOW_REDUCE;
|
|
|
663 if (tmp < LOCAL_OVERFLOW_REDUCE) tmp = 0;
|
|
|
664 else tmp -= LOCAL_OVERFLOW_REDUCE;
|
|
|
665 *s = (tmp << NT_LOCAL_SHIFT) | tmp2;
|
|
|
666 }
|
|
|
667 }
|
|
|
668 for (i = start, s = eh + start + 1; i != end; --i, --s) {
|
|
|
669 /* prepare for calculate current h */
|
|
|
670 curr_h = (*s >> NT_LOCAL_SHIFT) + score_array[i];
|
|
|
671 if (curr_h < 0) curr_h = 0;
|
|
|
672 if (last_h > 0) { /* initialize f */
|
|
|
673 f = (f > last_h - q)? f - r : last_h - qr;
|
|
|
674 if (curr_h < f) curr_h = f;
|
|
|
675 }
|
|
|
676 curr_last_h = *(s-1) >> NT_LOCAL_SHIFT;
|
|
|
677 e = ((*s & NT_LOCAL_MASK) > curr_last_h - q)? (*s & NT_LOCAL_MASK) - r : curr_last_h - qr;
|
|
|
678 if (e < 0) e = 0;
|
|
|
679 if (curr_h < e) curr_h = e;
|
|
|
680 *s = (last_h << NT_LOCAL_SHIFT) | e;
|
|
|
681 last_h = curr_h;
|
|
|
682 if (score_r < curr_h) {
|
|
|
683 score_r = curr_h; start_i = i; start_j = j;
|
|
|
684 if (score_r + of_base - qr == score_f) {
|
|
|
685 j = 1; break;
|
|
|
686 }
|
|
|
687 if (score_r > LOCAL_OVERFLOW_THRESHOLD) is_overflow = 1;
|
|
|
688 }
|
|
|
689 }
|
|
|
690 *s = last_h << NT_LOCAL_SHIFT;
|
|
|
691 /* recalculate start and end, the boundaries of the band */
|
|
|
692 if ((eh[start] >> NT_LOCAL_SHIFT) <= qr) --start;
|
|
|
693 if (start <= 0) start = 0;
|
|
|
694 end = start_i - (start_j - j) - (score_r + of_base + (start_j - j) * max_score) / r - 1;
|
|
|
695 if (end <= 0) end = 0;
|
|
|
696 }
|
|
|
697
|
|
|
698 if (_subo) {
|
|
|
699 int tmp2 = 0, tmp = (int)(start_j - .33 * (end_j - start_j) + .499);
|
|
|
700 for (j = 1; j <= tmp; ++j)
|
|
|
701 if (tmp2 < suba[j]) tmp2 = suba[j];
|
|
|
702 tmp = (int)(end_j + .33 * (end_j - start_j) + .499);
|
|
|
703 for (j = tmp; j <= len2; ++j)
|
|
|
704 if (tmp2 < suba[j]) tmp2 = suba[j];
|
|
|
705 *_subo = tmp2;
|
|
|
706 }
|
|
|
707
|
|
|
708 if (path_len == 0) {
|
|
|
709 path[0].i = start_i; path[0].j = start_j;
|
|
|
710 path[1].i = end_i; path[1].j = end_j;
|
|
|
711 goto end_func;
|
|
|
712 }
|
|
|
713
|
|
|
714 score_r += of_base;
|
|
|
715 score_r -= qr;
|
|
|
716
|
|
|
717 #ifdef DEBUG
|
|
|
718 /* this seems not a bug */
|
|
|
719 if (score_f != score_r)
|
|
|
720 fprintf(stderr, "[aln_local_core] unknown flaw occurs: score_f(%d) != score_r(%d)\n", score_f, score_r);
|
|
|
721 #endif
|
|
|
722
|
|
|
723 if (_thres > 0) { /* call global alignment to fill the path */
|
|
|
724 score_g = 0;
|
|
|
725 j = (end_i - start_i > end_j - start_j)? end_i - start_i : end_j - start_j;
|
|
|
726 ++j; /* j is the maximum band_width */
|
|
|
727 for (i = ap->band_width;; i <<= 1) {
|
|
|
728 AlnParam ap_real = *ap;
|
|
|
729 ap_real.gap_end = -1;
|
|
|
730 ap_real.band_width = i;
|
|
|
731 score_g = aln_global_core(seq1 + start_i, end_i - start_i + 1, seq2 + start_j,
|
|
|
732 end_j - start_j + 1, &ap_real, path, path_len);
|
|
|
733 if (score_g == score_r || score_f == score_g) break;
|
|
|
734 if (i > j) break;
|
|
|
735 }
|
|
|
736 if (score_r > score_g && score_f > score_g) {
|
|
|
737 fprintf(stderr, "[aln_local_core] Potential bug: (%d,%d) > %d\n", score_f, score_r, score_g);
|
|
|
738 score_f = score_r = -1;
|
|
|
739 } else score_f = score_g;
|
|
|
740
|
|
|
741 /* convert coordinate */
|
|
|
742 for (p = path + *path_len - 1; p >= path; --p) {
|
|
|
743 p->i += start_i - 1;
|
|
|
744 p->j += start_j - 1;
|
|
|
745 }
|
|
|
746 } else { /* just store the start and end */
|
|
|
747 *path_len = 2;
|
|
|
748 path[1].i = start_i; path[1].j = start_j;
|
|
|
749 path->i = end_i; path->j = end_j;
|
|
|
750 }
|
|
|
751
|
|
|
752 end_func:
|
|
|
753 /* free */
|
|
|
754 free(eh); free(suba);
|
|
|
755 for (i = 0; i != N_MATRIX_ROW; ++i) {
|
|
|
756 ++s_array[i];
|
|
|
757 free(s_array[i]);
|
|
|
758 }
|
|
|
759 free(s_array);
|
|
|
760 return score_f;
|
|
|
761 }
|
|
|
762 AlnAln *aln_stdaln_aux(const char *seq1, const char *seq2, const AlnParam *ap,
|
|
|
763 int type, int thres, int len1, int len2)
|
|
|
764 {
|
|
|
765 unsigned char *seq11, *seq22;
|
|
|
766 int score;
|
|
|
767 int i, j, l;
|
|
|
768 path_t *p;
|
|
|
769 char *out1, *out2, *outm;
|
|
|
770 AlnAln *aa;
|
|
|
771
|
|
|
772 if (len1 < 0) len1 = strlen(seq1);
|
|
|
773 if (len2 < 0) len2 = strlen(seq2);
|
|
|
774
|
|
|
775 aa = aln_init_AlnAln();
|
|
|
776 seq11 = (unsigned char*)malloc(sizeof(unsigned char) * len1);
|
|
|
777 seq22 = (unsigned char*)malloc(sizeof(unsigned char) * len2);
|
|
|
778 aa->path = (path_t*)malloc(sizeof(path_t) * (len1 + len2 + 1));
|
|
|
779
|
|
|
780 if (ap->row < 10) { /* 4-nucleotide alignment */
|
|
|
781 for (i = 0; i < len1; ++i)
|
|
|
782 seq11[i] = aln_nt4_table[(int)seq1[i]];
|
|
|
783 for (j = 0; j < len2; ++j)
|
|
|
784 seq22[j] = aln_nt4_table[(int)seq2[j]];
|
|
|
785 } else if (ap->row < 20) { /* 16-nucleotide alignment */
|
|
|
786 for (i = 0; i < len1; ++i)
|
|
|
787 seq11[i] = aln_nt16_table[(int)seq1[i]];
|
|
|
788 for (j = 0; j < len2; ++j)
|
|
|
789 seq22[j] = aln_nt16_table[(int)seq2[j]];
|
|
|
790 } else { /* amino acids */
|
|
|
791 for (i = 0; i < len1; ++i)
|
|
|
792 seq11[i] = aln_aa_table[(int)seq1[i]];
|
|
|
793 for (j = 0; j < len2; ++j)
|
|
|
794 seq22[j] = aln_aa_table[(int)seq2[j]];
|
|
|
795 }
|
|
|
796
|
|
|
797 if (type == ALN_TYPE_GLOBAL) score = aln_global_core(seq11, len1, seq22, len2, ap, aa->path, &aa->path_len);
|
|
|
798 else if (type == ALN_TYPE_LOCAL) score = aln_local_core(seq11, len1, seq22, len2, ap, aa->path, &aa->path_len, thres, &aa->subo);
|
|
|
799 else if (type == ALN_TYPE_EXTEND) score = aln_extend_core(seq11, len1, seq22, len2, ap, aa->path, &aa->path_len, 1, 0);
|
|
|
800 else {
|
|
|
801 free(seq11); free(seq22); free(aa->path);
|
|
|
802 aln_free_AlnAln(aa);
|
|
|
803 return 0;
|
|
|
804 }
|
|
|
805 aa->score = score;
|
|
|
806
|
|
|
807 if (thres > 0) {
|
|
|
808 out1 = aa->out1 = (char*)malloc(sizeof(char) * (aa->path_len + 1));
|
|
|
809 out2 = aa->out2 = (char*)malloc(sizeof(char) * (aa->path_len + 1));
|
|
|
810 outm = aa->outm = (char*)malloc(sizeof(char) * (aa->path_len + 1));
|
|
|
811
|
|
|
812 --seq1; --seq2;
|
|
|
813 --seq11; --seq22;
|
|
|
814
|
|
|
815 p = aa->path + aa->path_len - 1;
|
|
|
816
|
|
|
817 for (l = 0; p >= aa->path; --p, ++l) {
|
|
|
818 switch (p->ctype) {
|
|
|
819 case FROM_M: out1[l] = seq1[p->i]; out2[l] = seq2[p->j];
|
|
|
820 outm[l] = (seq11[p->i] == seq22[p->j] && seq11[p->i] != ap->row)? '|' : ' ';
|
|
|
821 break;
|
|
|
822 case FROM_I: out1[l] = '-'; out2[l] = seq2[p->j]; outm[l] = ' '; break;
|
|
|
823 case FROM_D: out1[l] = seq1[p->i]; out2[l] = '-'; outm[l] = ' '; break;
|
|
|
824 }
|
|
|
825 }
|
|
|
826 out1[l] = out2[l] = outm[l] = '\0';
|
|
|
827 ++seq11; ++seq22;
|
|
|
828 }
|
|
|
829
|
|
|
830 free(seq11);
|
|
|
831 free(seq22);
|
|
|
832
|
|
|
833 p = aa->path + aa->path_len - 1;
|
|
|
834 aa->start1 = p->i? p->i : 1;
|
|
|
835 aa->end1 = aa->path->i;
|
|
|
836 aa->start2 = p->j? p->j : 1;
|
|
|
837 aa->end2 = aa->path->j;
|
|
|
838 aa->cigar32 = aln_path2cigar32(aa->path, aa->path_len, &aa->n_cigar);
|
|
|
839
|
|
|
840 return aa;
|
|
|
841 }
|
|
|
842 AlnAln *aln_stdaln(const char *seq1, const char *seq2, const AlnParam *ap, int type, int thres)
|
|
|
843 {
|
|
|
844 return aln_stdaln_aux(seq1, seq2, ap, type, thres, -1, -1);
|
|
|
845 }
|
|
|
846
|
|
|
847 /* for backward compatibility */
|
|
|
848 uint16_t *aln_path2cigar(const path_t *path, int path_len, int *n_cigar)
|
|
|
849 {
|
|
|
850 uint32_t *cigar32;
|
|
|
851 uint16_t *cigar;
|
|
|
852 int i;
|
|
|
853 cigar32 = aln_path2cigar32(path, path_len, n_cigar);
|
|
|
854 cigar = (uint16_t*)cigar32;
|
|
|
855 for (i = 0; i < *n_cigar; ++i)
|
|
|
856 cigar[i] = (cigar32[i]&0xf)<<14 | (cigar32[i]>>4&0x3fff);
|
|
|
857 return cigar;
|
|
|
858 }
|
|
|
859
|
|
|
860 /* newly added functions (2009-07-21) */
|
|
|
861
|
|
|
862 int aln_extend_core(unsigned char *seq1, int len1, unsigned char *seq2, int len2, const AlnParam *ap,
|
|
|
863 path_t *path, int *path_len, int G0, uint8_t *_mem)
|
|
|
864 {
|
|
|
865 int q, r, qr, tmp_len;
|
|
|
866 int32_t **s_array, *score_array;
|
|
|
867 int is_overflow, of_base;
|
|
|
868 uint32_t *eh;
|
|
|
869 int i, j, end_i, end_j;
|
|
|
870 int score, start, end;
|
|
|
871 int *score_matrix, N_MATRIX_ROW;
|
|
|
872 uint8_t *mem, *_p;
|
|
|
873
|
|
|
874 /* initialize some align-related parameters. just for compatibility */
|
|
|
875 q = ap->gap_open;
|
|
|
876 r = ap->gap_ext;
|
|
|
877 qr = q + r;
|
|
|
878 score_matrix = ap->matrix;
|
|
|
879 N_MATRIX_ROW = ap->row;
|
|
|
880
|
|
|
881 if (len1 == 0 || len2 == 0) return -1;
|
|
|
882
|
|
|
883 /* allocate memory */
|
|
|
884 mem = _mem? _mem : calloc((len1 + 2) * (N_MATRIX_ROW + 1), 4);
|
|
|
885 _p = mem;
|
|
|
886 eh = (uint32_t*)_p, _p += 4 * (len1 + 2);
|
|
|
887 s_array = calloc(N_MATRIX_ROW, sizeof(void*));
|
|
|
888 for (i = 0; i != N_MATRIX_ROW; ++i)
|
|
|
889 s_array[i] = (int32_t*)_p, _p += 4 * len1;
|
|
|
890 /* initialization */
|
|
|
891 aln_init_score_array(seq1, len1, N_MATRIX_ROW, score_matrix, s_array);
|
|
|
892 tmp_len = len1 + 1;
|
|
|
893 start = 1; end = 2;
|
|
|
894 end_i = end_j = 0;
|
|
|
895 score = 0;
|
|
|
896 is_overflow = of_base = 0;
|
|
|
897 /* convert the coordinate */
|
|
|
898 --seq1; --seq2;
|
|
|
899 for (i = 0; i != N_MATRIX_ROW; ++i) --s_array[i];
|
|
|
900
|
|
|
901 /* dynamic programming */
|
|
|
902 memset(eh, 0, 4 * (len1 + 2));
|
|
|
903 eh[1] = (uint32_t)G0<<16;
|
|
|
904 for (j = 1; j <= len2; ++j) {
|
|
|
905 int _start, _end;
|
|
|
906 int h1 = 0, f = 0;
|
|
|
907 score_array = s_array[seq2[j]];
|
|
|
908 /* set start and end */
|
|
|
909 _start = j - ap->band_width;
|
|
|
910 if (_start < 1) _start = 1;
|
|
|
911 if (_start > start) start = _start;
|
|
|
912 _end = j + ap->band_width;
|
|
|
913 if (_end > len1 + 1) _end = len1 + 1;
|
|
|
914 if (_end < end) end = _end;
|
|
|
915 if (start == end) break;
|
|
|
916 /* adjust eh[] array if overflow occurs. */
|
|
|
917 if (is_overflow) {
|
|
|
918 int tmp, tmp2;
|
|
|
919 score -= LOCAL_OVERFLOW_REDUCE;
|
|
|
920 of_base += LOCAL_OVERFLOW_REDUCE;
|
|
|
921 is_overflow = 0;
|
|
|
922 for (i = start; i <= end; ++i) {
|
|
|
923 uint32_t *s = &eh[i];
|
|
|
924 tmp = *s >> 16; tmp2 = *s & 0xffff;
|
|
|
925 if (tmp2 < LOCAL_OVERFLOW_REDUCE) tmp2 = 0;
|
|
|
926 else tmp2 -= LOCAL_OVERFLOW_REDUCE;
|
|
|
927 if (tmp < LOCAL_OVERFLOW_REDUCE) tmp = 0;
|
|
|
928 else tmp -= LOCAL_OVERFLOW_REDUCE;
|
|
|
929 *s = (tmp << 16) | tmp2;
|
|
|
930 }
|
|
|
931 }
|
|
|
932 _start = _end = 0;
|
|
|
933 /* the inner loop */
|
|
|
934 for (i = start; i < end; ++i) {
|
|
|
935 /* At the beginning of each cycle:
|
|
|
936 eh[i] -> h[j-1,i-1]<<16 | e[j,i]
|
|
|
937 f -> f[j,i]
|
|
|
938 h1 -> h[j,i-1]
|
|
|
939 */
|
|
|
940 uint32_t *s = &eh[i];
|
|
|
941 int h = (int)(*s >> 16);
|
|
|
942 int e = *s & 0xffff; /* this is e[j,i] */
|
|
|
943 *s = (uint32_t)h1 << 16; /* eh[i] now stores h[j,i-1]<<16 */
|
|
|
944 h += h? score_array[i] : 0; /* this is left_core() specific */
|
|
|
945 /* calculate h[j,i]; don't need to test 0, as {e,f}>=0 */
|
|
|
946 h = h > e? h : e;
|
|
|
947 h = h > f? h : f; /* h now is h[j,i] */
|
|
|
948 h1 = h;
|
|
|
949 if (h > 0) {
|
|
|
950 if (_start == 0) _start = i;
|
|
|
951 _end = i;
|
|
|
952 if (score < h) {
|
|
|
953 score = h; end_i = i; end_j = j;
|
|
|
954 if (score > LOCAL_OVERFLOW_THRESHOLD) is_overflow = 1;
|
|
|
955 }
|
|
|
956 }
|
|
|
957 /* calculate e[j+1,i] and f[j,i+1] */
|
|
|
958 h -= qr;
|
|
|
959 h = h > 0? h : 0;
|
|
|
960 e -= r;
|
|
|
961 e = e > h? e : h;
|
|
|
962 f -= r;
|
|
|
963 f = f > h? f : h;
|
|
|
964 *s |= e;
|
|
|
965 }
|
|
|
966 eh[end] = h1 << 16;
|
|
|
967 /* recalculate start and end, the boundaries of the band */
|
|
|
968 if (_end <= 0) break; /* no cell in this row has a positive score */
|
|
|
969 start = _start;
|
|
|
970 end = _end + 3;
|
|
|
971 }
|
|
|
972
|
|
|
973 score += of_base - 1;
|
|
|
974 if (score <= 0) {
|
|
|
975 if (path_len) *path_len = 0;
|
|
|
976 goto end_left_func;
|
|
|
977 }
|
|
|
978
|
|
|
979 if (path == 0) goto end_left_func;
|
|
|
980
|
|
|
981 if (path_len == 0) {
|
|
|
982 path[0].i = end_i; path[0].j = end_j;
|
|
|
983 goto end_left_func;
|
|
|
984 }
|
|
|
985
|
|
|
986 { /* call global alignment to fill the path */
|
|
|
987 int score_g = 0;
|
|
|
988 j = (end_i - 1 > end_j - 1)? end_i - 1 : end_j - 1;
|
|
|
989 ++j; /* j is the maximum band_width */
|
|
|
990 for (i = ap->band_width;; i <<= 1) {
|
|
|
991 AlnParam ap_real = *ap;
|
|
|
992 ap_real.gap_end = -1;
|
|
|
993 ap_real.band_width = i;
|
|
|
994 score_g = aln_global_core(seq1 + 1, end_i, seq2 + 1, end_j, &ap_real, path, path_len);
|
|
|
995 if (score == score_g) break;
|
|
|
996 if (i > j) break;
|
|
|
997 }
|
|
|
998 if (score > score_g)
|
|
|
999 fprintf(stderr, "[aln_left_core] no suitable bandwidth: %d < %d\n", score_g, score);
|
|
|
1000 score = score_g;
|
|
|
1001 }
|
|
|
1002
|
|
|
1003 end_left_func:
|
|
|
1004 /* free */
|
|
|
1005 free(s_array);
|
|
|
1006 if (!_mem) free(mem);
|
|
|
1007 return score;
|
|
|
1008 }
|
|
|
1009
|
|
|
1010 uint32_t *aln_path2cigar32(const path_t *path, int path_len, int *n_cigar)
|
|
|
1011 {
|
|
|
1012 int i, n;
|
|
|
1013 uint32_t *cigar;
|
|
|
1014 unsigned char last_type;
|
|
|
1015
|
|
|
1016 if (path_len == 0 || path == 0) {
|
|
|
1017 *n_cigar = 0;
|
|
|
1018 return 0;
|
|
|
1019 }
|
|
|
1020
|
|
|
1021 last_type = path->ctype;
|
|
|
1022 for (i = n = 1; i < path_len; ++i) {
|
|
|
1023 if (last_type != path[i].ctype) ++n;
|
|
|
1024 last_type = path[i].ctype;
|
|
|
1025 }
|
|
|
1026 *n_cigar = n;
|
|
|
1027 cigar = (uint32_t*)malloc(*n_cigar * 4);
|
|
|
1028
|
|
|
1029 cigar[0] = 1u << 4 | path[path_len-1].ctype;
|
|
|
1030 last_type = path[path_len-1].ctype;
|
|
|
1031 for (i = path_len - 2, n = 0; i >= 0; --i) {
|
|
|
1032 if (path[i].ctype == last_type) cigar[n] += 1u << 4;
|
|
|
1033 else {
|
|
|
1034 cigar[++n] = 1u << 4 | path[i].ctype;
|
|
|
1035 last_type = path[i].ctype;
|
|
|
1036 }
|
|
|
1037 }
|
|
|
1038
|
|
|
1039 return cigar;
|
|
|
1040 }
|
|
|
1041
|
|
|
1042 #ifdef STDALN_MAIN
|
|
|
1043 int main()
|
|
|
1044 {
|
|
|
1045 AlnAln *aln_local, *aln_global, *aln_left;
|
|
|
1046 int i;
|
|
|
1047
|
|
|
1048 aln_local = aln_stdaln("CGTGCGATGCactgCATACGGCTCGCCTAGATCA", "AAGGGATGCTCTGCATCgCTCGGCTAGCTGT", &aln_param_blast, 0, 1);
|
|
|
1049 aln_global = aln_stdaln("CGTGCGATGCactgCATACGGCTCGCCTAGATCA", "AAGGGATGCTCTGCATCGgCTCGGCTAGCTGT", &aln_param_blast, 1, 1);
|
|
|
1050 // aln_left = aln_stdaln( "GATGCACTGCATACGGCTCGCCTAGATCA", "GATGCTCTGCATCGgCTCGGCTAGCTGT", &aln_param_blast, 2, 1);
|
|
|
1051 aln_left = aln_stdaln("CACCTTCGACTCACGTCTCATTCTCGGAGTCGAGTGGACGGTCCCTCATACACGAACAGGTTC",
|
|
|
1052 "CACCTTCGACTTTCACCTCTCATTCTCGGACTCGAGTGGACGGTCCCTCATCCAAGAACAGGGTCTGTGAAA", &aln_param_blast, 2, 1);
|
|
|
1053
|
|
|
1054 printf(">%d,%d\t%d,%d\n", aln_local->start1, aln_local->end1, aln_local->start2, aln_local->end2);
|
|
|
1055 printf("%s\n%s\n%s\n", aln_local->out1, aln_local->outm, aln_local->out2);
|
|
|
1056
|
|
|
1057 printf(">%d,%d\t%d,%d\t", aln_global->start1, aln_global->end1, aln_global->start2, aln_global->end2);
|
|
|
1058 for (i = 0; i != aln_global->n_cigar; ++i)
|
|
|
1059 printf("%d%c", aln_global->cigar32[i]>>4, "MID"[aln_global->cigar32[i]&0xf]);
|
|
|
1060 printf("\n%s\n%s\n%s\n", aln_global->out1, aln_global->outm, aln_global->out2);
|
|
|
1061
|
|
|
1062 printf(">%d\t%d,%d\t%d,%d\t", aln_left->score, aln_left->start1, aln_left->end1, aln_left->start2, aln_left->end2);
|
|
|
1063 for (i = 0; i != aln_left->n_cigar; ++i)
|
|
|
1064 printf("%d%c", aln_left->cigar32[i]>>4, "MID"[aln_left->cigar32[i]&0xf]);
|
|
|
1065 printf("\n%s\n%s\n%s\n", aln_left->out1, aln_left->outm, aln_left->out2);
|
|
|
1066
|
|
|
1067 aln_free_AlnAln(aln_local);
|
|
|
1068 aln_free_AlnAln(aln_global);
|
|
|
1069 aln_free_AlnAln(aln_left);
|
|
|
1070 return 0;
|
|
|
1071 }
|
|
|
1072 #endif
|